spacer

EBI Dbfetch

ID   AH006126; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH006126; AF003283-AF003284;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen HLA-C (HLA-C) gene, HLA-Cw*0306 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   PUBMED; 9686604.
RA   Turner S., Ellexson M.E., Hickman H.D., Sidebottom D.A., Fernandez-Vina M.,
RA   Confer D.L., Hildebrand W.H.;
RT   "Sequence-based typing provides a new look at HLA-C diversity";
RL   J. Immunol. 161(3):1406-1413(1998).
XX
RN   [2]
RP   1-646
RA   Ellexson M.E., Sidebottom D., Turner S., Hildebrand W.H.;
RT   ;
RL   Submitted (29-APR-1997) to the INSDC.
RL   Medicine, Univ. of OK Health Sciences Center, P.O. Box 26901, Oklahoma
RL   City, OK 73190, USA
XX
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:3165450, gi:3165451, gi:3165452.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0306"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0306"
FT                   /product="MHC class I antigen HLA-C"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0306"
FT                   /product="MHC class I antigen HLA-C"
FT                   /db_xref="GOA:P04222"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1EFX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04222"
FT                   /protein_id="AAC17716.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYVQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLKNGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0306"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0306"
FT                   /number=3
XX
SQ   Sequence 646 BP; 106 A; 165 C; 200 G; 75 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggggagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtatggct gcgacgtggg gcccgacggg       420
     cgcctcctcc gcgggtatgt ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggatctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctgaagaa tgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer