spacer

EBI Dbfetch

ID   AF000998; SV 1; linear; mRNA; STD; MUS; 7478 BP.
XX
AC   AF000998;
XX
DT   26-MAY-1997 (Rel. 52, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus CLOCK (Clock) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-7478
RX   DOI; 10.1016/S0092-8674(00)80246-9.
RX   PUBMED; 9160756.
RA   Antoch M.P., Song E.J., Chang A.M., Vitaterna M.H., Zhao Y.,
RA   Wilsbacher L.D., Sangoram A.M., King D.P., Pinto L.H., Takahashi J.S.;
RT   "Functional identification of the mouse circadian Clock gene by transgenic
RT   BAC rescue";
RL   Cell 89(4):655-667(1997).
XX
RN   [2]
RP   1-7478
RX   DOI; 10.1016/S0092-8674(00)80245-7.
RX   PUBMED; 9160755.
RA   King D.P., Zhao Y., Sangoram A.M., Wilsbacher L.D., Tanaka M., Antoch M.P.,
RA   Steeves T.D.L., Vitaterna M.H., Kornhauser J.M., Lowrey P.L., Turek F.W.,
RA   Takahashi J.S.;
RT   "Positional cloning of the mouse circadian clock gene";
RL   Cell 89(4):641-653(1997).
XX
RN   [3]
RP   1-7478
RA   King D.P., Zhao Y., Sangoram A.M., Wilsbacher L.D., Tanaka M., Antoch M.P.,
RA   Steeves T.D.L., Vitaterna M.H., Kornhauser J.M., Lowrey P.L., Turek F.W.,
RA   Takahashi J.S.;
RT   ;
RL   Submitted (23-APR-1997) to the INSDC.
RL   Neurobiology and Physiology, Northwestern University, 2153 North Campus
RL   Dr., Evanston, IL 60208, USA
XX
DR   MD5; 13322c366338f5a9fd8d4865ff78754f.
DR   Ensembl-Gn; ENSMUSG00000029238; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075159; mus_musculus.
DR   EuropePMC; PMC129793; 12374857.
DR   EuropePMC; PMC1802832; 17319750.
DR   EuropePMC; PMC18243; 10760301.
DR   EuropePMC; PMC19657; 9501178.
DR   EuropePMC; PMC2383916; 18430226.
DR   EuropePMC; PMC2628734; 19173005.
DR   EuropePMC; PMC28377; 9391097.
DR   EuropePMC; PMC311151; 11591652.
DR   EuropePMC; PMC313079; 11116088.
DR   EuropePMC; PMC3815553; 9160755.
DR   EuropePMC; PMC61113; 11707566.
DR   EuropePMC; PMC98974; 10357859.
XX
CC   The submitted sequence is described as mRNA in this record but is
CC   from multiple genomic sequence which are from BAC clones (which are
CC   derived from a 129 strain background) as well as several
CC   overlapping partial cDNA clones (from C57BL/6J and BALB/cJ strain
CC   backgrounds.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7478
FT                   /organism="Mus musculus"
FT                   /chromosome="5"
FT                   /strain="129"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             389..2956
FT                   /codon_start=1
FT                   /gene="Clock"
FT                   /product="CLOCK"
FT                   /db_xref="GOA:O08785"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001067"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="MGI:MGI:99698"
FT                   /db_xref="PDB:4F3L"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08785"
FT                   /protein_id="AAC53200.1"
FT                   /translation="MVFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKK
FT                   RRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTF
FT                   LSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEH
FT                   SEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSL
FT                   TSVSTSTHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHS
FT                   LEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYR
FT                   FLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETA
FT                   ADKSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTD
FT                   TSTPPRQHLPAHEKMTQRRSSFSSQSINSQSVGPSLTQPAMSQAANLPIPQGMSQFQFS
FT                   AQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNF
FT                   GSVQLSSGNSNIQQLTPVNMQGQVVPANQVQSGHISTGQHMIQQQTLQSTSTQQSQQSV
FT                   MSGHSQQTSLPSQTPSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSATVTTFTQD
FT                   RQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQAQTLSVTQQQ
FT                   QQQQQQPPQQQQQQQQSSQEQQLPSVQQPAQAQLGQPPQQFLQTSRLLHGNPSTQLILS
FT                   AAFPLQQSTFPPSHHQQHQPQQQQQLPRHRTDSLTDPSKVQPQ"
XX
SQ   Sequence 7478 BP; 2177 A; 1534 C; 1616 G; 2151 T; 0 other;
     ggggaggagc gcggcggtag cggtgaattt tgaggggtgg gtcgggggcg cgcactcgcc        60
     gcccctggtg ctgccggctc ccggagccgt ggcgtgtccc tgctgtcgcc gctcggctgt       120
     cgcgagccgc cgcgggcaga gtcccgggcg ggggagggag gaagccggag cctcaggcac       180
     gtgaaagaaa agcacaagaa gaaactttta caggcgttgt tgattggact agggcaacga       240
     ttcccaaaat caccagcaag agttctgatg gtcagtcaca cagaagacgg ccttgcgtct       300
     gtgggtgttg gagactccat tctaaagata taaaaagtga aagaggagaa gtacaaatgt       360
     ctaccacaag acgaaaacat aatgtgttat ggtgtttacc gtaagctgta gtaaaatgag       420
     ctcaattgtt gacagagatg acagtagtat ttttgatgga ttggtggaag aagatgacaa       480
     ggacaaagca aaaagagtat ctagaaacaa atcagaaaag aaacgtagag atcagttcaa       540
     tgtcctcatt aaggagctgg ggtctatgct tcctggtaac gcgagaaaga tggacaagtc       600
     tactgttcta cagaagagca ttgatttttt gcgcaaacat aaagagacca ctgcacagtc       660
     agatgctagt gagattcgac aggactggaa acccacattc cttagtaatg aagagtttac       720
     acagttaatg ttagaggctc ttgatggttt ttttttagcg atcatgacag atggaagtat       780
     aatatatgta tctgagagtg taacttcgtt acttgaacat ttaccatctg atcttgtgga       840
     tcaaagtata tttaatttta tcccagaggg agaacattca gaggtttata agatactctc       900
     tactcatctg ctggaaagtg actcattaac ccctgagtac ttaaaatcaa aaaatcagtt       960
     agaattctgt tgtcacatgc ttcgaggaac aatagaccca aaggagccat ccacctatga      1020
     atatgtgaga tttataggaa attttaaatc tttaaccagt gtatcaactt caacacacaa      1080
     tggttttgaa ggaactatac aacgcacaca taggccttct tatgaagata gagtttgttt      1140
     tgtagctact gtcagattag ctacacctca gttcatcaag gaaatgtgta ctgttgaaga      1200
     accaaatgaa gagtttacat ctagacacag tttagaatgg aagtttctat ttttagatca      1260
     cagggcacca ccaataatag gctatttgcc atttgaagtc ttgggaacat caggctatga      1320
     ttactatcat gtggatgacc tagaaaatct ggcaaaatgt cacgagcact taatgcaata      1380
     tggaaaaggc aaatcgtgtt actatagatt cctgaccaaa ggccagcagt ggatatggct      1440
     tcagactcat tattatatta cttaccatca gtggaattca aggccagagt tcattgtttg      1500
     tactcacact gtagtaagtt atgcagaagt tagggctgaa agacggcgag aacttggcat      1560
     tgaagagtct cttcctgaga cagctgctga caaaagccaa gattctgggt ctgacaatcg      1620
     tatcaacaca gtgagtctca aggaagcact ggaaaggttt gatcacagcc caactccttc      1680
     tgcctcctct agaagctcac gaaagtcatc tcacaccgca gtctcagacc cttcctccac      1740
     accgacaaag atccctactg atactagcac tcctcccaga cagcatttgc cagctcatga      1800
     aaagatgaca cagcggaggt cgtccttcag cagtcagtcc ataaactccc agtcagttgg      1860
     tccatcatta acacagccag cgatgtctca agctgcaaat ttaccaattc cacaaggcat      1920
     gtcacagttt cagttttcag ctcagttagg agccatgcag catctaaaag accagctaga      1980
     gcagcggaca cggatgatag aggcaaatat tcatcggcag caagaagaac taaggaaaat      2040
     tcaagagcaa cttcagatgg tccatggtca agggctacag atgtttttgc agcaatcaaa      2100
     ccctggattg aattttggtt ctgttcaact ttcctctgga aattctaata tccagcagct      2160
     cacacctgta aatatgcaag gccaggttgt ccctgctaac caggttcaga gtggacatat      2220
     cagcacaggc cagcacatga tacagcaaca gactttacaa agtacatcaa ctcagcagag      2280
     tcaacagagt gtaatgagtg gacacagtca gcagacgtct cttccaagtc agacaccgag      2340
     cactctcaca gccccactgt acaatacgat ggtgatttcc cagcctgcag ctgggagcat      2400
     ggtccagatt ccatccagta tgccacagaa cagtacccag agtgctacag tcactacgtt      2460
     cactcaggac agacagataa gattttctca aggtcagcaa cttgtgacca aattagtgac      2520
     tgctcctgta gcttgtgggg ccgtcatggt accaagtacc atgcttatgg gtcaggtggt      2580
     gactgcctat cctaccttcg ccacacaaca gcagcaggca cagacattat cggtaacaca      2640
     acagcagcag cagcagcagc agcagccacc acagcaacag caacaacaac agcagagttc      2700
     ccaggaacag cagcttcctt cagttcagca gccagctcag gcccagctgg gccagccacc      2760
     acagcagttc ttacagacat ctaggttgct ccacgggaat ccttcgacac agctcatcct      2820
     ctctgctgcc tttccactac aacagagcac tttccctcct tcgcaccacc agcaacacca      2880
     gcctcagcag caacagcagc ttcctcggca caggactgac agcctgactg acccttccaa      2940
     ggtccagcca cagtagcaca cacacttcct ctctgacatg cgagaggaag gggatggcca      3000
     gaaagaatcg ctcagttggc atgcggtcag aagttgaaca gtttcacgag ggtggtcttg      3060
     agtgttcagt cccttgatga gacggtaggg aagtgctgcc cagtgcttca gatgtccatt      3120
     aaataccagc cagtgggaaa tggtcatagg gacacagcca attctgacag tttctttgcc      3180
     caggtatttt ttgatagaaa gagtatattg ccaaatgcta acaagctcag ctatcaacca      3240
     gatctttact gaatccgaag agcactaaca gtgttggtag ctttagtggg tctgtgcctg      3300
     catcaaatat tacagagggc acaccactgc caggggtttg cttagaatgc catgaagata      3360
     gtccagtagt taatagtccc caccccaaac tcctctccct gttcagacaa tgatggaacc      3420
     gtgatgactt tgagaatgtt gtgcaggttt gaattcactg tgtacagatg ctgtagtgtc      3480
     tctgtgtctg gatggaggag agaaagccac tttgatacag aaagcattat ctgtccctca      3540
     caggtatgag tgcatttcat taggtttgac accatgtaca aactgataac aacctctctt      3600
     ttttcatttt gtttacaaca cagtagtgtt ctcgttactt ttccagggca caagtctttt      3660
     tgtccgtgct ttggctgtga tgtcacagtt tgttcagtga ggtaacaatg tgctgctggg      3720
     aatggatttt tttaaggtta aattattgct acatttccac ttactcagaa atatccctta      3780
     tttcattatt tttcaattat gtttgagaga attgcactgc tttattattt tagatggttg      3840
     gttgagagtt taatcacata ttttgatata tttcatagtt ggaatattta tgtaaatggt      3900
     tttcaacaag cctgaaagta atttcaagaa tgtttcagtt gtaagagtaa agtttgcaca      3960
     caaaacattt taggcacttt tttaacattc tcagaggtgg gaattttaac ttttaggatt      4020
     tgttggaatc tttttattat ctttaaaaat ttcaatgctt cttttagtca gaaatgattc      4080
     agggttattt gaggggaaaa aacccatagt gccttgattt taattcaggt gataactcac      4140
     catcttgaat tcattgtctg gtttcagtag cagttttgaa accttagtac atttttagca      4200
     gcagtgtcat tctcaagtcc ccatgaggac tgctgcgtct cttgggctgc ctgacagcgt      4260
     cacagctggg aatgggatcc caaaatcgtt tcctgtttgc atcttcctct aaagctaagt      4320
     aactctttta ggaattacca gtaaatactt gctcagagac aagggacaag ttgtctttaa      4380
     ttttcattgc agcactagaa taatgtaact cacatgcttt ttaaacatta agatttcatt      4440
     tggcaatatc attctctaca ggtaataaac tccaacaaag ctacatacat tttaaaaggc      4500
     atttttttag attttatggt actaataatg agtttttcaa ttaaagaaca aaagatcagt      4560
     aggatataga atatcaagta ttactgagaa aagggaggat aagtgtggca cattagaatt      4620
     gaccttaaaa ggaaagtatg tgatggtgag gtgctaaact ggtttcagca gtgcagataa      4680
     cctaaggcag agttgctaga tcagggcttg gggaactcgg agtcagctat ctgtctctag      4740
     ctttgctctc atcatcagta agtgtgtctt tgttttcctg tttacctgac tgcaattaag      4800
     ttagcaagtt agtgataaaa agaaaacaac caaagaaaat tggtacctac tcttctgcgt      4860
     aagaagtgtg tctagatacc agtcagtaac tcacatatca cagaagttct tctagctgac      4920
     attcatacga ataccagaaa tagttgtgag aatacacatt tatgcaagtt tgtgcacacg      4980
     tgacgaaatc aatgtaagtc gagcacccac attgcttttc tcccttccac attgccttct      5040
     tctctttggc cattccatgt cctcggagtc ggagctgtgc ctcgtttatc tttttgcatc      5100
     acatagcgat aagaatttag ctacaggaga tacaacatgc tagttatgta atgcctgctg      5160
     ttcttcacag ttcatctccc tgcttaaaag tagcagttga taagaaactc tagctgctaa      5220
     ggctgctgtc cacacggaga tgcatgctgg gcaacagttg tcagcactag ctgcctctta      5280
     gctccttaat tcttggttcc tttggatggc aaactgtctt tgtctgctcc ccacacgact      5340
     ccagtattct gaagaaagtt catcttttgc ctgttcattt ctgtagccaa agctgactga      5400
     aaccccaaat ctaaatcatg aaaagatacc aaaaagaaac acttctcagc ttcttagaaa      5460
     ccttaacttc tcttgctgta tttcatggat ttgattttct ttgaaatttt tgattctggg      5520
     cagcgccttt taattaagaa attgttagga tgaaggtcaa acaggttctc attgccctgc      5580
     aggtaccttg ctctggactg cttctgtatg gggtgacttg gggttgctga acacacagga      5640
     ttagaacagt aaacacaaag ctgcccttga ggctggcgtt aaaccagagc ctcaatattg      5700
     aaaatatcaa gtcctctttc cttccttaga gacgagactg tgagaggaaa gcaactgtgg      5760
     taggtgggct tgcttgcaca tgagcaccaa gaccattccc caagctctat cctcagggta      5820
     gcatttagag tgctgtgttc tgctgtcaca tagacatggc ttagggatgt agcactaata      5880
     aaagaatgcc cgtgcttttg aatagttgtg atagcaaact ctaggctaac tagcaagtgt      5940
     ttgaattctg tgtgctgtat agtagttggt cattgcctta aagcagtctc ttggaagttg      6000
     ggagcactga agcagtccaa ccatatatgg gcatcacgtt gagggagatg agccttgttc      6060
     aagccttaga aaggaccctt agtctacaca ggtagattct tttcacttgg atattactgt      6120
     gtttaaaatg tttccactat gttgaggcag ttttttaaag tggaacacag ataggatttt      6180
     tagtatttct ttttttgttt ctttggtgat taaaggtttg ttggtagaca tttgtgtaaa      6240
     agttgttcaa gcctatcatc tttccagtac ttgtggtcct gttcttagta ccagagtcca      6300
     caatggaaag tgtaaacact ggatattaat attgctgagg gtgcatagcc aggtgtgagc      6360
     tgactggaac ttctcagtgg tgaagaaaca gcacaacggc acttgccatt ttcatagtga      6420
     ttgcataaag agaccttcta agtttgtctg gattgagtga acactcttct aagaggagct      6480
     tctcaagtaa atgcaaagga aaagagttga ctatttttat agcatattta atatatttgt      6540
     atataactat gagtgtagta ggaaccctcc acatgcctcc cacttttcta attccctccc      6600
     cttctgccgt agccctagtc cagcctcatc cgcatgggta atgtgcctac tgtcagccta      6660
     cctaccaaaa gatagtgctg ctgctttctg agacaggtga gatcagactc tcatgcctgg      6720
     ggatccttat gggaggaata gcacacactt agaacaacat accacagttt aagagcatca      6780
     ttttgaaagg taataagcac tttattgcaa ttattcattt agataaagtt tgtatcttag      6840
     gcattaaccg tttttaaagg atccctaatc atcacttagg tgaaatgata aacgacacat      6900
     ttctgagaaa tgttcaggtc cagtgaaccg tagcaggttt atgggaatga tttcaaggta      6960
     gccaaataaa ctctgacttt tgttttgaat gtggtggagt caggagattg tagatgtgta      7020
     gtttgattta aacactattg taaacctatc ttgcctattg tgtggacacc aaaagagacc      7080
     aatgagcctg tttattttca gaggtctagg aatatgcatc tgtctgagta gatatacaga      7140
     actaatctat aaacggttgg tagtaatatt ttaggataca gtaacttaaa gaattattga      7200
     gtgttttaaa tgtgccctga aatgttggca tgtcatttca gcgttcccat ttgagttgct      7260
     cttgtaatat ttttgcacaa aaaggactga gaaaagactg ctttggttga agaaaactat      7320
     aatttggtct tattttaatg tctcctgtgg aaacactgga ggtaaatttg ttggcatagt      7380
     tactaattca ggatatttaa aacagtgttg aacagctcat cagaaattaa gcaaacttat      7440
     atatttaaaa attaaaaatc tttttttcca tgtgactg                              7478
//


spacer
spacer