spacer

EBI Dbfetch

ID   AF004569; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF004569;
XX
DT   10-MAR-1998 (Rel. 54, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Arvicanthis niloticus cytochrome b (cytb) gene, mitochondrial gene encoding
DE   mitochondrial protein, partial cds.
XX
KW   .
XX
OS   Arvicanthis niloticus (African grass rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Arvicanthis.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RX   DOI; 10.1006/mpev.1997.0477.
RX   PUBMED; 9751921.
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   "A molecular perspective on the systematics and evolution of the genus
RT   Arvicanthis (Rodentia, Muridae): inferences from complete cytochrome b gene
RT   sequences";
RL   Mol. Phylogenet. Evol. 10(1):104-117(1998).
XX
RN   [2]
RP   1-1140
RA   Ducroz J.-F., Volobouev V., Granjon L.;
RT   ;
RL   Submitted (19-MAY-1997) to the INSDC.
RL   Zoologie, Mammiferes et Oiseaux, Museum National d'Histoire Naturelle, 55
RL   rue Buffon, Paris 75005, France
XX
DR   MD5; 7939feded34772c0e012d224a1bdb40f.
DR   EuropePMC; PMC2490707; 18616808.
DR   EuropePMC; PMC3815218; 24223730.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Arvicanthis niloticus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /note="Geographic origin: Egypt"
FT                   /db_xref="taxon:61156"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:O47508"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:O47508"
FT                   /protein_id="AAC04646.1"
FT                   /translation="MTNIRKTHPLLKIINHSFIDLPAPSNISSWWNFGSLLGICLMLQI
FT                   ITGLFLAMHYTSDTTTAFSSVAHICRDVNYGWLMRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYTFLETWNIGVVLLFTVMATAFMGYVLPWGQMSFWGATVSTNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTTKDILGILMMFIFLMTLVLFFPDLLGDPDNYMPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALLPFLHTSKQRSLIFRPITQTLYWMLVANLFILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGMIEDKMLKWN"
XX
SQ   Sequence 1140 BP; 365 A; 305 C; 142 G; 328 T; 0 other;
     atgacaaaca tccgaaaaac acatccccta cttaaaatta ttaaccactc atttattgac        60
     ctacccgccc catctaatat ctcatcgtga tgaaattttg gctctctact aggaatctgc       120
     ttaatattac aaattatcac aggcctattt ctagctatac actacacatc agatacaaca       180
     acagcattct cctcagtagc acacatttgc cgagacgtaa attatgggtg actaatacga       240
     tatatacacg ctaatggggc ttcaatattt tttatctgct tatttctaca cgtagggcga       300
     ggaatatact acggatccta cacattcctt gaaacatgaa acattggagt agtattgcta       360
     tttacagtaa tagccacagc attcataggc tatgtacttc catgaggaca aatatcattc       420
     tgaggggcaa cagtaagcac aaacctactt tcagctatcc catatattgg taccacctta       480
     gtggaatgaa tttgaggggg cttctcagta gataaagcca cactaactcg attcttcgca       540
     ttccacttca ttctcccatt tattattaca gccctcgtca tcgttcacct tttatttctc       600
     catgaaacag gctcaaacaa cccaacaggc ctaaactcag acgcagataa aattccattc       660
     catccatact atactaccaa agacatccta ggaatcctaa taatatttat tttcctaata       720
     accttagtac tattcttccc agacctacta ggagaccctg acaattatat accagccaac       780
     ccactcaata caccacctca catcaaacca gagtggtact tcctatttgc ctatgctatt       840
     ctacgctcca tccccaacaa actaggaggc gtcctagctc taattctatc tatccttatt       900
     ctagccctac taccatttct acacacctcc aaacaacgca gcttaatctt ccgtccaatt       960
     acccaaaccc tatactgaat actagtagca aacctattca tcttaacctg aatcggaggc      1020
     caaccagtag aacacccatt tatcatcatt ggtcaactag cttctatcag ttacttctct      1080
     attatcctaa tcctcatgcc aatctcagga ataattgaag acaaaatact aaaatgaaac      1140
//


spacer
spacer