spacer

EBI Dbfetch

ID   AF009681; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AF009681;
XX
DT   15-AUG-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class I antigen HLA-B (allele B15) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Cao K., Burdett L., Zhang G.H., Fernandez-Vina M.A., Hillenbach J.,
RA   Klitz W.;
RT   ;
RL   Submitted (23-JUN-1997) to the INSDC.
RL   Nat. Histo. Lab, American Red Cross, 22 S. Greene St., Baltimore, MD 21201,
RL   USA
XX
DR   MD5; fa1ef0bff5f0ce04c3ae10bef5978d64.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /note="ZA016"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /number=3
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:O19512"
FT                   /db_xref="IMGT/HLA:B*15:39:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19512"
FT                   /protein_id="AAB66707.1"
FT                   /translation="SHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRA"
XX
SQ   Sequence 276 BP; 52 A; 86 C; 104 G; 34 T; 0 other;
     ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer