spacer

EBI Dbfetch

ID   AE014074; SV 1; circular; genomic DNA; STD; PRO; 1900521 BP.
XX
AC   AE014074; AE014136-AE014172;
XX
PR   Project:PRJNA311;
XX
DT   27-JAN-2006 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Streptococcus pyogenes MGAS315, complete genome.
XX
KW   .
XX
OS   Streptococcus pyogenes MGAS315
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
OS   Streptococcus pyogenes phage 315.1
OC   Viruses; unclassified phages.
XX
OS   Streptococcus pyogenes phage 315.2
OC   Viruses; unclassified phages.
XX
OS   Streptococcus pyogenes phage 315.3
OC   Viruses; unclassified phages.
XX
OS   Streptococcus pyogenes phage 315.4
OC   Viruses; unclassified phages.
XX
OS   Streptococcus pyogenes phage 315.5
OC   Viruses; unclassified phages.
XX
OS   Streptococcus pyogenes phage 315.6
OC   Viruses; unclassified phages.
XX
RN   [1]
RP   1-1900521
RX   DOI; 10.1073/pnas.152298499.
RX   PUBMED; 12122206.
RA   Beres S.B., Sylva G.L., Barbian K.D., Lei B., Hoff J.S., Mammarella N.D.,
RA   Liu M.Y., Smoot J.C., Porcella S.F., Parkins L.D., Campbell D.S.,
RA   Smith T.M., McCormick J.K., Leung D.Y., Schlievert P.M., Musser J.M.;
RT   "Genome sequence of a serotype M3 strain of group A Streptococcus:
RT   phage-encoded toxins, the high-virulence phenotype, and clone emergence";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(15):10078-10083(2002).
XX
RN   [2]
RP   1-1900521
RA   Beres S.B., Sylva G.L., Barbian K.D., Lei B., Hoff J.S., Mammarella N.D.,
RA   Liu M.-Y., Smoot J.C., Porcella S.F., Parkins L.D., McCormick J.K.,
RA   Leung D.Y.M., Schlievert P.M., Musser J.M.;
RT   ;
RL   Submitted (14-JUN-2002) to the INSDC.
RL   Laboratory of Human-Bacterial Pathogenesis, Rocky Mountain Laboratories,
RL   NIAID, NIH, 903 South Fourth St., Hamilton, MT 59840, USA
XX
DR   MD5; b37116fe54782755b4986e556d05d2e6.
DR   BioSample; SAMN02603496.
DR   EnsemblGenomes-Gn; SpyM3_r01.
DR   EnsemblGenomes-Gn; SpyM3_r02.
DR   EnsemblGenomes-Gn; SpyM3_r03.
DR   EnsemblGenomes-Gn; SpyM3_r04.
DR   EnsemblGenomes-Gn; SpyM3_r05.
DR   EnsemblGenomes-Gn; SpyM3_r06.
DR   EnsemblGenomes-Gn; SpyM3_r07.
DR   EnsemblGenomes-Gn; SpyM3_r08.
DR   EnsemblGenomes-Gn; SpyM3_r09.
DR   EnsemblGenomes-Gn; SpyM3_r10.
DR   EnsemblGenomes-Gn; SpyM3_r11.
DR   EnsemblGenomes-Gn; SpyM3_r12.
DR   EnsemblGenomes-Gn; SpyM3_s01.
DR   EnsemblGenomes-Gn; SpyM3_t01.
DR   EnsemblGenomes-Gn; SpyM3_t02.
DR   EnsemblGenomes-Gn; SpyM3_t03.
DR   EnsemblGenomes-Gn; SpyM3_t04.
DR   EnsemblGenomes-Gn; SpyM3_t05.
DR   EnsemblGenomes-Gn; SpyM3_t06.
DR   EnsemblGenomes-Gn; SpyM3_t07.
DR   EnsemblGenomes-Gn; SpyM3_t08.
DR   EnsemblGenomes-Gn; SpyM3_t09.
DR   EnsemblGenomes-Gn; SpyM3_t10.
DR   EnsemblGenomes-Gn; SpyM3_t11.
DR   EnsemblGenomes-Gn; SpyM3_t12.
DR   EnsemblGenomes-Gn; SpyM3_t13.
DR   EnsemblGenomes-Gn; SpyM3_t14.
DR   EnsemblGenomes-Gn; SpyM3_t15.
DR   EnsemblGenomes-Gn; SpyM3_t16.
DR   EnsemblGenomes-Gn; SpyM3_t17.
DR   EnsemblGenomes-Gn; SpyM3_t18.
DR   EnsemblGenomes-Gn; SpyM3_t19.
DR   EnsemblGenomes-Gn; SpyM3_t20.
DR   EnsemblGenomes-Gn; SpyM3_t21.
DR   EnsemblGenomes-Gn; SpyM3_t22.
DR   EnsemblGenomes-Gn; SpyM3_t23.
DR   EnsemblGenomes-Gn; SpyM3_t24.
DR   EnsemblGenomes-Gn; SpyM3_t25.
DR   EnsemblGenomes-Gn; SpyM3_t26.
DR   EnsemblGenomes-Gn; SpyM3_t27.
DR   EnsemblGenomes-Gn; SpyM3_t28.
DR   EnsemblGenomes-Gn; SpyM3_t29.
DR   EnsemblGenomes-Gn; SpyM3_t30.
DR   EnsemblGenomes-Gn; SpyM3_t31.
DR   EnsemblGenomes-Gn; SpyM3_t32.
DR   EnsemblGenomes-Gn; SpyM3_t33.
DR   EnsemblGenomes-Gn; SpyM3_t34.
DR   EnsemblGenomes-Gn; SpyM3_t35.
DR   EnsemblGenomes-Gn; SpyM3_t36.
DR   EnsemblGenomes-Gn; SpyM3_t37.
DR   EnsemblGenomes-Gn; SpyM3_t38.
DR   EnsemblGenomes-Gn; SpyM3_t39.
DR   EnsemblGenomes-Gn; SpyM3_t40.
DR   EnsemblGenomes-Gn; SpyM3_t41.
DR   EnsemblGenomes-Gn; SpyM3_t42.
DR   EnsemblGenomes-Gn; SpyM3_t43.
DR   EnsemblGenomes-Gn; SpyM3_t44.
DR   EnsemblGenomes-Gn; SpyM3_t45.
DR   EnsemblGenomes-Gn; SpyM3_t46.
DR   EnsemblGenomes-Gn; SpyM3_t47.
DR   EnsemblGenomes-Gn; SpyM3_t48.
DR   EnsemblGenomes-Gn; SpyM3_t49.
DR   EnsemblGenomes-Gn; SpyM3_t50.
DR   EnsemblGenomes-Gn; SpyM3_t51.
DR   EnsemblGenomes-Gn; SpyM3_t52.
DR   EnsemblGenomes-Gn; SpyM3_t53.
DR   EnsemblGenomes-Gn; SpyM3_t54.
DR   EnsemblGenomes-Gn; SpyM3_t55.
DR   EnsemblGenomes-Gn; SpyM3_t56.
DR   EnsemblGenomes-Gn; SpyM3_t57.
DR   EnsemblGenomes-Gn; SpyM3_t58.
DR   EnsemblGenomes-Gn; SpyM3_t59.
DR   EnsemblGenomes-Gn; SpyM3_t60.
DR   EnsemblGenomes-Gn; SpyM3_t61.
DR   EnsemblGenomes-Gn; SpyM3_t62.
DR   EnsemblGenomes-Gn; SpyM3_t63.
DR   EnsemblGenomes-Gn; SpyM3_t64.
DR   EnsemblGenomes-Gn; SpyM3_t65.
DR   EnsemblGenomes-Gn; SpyM3_t66.
DR   EnsemblGenomes-Gn; SpyM3_t67.
DR   EnsemblGenomes-Tr; SpyM3_r01.
DR   EnsemblGenomes-Tr; SpyM3_r02.
DR   EnsemblGenomes-Tr; SpyM3_r03.
DR   EnsemblGenomes-Tr; SpyM3_r04.
DR   EnsemblGenomes-Tr; SpyM3_r05.
DR   EnsemblGenomes-Tr; SpyM3_r06.
DR   EnsemblGenomes-Tr; SpyM3_r07.
DR   EnsemblGenomes-Tr; SpyM3_r08.
DR   EnsemblGenomes-Tr; SpyM3_r09.
DR   EnsemblGenomes-Tr; SpyM3_r10.
DR   EnsemblGenomes-Tr; SpyM3_r11.
DR   EnsemblGenomes-Tr; SpyM3_r12.
DR   EnsemblGenomes-Tr; SpyM3_s01.
DR   EnsemblGenomes-Tr; SpyM3_t01.
DR   EnsemblGenomes-Tr; SpyM3_t02.
DR   EnsemblGenomes-Tr; SpyM3_t03.
DR   EnsemblGenomes-Tr; SpyM3_t04.
DR   EnsemblGenomes-Tr; SpyM3_t05.
DR   EnsemblGenomes-Tr; SpyM3_t06.
DR   EnsemblGenomes-Tr; SpyM3_t07.
DR   EnsemblGenomes-Tr; SpyM3_t08.
DR   EnsemblGenomes-Tr; SpyM3_t09.
DR   EnsemblGenomes-Tr; SpyM3_t10.
DR   EnsemblGenomes-Tr; SpyM3_t11.
DR   EnsemblGenomes-Tr; SpyM3_t12.
DR   EnsemblGenomes-Tr; SpyM3_t13.
DR   EnsemblGenomes-Tr; SpyM3_t14.
DR   EnsemblGenomes-Tr; SpyM3_t15.
DR   EnsemblGenomes-Tr; SpyM3_t16.
DR   EnsemblGenomes-Tr; SpyM3_t17.
DR   EnsemblGenomes-Tr; SpyM3_t18.
DR   EnsemblGenomes-Tr; SpyM3_t19.
DR   EnsemblGenomes-Tr; SpyM3_t20.
DR   EnsemblGenomes-Tr; SpyM3_t21.
DR   EnsemblGenomes-Tr; SpyM3_t22.
DR   EnsemblGenomes-Tr; SpyM3_t23.
DR   EnsemblGenomes-Tr; SpyM3_t24.
DR   EnsemblGenomes-Tr; SpyM3_t25.
DR   EnsemblGenomes-Tr; SpyM3_t26.
DR   EnsemblGenomes-Tr; SpyM3_t27.
DR   EnsemblGenomes-Tr; SpyM3_t28.
DR   EnsemblGenomes-Tr; SpyM3_t29.
DR   EnsemblGenomes-Tr; SpyM3_t30.
DR   EnsemblGenomes-Tr; SpyM3_t31.
DR   EnsemblGenomes-Tr; SpyM3_t32.
DR   EnsemblGenomes-Tr; SpyM3_t33.
DR   EnsemblGenomes-Tr; SpyM3_t34.
DR   EnsemblGenomes-Tr; SpyM3_t35.
DR   EnsemblGenomes-Tr; SpyM3_t36.
DR   EnsemblGenomes-Tr; SpyM3_t37.
DR   EnsemblGenomes-Tr; SpyM3_t38.
DR   EnsemblGenomes-Tr; SpyM3_t39.
DR   EnsemblGenomes-Tr; SpyM3_t40.
DR   EnsemblGenomes-Tr; SpyM3_t41.
DR   EnsemblGenomes-Tr; SpyM3_t42.
DR   EnsemblGenomes-Tr; SpyM3_t43.
DR   EnsemblGenomes-Tr; SpyM3_t44.
DR   EnsemblGenomes-Tr; SpyM3_t45.
DR   EnsemblGenomes-Tr; SpyM3_t46.
DR   EnsemblGenomes-Tr; SpyM3_t47.
DR   EnsemblGenomes-Tr; SpyM3_t48.
DR   EnsemblGenomes-Tr; SpyM3_t49.
DR   EnsemblGenomes-Tr; SpyM3_t50.
DR   EnsemblGenomes-Tr; SpyM3_t51.
DR   EnsemblGenomes-Tr; SpyM3_t52.
DR   EnsemblGenomes-Tr; SpyM3_t53.
DR   EnsemblGenomes-Tr; SpyM3_t54.
DR   EnsemblGenomes-Tr; SpyM3_t55.
DR   EnsemblGenomes-Tr; SpyM3_t56.
DR   EnsemblGenomes-Tr; SpyM3_t57.
DR   EnsemblGenomes-Tr; SpyM3_t58.
DR   EnsemblGenomes-Tr; SpyM3_t59.
DR   EnsemblGenomes-Tr; SpyM3_t60.
DR   EnsemblGenomes-Tr; SpyM3_t61.
DR   EnsemblGenomes-Tr; SpyM3_t62.
DR   EnsemblGenomes-Tr; SpyM3_t63.
DR   EnsemblGenomes-Tr; SpyM3_t64.
DR   EnsemblGenomes-Tr; SpyM3_t65.
DR   EnsemblGenomes-Tr; SpyM3_t66.
DR   EnsemblGenomes-Tr; SpyM3_t67.
DR   EuropePMC; PMC1112048; 15901699.
DR   EuropePMC; PMC1142405; 15933207.
DR   EuropePMC; PMC126627; 12122206.
DR   EuropePMC; PMC1392966; 16461700.
DR   EuropePMC; PMC1797367; 17028269.
DR   EuropePMC; PMC1855836; 17277061.
DR   EuropePMC; PMC1976330; 17941709.
DR   EuropePMC; PMC2657157; 19175920.
DR   EuropePMC; PMC303441; 14679231.
DR   EuropePMC; PMC3034890; 21103900.
DR   EuropePMC; PMC3091779; 21106082.
DR   EuropePMC; PMC3462185; 23049698.
DR   EuropePMC; PMC3675131; 23762235.
DR   EuropePMC; PMC403657; 12799345.
DR   GOA; P0DE42.
DR   InterPro; IPR011332; Ribosomal_zn-bd.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02099; rivX.
DR   SILVA-LSU; AE014074.
DR   SILVA-SSU; AE014074.
DR   StrainInfo; 352256; 0.
DR   UniProtKB/Swiss-Prot; P0DE42; RL332_STRP3.
XX
CC   On or before Jan 26, 2006 this sequence version replaced
CC   gi:21903716, gi:21903746, gi:21903795, gi:21903849, gi:21903894,
CC   gi:21903940, gi:21903990, gi:21904039, gi:21904092, gi:21904143,
CC   gi:21904188, gi:21904236, gi:21904285, gi:21904329, gi:21904382,
CC   gi:21904439, gi:21904494, gi:21904545, gi:21904594, gi:21904646,
CC   gi:21904714, gi:21904768, gi:21904816, gi:21904885, gi:21904935,
CC   gi:21905010, gi:21905065, gi:21905124, gi:21905178, gi:21905237,
CC   gi:21905292, gi:21905337, gi:21905387, gi:21905429, gi:21905475,
CC   gi:21905523, gi:21905566.
XX
FH   Key             Location/Qualifiers
FH
FT   source          order(1..749107,788646..977266,1018339..1137553,
FT                   1171973..1230114,1271911..1332006,1351400..1434091,
FT                   1450556..1900521)
FT                   /organism="Streptococcus pyogenes MGAS315"
FT                   /focus
FT                   /strain="MGAS315"
FT                   /serotype="M3"
FT                   /mol_type="genomic DNA"
FT                   /note="group: A"
FT                   /db_xref="taxon:198466"
FT   source          749108..788645
FT                   /organism="Streptococcus pyogenes phage 315.1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:198538"
FT   source          977267..1018338
FT                   /organism="Streptococcus pyogenes phage 315.2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:198539"
FT   source          1137554..1171972
FT                   /organism="Streptococcus pyogenes phage 315.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:198540"
FT   source          1230115..1271910
FT                   /organism="Streptococcus pyogenes phage 315.4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:198541"
FT   source          1332007..1351399
FT                   /organism="Streptococcus pyogenes phage 315.5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:198542"
FT   source          1434092..1450555
FT                   /organism="Streptococcus pyogenes phage 315.6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:198543"
FT   gene            232..1587
FT                   /gene="dnaA"
FT                   /locus_tag="SpyM3_0001"
FT   CDS             232..1587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SpyM3_0001"
FT                   /product="chromosomal initiator protein"
FT                   /note="best blastp hit: gb|AAF71535.1|AF255728_1 (AF255728)
FT                   chromosomal initiator protein DnaA [Streptococcus
FT                   pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78608"
FT                   /db_xref="GOA:P0DA68"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA68"
FT                   /protein_id="AAM78608.1"
FT                   /translation="MTENEQIFWNRVLELAQSQLKQATYEFFVHDARLLKVDKHIATIY
FT                   LDQMKELFWEKNLKDVILTAGFEVYNAQISVDYVFEEDLMIEQNQTKINQKPKQQALNS
FT                   LPTVTSDLNSKYSFENFIQGDENRWAVAASIAVANTPGTTYNPLFIWGGPGLGKTHLLN
FT                   AIGNSVLLENPNARIKYITAENFINEFVIHIRLDTMDELKEKFRNLDLLLIDDIQSLAK
FT                   KTLSGTQEEFFNTFNALHNNNKQIVLTSDRTPDHLNDLEDRLVTRFKWGLTVNITPPDF
FT                   ETRVAILTNKIQEYNFIFPQDTIEYLAGQFDSNVRDLEGALKDISLVANFKQIDTITVD
FT                   IAAEAIRARKQDGPKMTVIPIEEIQAQVGKFYGVTVKEIKATKRTQNIVLARQVAMFLA
FT                   REMTDNSLPKIGKEFGGRDHSTVLHAYNKIKNMISQDESLRIEIETIKNKIK"
FT   gene            1742..2878
FT                   /gene="dnaN"
FT                   /locus_tag="SpyM3_0002"
FT   CDS             1742..2878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SpyM3_0002"
FT                   /product="beta subunit of DNA polymerase III"
FT                   /note="best blastp hit: gb|AAK33147.1| (AE006472) beta
FT                   subunit of DNA polymerase III [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78609"
FT                   /db_xref="GOA:Q8K8Z9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Z9"
FT                   /protein_id="AAM78609.1"
FT                   /translation="MIQFSINRTLFIHALNATKRAISTKNAIPILSSIKIEVTPTGVTL
FT                   TGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDININVKEIEQHQV
FT                   VLTSGKSEITLKGKDVDQYPRLQEVSTENPLILKTKLLKSIIAETAFAASLQESRPILT
FT                   GVHIVLSNHKDFKAVATDSHRMSQRLITLDNTSADFDVVIPGKSLREFSAVFTDDIETV
FT                   EVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLI
FT                   SNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKA
FT                   IKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVRTN"
FT   gene            2953..3150
FT                   /locus_tag="SpyM3_0003"
FT   CDS             2953..3150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0003"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAC45338.1| (AF000658)
FT                   ORFX [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78610"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFM2"
FT                   /protein_id="AAM78610.1"
FT                   /translation="MYQIGSFVEMKKPHACVIKETGKKANQWKVLRVGADIKIQCTNCQ
FT                   HVIMMSRYDFERKLKKVLQP"
FT   gene            3480..4595
FT                   /locus_tag="SpyM3_0004"
FT   CDS             3480..4595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0004"
FT                   /product="putative GTP-binding protein"
FT                   /note="best blastp hit: gb|AAK33149.1| (AE006472) putative
FT                   GTP-binding protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78611"
FT                   /db_xref="GOA:Q8K8Z8"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Z8"
FT                   /protein_id="AAM78611.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTELITPKKTVPTTFEFTDIAGIVKGASRGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPVADIDTINLELILADLESINKRYARVEKMARTQKDKES
FT                   VAEFNVLQKIKPVLEDGKSARTIEFTDEEAKVVKGLFLLTTKPVLYVANVDEDKVANPD
FT                   GIDYVKQIRDFAATENAEVVVISARAEEEILELDDEDKEEFLEAIGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGIKAPQAAGIIHSDFERGFIRAVTMSYDDLMTYSS
FT                   EKAVKEAGRLREEGKEYVVQDGDIMEFRFNV"
FT   gene            4665..5234
FT                   /gene="pth"
FT                   /locus_tag="SpyM3_0005"
FT   CDS             4665..5234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SpyM3_0005"
FT                   /product="putative peptidyl-tRNA hydrolase"
FT                   /note="best blastp hit: gb|AAK33150.1| (AE006472) putative
FT                   peptidyl-tRNA hydrolase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78612"
FT                   /db_xref="GOA:P0DD50"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD50"
FT                   /protein_id="AAM78612.1"
FT                   /translation="MVKMIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTFTDDKNFK
FT                   AQIGSTFINHEKVCFVKPTTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRL
FT                   RSKGSAGGHNGIKSIIAHIGTQEFNRIKVGIGRPLKGMTVINHVMGQFNTEDNIAISLT
FT                   LDRVVNAVKFYLQENDFEKTMQKFNG"
FT   gene            5321..8740
FT                   /gene="trcF"
FT                   /locus_tag="SpyM3_0006"
FT   CDS             5321..8740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trcF"
FT                   /locus_tag="SpyM3_0006"
FT                   /product="putative transcription-repair coupling factor"
FT                   /note="best blastp hit: gb|AAK33151.1| (AE006472) putative
FT                   transcription-repair coupling factor [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78613"
FT                   /db_xref="GOA:Q8K8Z6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Z6"
FT                   /protein_id="AAM78613.1"
FT                   /translation="MGLSGSSKALAIASAYLDDQKKIVVVTSTQNEVEKLASDLSSLLD
FT                   EELVFQFFADDVAAAEFIFASMDKALSRIETLQFLRNPKSQGVLIVSLSGLRTLLPNPD
FT                   VFTKSQIQLTVGEDYDSDTLTKQLMTIGYQKVSQVISPGEFSRRGDILDIYEITQELPY
FT                   RLEFFGDDIDSIRQFHPETQKSFEQLEGVFINPASDLIFEASDFQRGIEQLEKALQTAQ
FT                   DDKKSYLEDVLAVSKNGFKHKDIRKFQSLFYEKEWSLLDYIPKGTPIFFDDFQKLVDKN
FT                   ARFDLEIANLLTEDLQQGKALSNLNYFADNYRELRHYKPATFFSNFHKGLGNIKFDQMH
FT                   QLTQYAMQEFFNQFPLLIDEIKRYQKNQTTVIVQVESQYAYERLEKSFQDYQFRLPLVS
FT                   ANQIVSRESQIVIGAISSGFYFADEKLALITEHEIYHKKIKRRARRSNISNAERLKDYN
FT                   ELAVGDYVVHNVHGIGRFLGIETIQIQGIHRDYVTIQYQNSDRISLPIDQISSLSKYVS
FT                   ADGKEPKINKLNDGRFQKTKQKVARQVEDIADDLLKLYAERSQQKGFSFSPDDDLQRAF
FT                   DDDFAFVETEDQLRSIKEIKADMESMQPMDRLLVGDVGFGKTEVAMRAAFKAVNDHKQV
FT                   AVLVPTTVLAQQHYENFKARFENYPVEVDVLSRFRSKKEQAETLERVRKGQIDIIIGTH
FT                   RLLSKDVVFSDLGLIVIDEEQRFGVKHKETLKELKTKVDVLTLTATPIPRTLHMSMLGI
FT                   RDLSVIETPPTNRYPVQTYVLENNPGLVREAIIREMDRGGQIFYVYNKVDTIEKKVAEL
FT                   QELVPEASIGFVHGQMSEIQLENTLIDFINGDYDVLVATTIIETGVDISNVNTLFIENA
FT                   DHMGLSTLYQLRGRVGRSNRIAYAYLMYRPDKVLTEVSEKRLEAIKGFTELGSGFKIAM
FT                   RDLSIRGAGNILGASQSGFIDSVGFEMYSQLLEQAIASKQGKTTVRQKGNTEINLQIDA
FT                   YLPDDYIADERQKIDIYKRIREIQSREDYLNLQDELIDRFGEYPDQVAYLLEIALLKHY
FT                   MDNAFAELVERKNNQVIVRFEVTSLSYFLTQDYFEALSKTHLKAKISEHQGKIDIVFDV
FT                   RHQKDYRILEELMLFGERLSEIKIRKNNSVFK"
FT   gene            8902..9174
FT                   /locus_tag="SpyM3_0007"
FT   CDS             8902..9174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74200.1| (AE007318)
FT                   S4 domain protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78614"
FT                   /db_xref="GOA:Q8K8Z5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Z5"
FT                   /protein_id="AAM78614.1"
FT                   /translation="MRLDKYLKVSRLIKRRSVAKEVADKGRIKVNGILAKSSTNIKLND
FT                   HIEISFGNKLLTVRVIEIKDSTKKEDALKMYEIISETRITLNEEA"
FT   gene            9161..9532
FT                   /gene="divIC"
FT                   /locus_tag="SpyM3_0008"
FT   CDS             9161..9532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="SpyM3_0008"
FT                   /product="putative cell division protein"
FT                   /note="best blastp hit: gb|AAK33153.1| (AE006472) putative
FT                   cell division protein (DivIC) [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78615"
FT                   /db_xref="GOA:F7IVR8"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVR8"
FT                   /protein_id="AAM78615.1"
FT                   /translation="MKKPSIVQLNNHYIKKENLKKKFEEEESQKRNRFMGWILVSMMFL
FT                   FILPTYNLVKSYVDFEKQNQQVVKLKKEYNELSKSTKKEKQLAERLKDDNFVKKYARAK
FT                   YYLSREGEMIYPIPGLLPK"
FT   gene            9667..10953
FT                   /locus_tag="SpyM3_0009"
FT   CDS             9667..10953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK98813.1| (AE008385)
FT                   Conserved hypothetical protein [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78616"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Z4"
FT                   /protein_id="AAM78616.1"
FT                   /translation="MRKLLAAMLMTFFLTPLPVISTEKKLIFSKNAVYQLKQDVVQSTQ
FT                   FYNQLPSNPNLYQETCAYKDSDLTLPVGRLGVNQPLPIKSLVLNKESLPVFELADGTYV
FT                   EANRQLIYDDIVLNQVDIDSYFWTQKKLRLYSAPYVLGTQTIPSSVSFAQKVHATQMAQ
FT                   TNHGTYYLIDDKGWASQEDLVQFDNRMLKVQEMLLQKYNNPNYSIFVKQLNTQTSAGIN
FT                   ADKKMYAASISKLAPLYIVQKQLQKKKLAENKTLTYIKDVNHFYGDYDPLGSGKISKIP
FT                   DNKDYRVEDLLKAVAQQSDNVATNILGYYLCHQYDKAFRSEIKALSGIDWDMEQRLLTS
FT                   RSAANMMEAIYHQKGQIISYLSNTEFDQQRITKNITVPVAHKIGDAYDYKHDVAIIYGN
FT                   TPFILSIFTNKSTYEDITAIADDVYGILK"
FT   gene            11049..12236
FT                   /gene="mesJ"
FT                   /locus_tag="SpyM3_0010"
FT   CDS             11049..12236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="SpyM3_0010"
FT                   /product="putative cell-cycle protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74204.1| (AE007318)
FT                   MesJ/Ycf62 family protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78617"
FT                   /db_xref="GOA:P0DG00"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG00"
FT                   /protein_id="AAM78617.1"
FT                   /translation="MNLLHFLYLFQDKLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKH
FT                   DIPIYVSNFEGIFSEKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGS
FT                   RLRHLSGIKSVQPFANGQLIRPFLTFSKKDLPEIFHFEDSSNRELSFLRNRVRNNYLPL
FT                   LKQENPRFIQGLNQLALENSLLFQAFKELTNHITTTDLTEFNEQSKSIQYFLLQDYLEG
FT                   FPDLDLKKSQFTQLLQIIQTAKQGYYYLKKDYYIFIDKFSFKITKIVPKTELVKDEKML
FT                   EYDSNLCYRDYCFSFMPKSNEDQGQVSIPLFSLSSIKLRSRQSGDYISFGHFSKKIRRL
FT                   FIDEKFTIAERQNAIIGEQDEQIIFVLIGNKTYLRKACKHDIMLAKLYIDKLEKG"
FT   gene            12241..12783
FT                   /gene="hpt"
FT                   /locus_tag="SpyM3_0011"
FT   CDS             12241..12783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SpyM3_0011"
FT                   /product="putative hypoxanthine-guanine
FT                   phosphoribosyltransferase"
FT                   /note="best blastp hit: gb|AAK74205.1| (AE007318)
FT                   hypoxanthine-guanine phosphoribosyltransferase
FT                   [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78618"
FT                   /db_xref="GOA:P0DD40"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD40"
FT                   /protein_id="AAM78618.1"
FT                   /translation="MLEQDIQKILYSENDIIRKTKKLGEQLTKDYQEKNPLMIGVLKGS
FT                   VPFMAELMKHIDTHVEIDFMVVSSYHGGTSSSGEVKILKDVDTNIEGRDIIIVEDIIDT
FT                   GRTLKYLRDMFKYRKANTIKIATLFDKPEGRVVKIEADYVCYNIPNEFIVGFGLDYAEN
FT                   YRNLPYVGVLKEEVYSK"
FT   gene            12805..14784
FT                   /gene="ftsH"
FT                   /locus_tag="SpyM3_0012"
FT   CDS             12805..14784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="SpyM3_0012"
FT                   /product="putative cell division protein"
FT                   /note="best blastp hit: gb|AAK33156.1| (AE006473) putative
FT                   cell division protein, FtsH homologue [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78619"
FT                   /db_xref="GOA:F7IVK9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVK9"
FT                   /protein_id="AAM78619.1"
FT                   /translation="MKNNKNNGFVKNSFIYILMIIVVITGFQFYLKGTSTQSQQISYSK
FT                   LIKHLKAGDIKSLSYQPSGSIIEVKGKYEKPQKVTVNSGLSFLGGRASTQVTEFSSLVL
FT                   PSDTILKEMTAAADKNGTELTVKQESSSGTWITFLMSFLPIVIFAAFMMMMMNQGGGGA
FT                   RGAMSFGKNKAKSQSKGDVKVRFTDVAGAEEEKQELVEVVDFLKNPKKYKSLGARIPAG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAERA
FT                   IIFIDEIDAVGRRRGAGMGGGNDEREQTLNQLLIEMDGFEGNENIIVIAATNRSDVLDP
FT                   ALLRPGRFDRKVLVGRPDVKGREAILRVHAKNKPLANDVNLKVVAQQTPGFVGADLENV
FT                   LNEAALVAARRNKIKIDASDIDEAEDRVIAGPSKKDRTISQKEREMVAYHEAGHTIVGL
FT                   VLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDLKEQLAGLMGGRVAEEIVFNA
FT                   QTSGASNDFEQATQIARAMVTEYGMSEKLGPVQYEGNHAMMPGQISPEKAYSAQTAQMI
FT                   DDEVRELLNQARNQAADIINENRDTHKLIAEALLKYETLDAAQIKSIYETGKMPVDLET
FT                   DDNEAHALSYDEIKNKMTESESAE"
FT   gene            15110..16501
FT                   /locus_tag="SpyM3_0013"
FT   CDS             15110..16501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0013"
FT                   /product="putative amino acid permease"
FT                   /note="best non-GAS blastp hit: gb|AAK99709.1| (AE008464)
FT                   cationic amino acid transporter - APC Superfamily
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78620"
FT                   /db_xref="GOA:Q8K8Z2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Z2"
FT                   /protein_id="AAM78620.1"
FT                   /translation="MTIFRKKKKYSNKTEMQRHFKVIDLIFLGLGSMVGTGIFTVTGIG
FT                   AAKYAGPALTISIIISAIAIGILALFYAEFASRMPSNGGAYSYVYATLGEFPAWLVGWY
FT                   IIMEFLTAISSVAVGWGSYLKGLLANYNIVLPNALNGTFNLKNGTYIDILPVLVMFFVT
FT                   GIVLMNSKLALRFNSFLVILKFSALALFIFVGIFFIDHNNWFHFAPYGVGQITGGKTGI
FT                   FAGASVMFFAFLGFESISMAVDEVKEPQKTIPKGIILSLIIVTALYIVVTTILTGIVHY
FT                   TKLNVPDAVAFALRNIRLYWAADYVSIVAILTLITVCISMTYALARTIYSISRDGLLPK
FT                   SLYTLTKKNKVPQNATLVTGLLAMICAGIFPLSSLAEFVNICTLAYLIILSGAIIKLRR
FT                   IEGEPKANEFKTPLVPFLPMLAIIICLSFMSQYKAFTWIAFAIATIIGTLIYLAYGYTH
FT                   SIENK"
FT   gene            17066..18620
FT                   /locus_tag="SpyM3_r01"
FT   rRNA            17169..18503
FT                   /locus_tag="SpyM3_r01"
FT                   /product="16S ribosomal RNA"
FT   gene            18665..18740
FT                   /locus_tag="SpyM3_t01"
FT   tRNA            18665..18740
FT                   /locus_tag="SpyM3_t01"
FT                   /product="tRNA-Ala"
FT   gene            19036..21941
FT                   /locus_tag="SpyM3_r02"
FT   rRNA            19037..21937
FT                   /locus_tag="SpyM3_r02"
FT                   /product="23S ribosomal RNA"
FT   gene            22023..22140
FT                   /locus_tag="SpyM3_r13"
FT   gene            22158..22230
FT                   /locus_tag="SpyM3_t02"
FT   tRNA            22158..22230
FT                   /locus_tag="SpyM3_t02"
FT                   /product="tRNA-Val"
FT   gene            22248..22320
FT                   /locus_tag="SpyM3_t03"
FT   tRNA            22248..22320
FT                   /locus_tag="SpyM3_t03"
FT                   /product="tRNA-Asp"
FT   gene            22352..22424
FT                   /locus_tag="SpyM3_t04"
FT   tRNA            22352..22424
FT                   /locus_tag="SpyM3_t04"
FT                   /product="tRNA-Lys"
FT   gene            22430..22511
FT                   /locus_tag="SpyM3_t05"
FT   tRNA            22430..22511
FT                   /locus_tag="SpyM3_t05"
FT                   /product="tRNA-Leu"
FT   gene            22522..22594
FT                   /locus_tag="SpyM3_t06"
FT   tRNA            22522..22594
FT                   /locus_tag="SpyM3_t06"
FT                   /product="tRNA-Thr"
FT   gene            22607..22678
FT                   /locus_tag="SpyM3_t07"
FT   tRNA            22607..22678
FT                   /locus_tag="SpyM3_t07"
FT                   /product="tRNA-Gly"
FT   gene            22687..22771
FT                   /locus_tag="SpyM3_t08"
FT   tRNA            22687..22771
FT                   /locus_tag="SpyM3_t08"
FT                   /product="tRNA-Leu"
FT   gene            22788..22864
FT                   /locus_tag="SpyM3_t09"
FT   tRNA            22788..22864
FT                   /locus_tag="SpyM3_t09"
FT                   /product="tRNA-Arg"
FT   gene            22868..22941
FT                   /locus_tag="SpyM3_t10"
FT   tRNA            22868..22941
FT                   /locus_tag="SpyM3_t10"
FT                   /product="tRNA-Pro"
FT   gene            23068..24622
FT                   /locus_tag="SpyM3_r03"
FT   rRNA            23171..24505
FT                   /locus_tag="SpyM3_r03"
FT                   /product="16S ribosomal RNA"
FT   gene            24667..24742
FT                   /locus_tag="SpyM3_t11"
FT   tRNA            24667..24742
FT                   /locus_tag="SpyM3_t11"
FT                   /product="tRNA-Ala"
FT   gene            25038..27943
FT                   /locus_tag="SpyM3_r04"
FT   rRNA            25039..27939
FT                   /locus_tag="SpyM3_r04"
FT                   /product="23S ribosomal RNA"
FT   gene            28025..28142
FT                   /locus_tag="SpyM3_r14"
FT   gene            28160..28232
FT                   /locus_tag="SpyM3_t12"
FT   tRNA            28160..28232
FT                   /locus_tag="SpyM3_t12"
FT                   /product="tRNA-Val"
FT   gene            28250..28322
FT                   /locus_tag="SpyM3_t13"
FT   tRNA            28250..28322
FT                   /locus_tag="SpyM3_t13"
FT                   /product="tRNA-Asp"
FT   gene            28354..28426
FT                   /locus_tag="SpyM3_t14"
FT   tRNA            28354..28426
FT                   /locus_tag="SpyM3_t14"
FT                   /product="tRNA-Lys"
FT   gene            28432..28513
FT                   /locus_tag="SpyM3_t15"
FT   tRNA            28432..28513
FT                   /locus_tag="SpyM3_t15"
FT                   /product="tRNA-Leu"
FT   gene            28524..28596
FT                   /locus_tag="SpyM3_t16"
FT   tRNA            28524..28596
FT                   /locus_tag="SpyM3_t16"
FT                   /product="tRNA-Thr"
FT   gene            28609..28680
FT                   /locus_tag="SpyM3_t17"
FT   tRNA            28609..28680
FT                   /locus_tag="SpyM3_t17"
FT                   /product="tRNA-Gly"
FT   gene            28689..28773
FT                   /locus_tag="SpyM3_t18"
FT   tRNA            28689..28773
FT                   /locus_tag="SpyM3_t18"
FT                   /product="tRNA-Leu"
FT   gene            28790..28866
FT                   /locus_tag="SpyM3_t19"
FT   tRNA            28790..28866
FT                   /locus_tag="SpyM3_t19"
FT                   /product="tRNA-Arg"
FT   gene            28870..28943
FT                   /locus_tag="SpyM3_t20"
FT   tRNA            28870..28943
FT                   /locus_tag="SpyM3_t20"
FT                   /product="tRNA-Pro"
FT   gene            28949..29022
FT                   /locus_tag="SpyM3_t21"
FT   tRNA            28949..29022
FT                   /locus_tag="SpyM3_t21"
FT                   /product="tRNA-Met"
FT   gene            29043..29116
FT                   /locus_tag="SpyM3_t22"
FT   tRNA            29043..29116
FT                   /locus_tag="SpyM3_t22"
FT                   /product="tRNA-Met"
FT   gene            29139..29228
FT                   /locus_tag="SpyM3_t23"
FT   tRNA            29139..29228
FT                   /locus_tag="SpyM3_t23"
FT                   /product="tRNA-Ser"
FT   gene            29238..29311
FT                   /locus_tag="SpyM3_t24"
FT   tRNA            29238..29311
FT                   /locus_tag="SpyM3_t24"
FT                   /product="tRNA-Met"
FT   gene            29332..29404
FT                   /locus_tag="SpyM3_t25"
FT   tRNA            29332..29404
FT                   /locus_tag="SpyM3_t25"
FT                   /product="tRNA-Phe"
FT   gene            29417..29487
FT                   /locus_tag="SpyM3_t26"
FT   tRNA            29417..29487
FT                   /locus_tag="SpyM3_t26"
FT                   /product="tRNA-Gly"
FT   gene            29522..29595
FT                   /locus_tag="SpyM3_t27"
FT   tRNA            29522..29595
FT                   /locus_tag="SpyM3_t27"
FT                   /product="tRNA-Ile"
FT   gene            29605..29692
FT                   /locus_tag="SpyM3_t28"
FT   tRNA            29605..29692
FT                   /locus_tag="SpyM3_t28"
FT                   /product="tRNA-Ser"
FT   gene            31195..32391
FT                   /locus_tag="SpyM3_0014"
FT   CDS             31195..32391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0014"
FT                   /product="putative secreted protein"
FT                   /note="best non-GAS blastp hit: gb|AAK08104.1|AF338445_1
FT                   (AF338445) immunodominant glycoprotein IDG-60; general
FT                   stress protein GSP-781 [Streptococcus mutans]
FT                   gb|AAK94501.1| (AY046411) glucan-binding protein B
FT                   [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78621"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR009148"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVU1"
FT                   /protein_id="AAM78621.1"
FT                   /translation="MKKRILSAVLVSGVTLGAATTVGAEDLSTKIAKQDSIISNLTTEQ
FT                   KAAQNQVSALQAQVSSLQSEQDKLTARNTELEALSKRFEQEIKALTSQIVARNEKLKNQ
FT                   ARSAYKNNETSGYINALLNSKSISDVVNRLVAINRAVSANAKLLEQQKADKVSLEEKQA
FT                   ANQTAINTIAANMAMAEENQNTLRTQQANLEAATANLALQLASATEDKANLVAQKEAAE
FT                   KAAAEALAQEQAAKVKAQEQAAQQAASVEAAKSAITPAPQATPAAQSSNAIEPAALTAP
FT                   AAPSARPQTSYDSSNTYPVGQCTWGAKSLAPWAGNNWGNGGQWAYSAQAAGYRTGSTPM
FT                   VGAIAVWNDGGYGHVAVVVEVQSASSIRVMESNYSGRQYIADHRGWFNPTGVTFIYPH"
FT   gene            32644..33606
FT                   /gene="prsA"
FT                   /locus_tag="SpyM3_0015"
FT   CDS             32644..33606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="SpyM3_0015"
FT                   /product="putative ribose-phosphate pyrophosphokinase"
FT                   /note="best blastp hit: gb|AAK33159.1| (AE006474) putative
FT                   ribose-phosphate pyrophosphokinase [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78622"
FT                   /db_xref="GOA:P0DB98"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DB98"
FT                   /protein_id="AAM78622.1"
FT                   /translation="MSYSDLKLFALSSNKELAEKVASAMGIQLGKSTVRQFSDGEIQVN
FT                   IEESIRGHHVFILQSTSSPVNDNLMEILIMVDALKRASAEKISVVMPYYGYARQDRKAR
FT                   SREPITSKLVANMLEVAGVDRLLTVDLHAAQIQGFFDIPVDHLMGAPLIADYFDRHGLV
FT                   GEDVVVVSPDHGGVTRARKLAQFLQTPIAIIDKRRSVDKMNTSEVMNIIGNVSGKKCIL
FT                   IDDMIDTAGTICHAADALAEAGATAVYASCTHPVLSGPALDNIQRSAIEKLIVLDTIYL
FT                   PKERLIDKIEQISIADLVAEAIIRIHEKRPLSPLFEMGN"
FT   gene            33891..34547
FT                   /locus_tag="SpyM3_0016"
FT   CDS             33891..34547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74226.1| (AE007321)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78623"
FT                   /db_xref="GOA:P0DD86"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD86"
FT                   /protein_id="AAM78623.1"
FT                   /translation="MFFVKHISRSKMSSIIQPLTIADFIFKLNDTGLSYVVDYSNVNTY
FT                   RYINNDIFRLAYASYVLALADAAIADNESDSHLFTFLKKTLDLMEEGLDYEILTNIFEI
FT                   QILDRFGISLNFHECAICHRTDLPLDFSHRFSAVLCSEHYYKDNRRNHLDPNVIYLLSR
FT                   FQKITFDDLRTISLNKDIKKKLRQFIDELYHDYVGIKLKSKTFIDNLVKWGDIMK"
FT   gene            34650..35657
FT                   /gene="plsX"
FT                   /locus_tag="SpyM3_0017"
FT   CDS             34650..35657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SpyM3_0017"
FT                   /product="putative fatty acid/phospholipid synthesis
FT                   protein"
FT                   /note="best non-GAS blastp hit: gb|AAK98841.1| (AE008388)
FT                   Involved in fatty acid/phospholipid synthesis
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78624"
FT                   /db_xref="GOA:P0DD08"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD08"
FT                   /protein_id="AAM78624.1"
FT                   /translation="MKRIAIDAMGGDNAPKAIVEGVNQAIEAFSDIEIQLYGDQTKINS
FT                   YLIQSDRVAIIHTDEKIMSDDEPAKAVRRKKKASMVLAAKAVKEGKADAIISAGNTGAL
FT                   LAVGLFVVGRIKGVDRPGLLSTIPTVTGLGFDMLDLGANAENTAKHLHQYAILGSFYAK
FT                   NVRGIANPRVGLLNNGTEETKGDPLRKATYELLTADNTISFVGNVEARELMSGVADVIV
FT                   SDGFTGNAVLKSIEGTAISIMGQLKQIINSGGIKTKIGASLLKSSLYEMKKTLDYSSAG
FT                   GAVLFGLKAPVVKSHGSSDVKAIFSTIKQVRTMLDTNVVGQLVEEFAKETQVND"
FT   gene            35650..35892
FT                   /gene="acpP.1"
FT                   /locus_tag="SpyM3_0018"
FT   CDS             35650..35892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP.1"
FT                   /locus_tag="SpyM3_0018"
FT                   /product="putative acyl carrier protein"
FT                   /note="best non-GAS blastp hit: gb|AAG22707.1| (AF276618)
FT                   acyl carrier protein; AcpP; ACP [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78625"
FT                   /db_xref="GOA:Q8K8Z1"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Z1"
FT                   /protein_id="AAM78625.1"
FT                   /translation="MTRQEIFERLINLIQKQRSYLSVAITEQTHLKNDLAVDSIELVEF
FT                   IINVEDEFHIAIPDEDVEDMVFMGDVLDYLVQRLT"
FT   gene            36044..36748
FT                   /gene="purC"
FT                   /locus_tag="SpyM3_0019"
FT   CDS             36044..36748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SpyM3_0019"
FT                   /product="putative
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /note="SAICAR synthetase; best non-GAS blastp hit:
FT                   sp|Q07296|PUR7_STRPN
FT                   PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
FT                   (SAICAR SYNTHETASE) >gi|625868|pir||A36941
FT                   phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC
FT                   6.3.2.6) - Streptococcus pneumoniae
FT                   >gi|295192|gb|AAA03540.1| (L15190) SAICAR synthetase
FT                   [Streptococcus pneumoniae] >gi|663281|gb|AAA69512.1|
FT                   (M36180) SAICAR synthetase [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78626"
FT                   /db_xref="GOA:P0DD56"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD56"
FT                   /protein_id="AAM78626.1"
FT                   /translation="MTNQLIYKGKAKDIYSTKDENVIRTVYKDQATMLNGARKETIDGK
FT                   GALNNQISSLIFEKLNKAGVATHYIEQISKNEQLNKKVDIIPLEVVLRNVTAGSFSKRF
FT                   GVEEGRVLETPIVEFYYKNDDLNDPFINDEHVKFLGIVNDEEIAYLKGETRRINELLKC
FT                   WFAQIGLNLIDFKLEFGFDQEGTIILADEFSPDNCRLWDKNGNHMDKDVFRRDLGNLTD
FT                   VYQVVLEKLIAL"
FT   gene            36942..40598
FT                   /gene="purL"
FT                   /locus_tag="SpyM3_0020"
FT   CDS             36942..40598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="SpyM3_0020"
FT                   /product="putative phosphoribosylformylglycinamidine
FT                   synthase II"
FT                   /note="best blastp hit: gb|AAK33164.1| (AE006475) putative
FT                   phosphoribosylformylglycinamidine synthase II
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78627"
FT                   /db_xref="GOA:Q8K8Y9"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Y9"
FT                   /protein_id="AAM78627.1"
FT                   /translation="MTHNLQLTSLKDLRIVQVYDVFNLAEDLLARAEKHIFSEQVTDRL
FT                   LTEAEITAELDKVAFFAIEALPGQFDQRAASSQEALLLFGSDSQVKVNTAQLYLVNKDI
FT                   AEAELEAVKNYLLNPVDSRFKDITLPLEEQAFSVSDKTIPNLDFFENYKADDFAAYKAD
FT                   QGLAMEVDDLLFIQDYFKSIGRVPTETELKVLDTYWSDHCRHTTFETELKNIDFSASKF
FT                   QKQLQTTYDKYIAMRDELGRSEKPQTLMDMATIFGRYERANGRLDDMEVSDEINACSVE
FT                   IEVDVDGVKEPWLLMFKNETHNHPTEIEPFGGAATCIGGAIRDPLSGRSYVYQAMRISG
FT                   AGDITTPIAETRTGKLPQQVISKTAAHGYSSYGNQIGLATTYVREYFHPGFVAKRMELG
FT                   AVVGAAHKENVVREKPEAGDVVILLGGKTGRDGVGGATGSSKVQTVESVETAGAEVQKG
FT                   NAIEERKIQRLFRDGEVTRLIKKSNDFGAGGVCVAIGELADGLEIDLDKVPLKYQGLNG
FT                   TEIAISESQERMSVVVRPNDVDAFIAACNKENIDAVVVATVTEKPNLVMTWNGETIVDL
FT                   ERRFLDTNGVRVVVDVKFVDKDLTVPEARTTSAETLEADTLKVLSDLNHASQKGLQTIF
FT                   DSSVGRSTVNHPIGGRYQITPTESSVQKLPVQHGVTTTASVMAQGYNPYIAEWSPYHGA
FT                   AYAVIEATARLVATGADWSRARFSYQEYFERMDKQAERFGQPVSALLGSIEAQIQLGLP
FT                   SIGGKDSMSGTFEDLTVPPTLVAFGVTTADSRKVLSPEFKVAGENIYYIPGQAISEDID
FT                   FDLIKANFSQFEAIQAQHKITAASAAKYGGVLESLALMTFGNRIGASVEIAELDSSLTA
FT                   QLGGFVFTSAEEIADAVKIGQTQADFTVTVNGNDLAGASLLAAFEGKLEEVYPTEFEQA
FT                   DALEEVPAVVSDTVIKAKETIEKPVVYIPVFPGTNSEYDSAKAFEQVGASVNLVPFVTL
FT                   NEVAIAESVDTMVANIAKANIIFFAGGFSAADEPDGSAKFIVNILLNEKVRAAIDNFIE
FT                   KGGLIIGICNGFQALVKSGLLPYGNFEEAGETSPTLFYNDANQHVAKMVETRIANTNSP
FT                   WLAGVEVGDIHAIPVSHGEGKFVVSASEFAELRDNGQIWSQYVDFDGQPSMDSKYNPNG
FT                   SVNAIEGITSKNGQIIGKMGHSERWEDGLFQNIPGNKDQTLFASAVKYFTGK"
FT   gene            40832..42286
FT                   /gene="purF"
FT                   /locus_tag="SpyM3_0021"
FT   CDS             40832..42286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SpyM3_0021"
FT                   /product="putative phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /note="best blastp hit: gb|AAK33165.1| (AE006475) putative
FT                   phosphoribosylpyrophosphate amidotransferase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78628"
FT                   /db_xref="GOA:Q8K8Y8"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Y8"
FT                   /protein_id="AAM78628.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPQAAQVTYFGLHSLQHRGQEGAGIV
FT                   SNDNGKLYGYRNVGLLSEVFKNQSELDNLTGNAAIGHVRYATAGSADIRNIQPFLYKFH
FT                   DGQFALCHNGNLTNAISLRKELEKQGAIFNASSDTEILMHLIRRSHNSSFMGKVKEALN
FT                   TVKGGFAYLLMTENKLIAALDPNAFRPLSIGQMQNGAWVISSETCAFEVVGAKWVRDVE
FT                   PGEVILIDDRGIQCDRYTDETQLAICSMEYVYFARPDSTIHGVNVHTARKNMGKRLAQE
FT                   FKQDADIVIGVPNSSLSAAMGFAEESGLPNEMGLVKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSGVVKGKRVVMIDDSIVRGTTSRRIVGLLREAGASEVHVAIASPELKYPCFYGID
FT                   IQTRRELISANHAVDEVCDIIGADSLTYLSLDGLIESIGLETKAPNGGLCVAYFDGHYP
FT                   TPLYDYEEEYLRSLEEKTSFYIQKVK"
FT   gene            42314..43336
FT                   /gene="purM"
FT                   /locus_tag="SpyM3_0022"
FT   CDS             42314..43336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SpyM3_0022"
FT                   /product="putative phosphoribosylformylglycinamide
FT                   cyclo-ligase"
FT                   /note="best blastp hit: gb|AAK33166.1| (AE006475) putative
FT                   phosphoribosylformylglycinamide cyclo-ligase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78629"
FT                   /db_xref="GOA:P0DD62"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD62"
FT                   /protein_id="AAM78629.1"
FT                   /translation="MSEKNAYAKSGVDVEAGYEVVERIKKHVARTERAGVMGVLGGFGG
FT                   MFDLSKTGVKEPVLVSGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYIATGKNNPVKLEEVVSGVAEGCVQAGVALIGGETAEMPGMYGEDDYDLAGFAVGVA
FT                   EKSQIIDGSKVKEGDILLGLASSGIHSNGYSLVRRVFADYTGKELLPELEGKQLKDVLL
FT                   EPTRIYVKAALPLIKEELVNGIGHITGGGFIENVPRMFADDLAAEIDEDKVPVLPIFKA
FT                   LEKYGDIKHEEMFEIFNMGVGLMLAVSPENVNRVKELLDEPVYEIGRIIKKADASVVIK
FT                   "
FT   gene            43504..44058
FT                   /gene="purN"
FT                   /locus_tag="SpyM3_0023"
FT   CDS             43504..44058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SpyM3_0023"
FT                   /product="Phosphoribosylglycinamide formyltransferase"
FT                   /note="best blastp hit: gb|AAK33167.1| (AE006475)
FT                   Phosphoribosylglycinamide formyltransferase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78630"
FT                   /db_xref="GOA:F7IWG5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="UniProtKB/TrEMBL:F7IWG5"
FT                   /protein_id="AAM78630.1"
FT                   /translation="MKIAVFASGNGSNFQVIAEQFPVSFVFSDHRDAYVLERAQNLAIP
FT                   SFAFELKEFENKAAYEQAIVDLLDKHEIDLVCLAGYMKIVGETLLLAYEGRIINIHPAY
FT                   LPEFPGAHGIEDAWEAGVDQSGVTIHWVDSGVDTGQVIQQVRVPRLADDSLESFETRIH
FT                   ETEYQLYPAVLDSLGVERKVI"
FT   gene            44242..45789
FT                   /gene="purH"
FT                   /locus_tag="SpyM3_0024"
FT   CDS             44242..45789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SpyM3_0024"
FT                   /product="putative phosphoribosyl carboxyamide
FT                   aminoimidazole transformylase"
FT                   /note="best blastp hit: gb|AAK74239.1| (AE007322)
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase [Streptococcus
FT                   pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78631"
FT                   /db_xref="GOA:P0DD60"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD60"
FT                   /protein_id="AAM78631.1"
FT                   /translation="MTKRALISVSDKSGIVDFAKELKNLGWDIISTGGTKVALDNAGVE
FT                   TIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDADSHLQAAKDNNIELIDLVVVNLYP
FT                   FKETILRPDITYDLAVENIDIGGPSMLRSAAKNHASVTVVVDPADYATVLGELADAGQT
FT                   TFETRQRLAAKVFRHTAAYDALIAEYFTTQVGEAKPEKLTITYDLKQAMRYGENPQQDA
FT                   DFYQKALPIDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKDRPTVVVLKHMNPCGI
FT                   GQADDIETAWDYAYEADPVSIFGGIVVLNREVDAATAKKMHPIFLEIIIAPSYSEEALA
FT                   ILTNKKKNLRILELPFDAQAASEVEAEYTGVVGGLLVQNQDVVAENPSDWQVVTDRQPT
FT                   EQEATALEFAWKAIKYVKSNGIIITNDHMTLGLGAGQTNRVGSVKIAIEQAKDHLDGAV
FT                   LASDAFFPFADNIEEIAAAGIKAIIQPGGSVRDQDSIDAANKHGLTMIFTGVRHFRH"
FT   gene            complement(45848..46972)
FT                   /locus_tag="SpyM3_0025"
FT   CDS             complement(45848..46972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0025"
FT                   /product="putative choline binding protein"
FT                   /note="best non-GAS blastp hit: gb|AAF87768.1|AF278686_1
FT                   (AF278686) choline binding protein D; CbpD [Streptococcus
FT                   pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78632"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Y5"
FT                   /protein_id="AAM78632.1"
FT                   /translation="MKKFHRFLVSGVILLGFNGLVPTMPSTLISQQENLVHAAVLGDNY
FT                   PSKWKKGNGIDSWNMYIRQCTSFAAFRLSSANGFQLPKGYGNACTWGHIAKNQGYPVNK
FT                   TPSIGAIAWFDKNAYQSNAAYGHVAWVADIRGDTVTIEEYNYNAGQGPERYHKRQIPKS
FT                   QVSGYIHFKDLSSQTSHSYPRQLKHISQSSFDPSGTYHFTTRLPVKGQTSIDSPDLAYY
FT                   EAGQSVYYDKIVTAGGYTWLSYLSFSGNRRYIPIKEPAQSVVQNDNTKPSIKVGDTVTF
FT                   PGVFRVDQLVNNLIVNKELAGGDPTPLNWIDPTPLDETDNQGKVLGDQILRVGEYFTVT
FT                   GSYKVLKIDQPSNGIYVQIGSRGTWVNADKANKL"
FT   gene            47218..48492
FT                   /gene="purD"
FT                   /locus_tag="SpyM3_0026"
FT   CDS             47218..48492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SpyM3_0026"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /note="best blastp hit: gb|AAK33169.1| (AE006476)
FT                   phosphoribosylamine-glycine ligase [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78633"
FT                   /db_xref="GOA:P0DD58"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD58"
FT                   /protein_id="AAM78633.1"
FT                   /translation="MDVLKLLVVGSGGREHAIAKKLLASKGVDQVFVAPGNDGMTLDGL
FT                   DLVNIVVSEHSRLIAFAKENEISWAFIGPDDALAAGIVDDFNTAGLRAFGPTKAAAELE
FT                   WSKDFAKEIMVKYNVPTAAYGTFSDFEKAKAYIEEQGAPIVVKADGLALGKGVVVAETV
FT                   EQAVEAAQEMLLDNKFGDSGARVVIEEFLDGEEFSLFAFVNGDKFYIMPTAQDHKRAFD
FT                   GDKGPNTGGMGAYAPVPHLPQSVVDTAVEMIVRPVLEGMVAEGRPYLGVLYVGLILTAD
FT                   GPKVIEFNSRFGDPETQIILPRLTSDFAQNIDDIMMGIEPYITWQKDGVTLGVVVASEG
FT                   YPFDYEKGVPLPEKTDGDIITYYAGVKFSENSELLLSNGGRVYMLVTTEDSVKAGQDKI
FT                   YTQLAQQDPTGLFYRNDIGSKAIRE"
FT   gene            48650..49261
FT                   /gene="purE"
FT                   /locus_tag="SpyM3_0027"
FT   CDS             48650..49261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SpyM3_0027"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   I"
FT                   /note="best blastp hit: gb|AAK33170.1| (AE006476) putative
FT                   phosphoribosylaminoimidazole carboxylase I [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78634"
FT                   /db_xref="GOA:Q8K8Y3"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Y3"
FT                   /protein_id="AAM78634.1"
FT                   /translation="MLKHLVALTWVRLRNQRFRTYRIFFYGRFRQVETPLYILIMKTPI
FT                   ISIIMGSKSDWATMQKTAEVLDNFGIAYEKKVVSAHRTPDLMFKHAEEARGRGIKIIIA
FT                   GAGGAAHLPGIVAAKTTLPVIGVPVKSRALSGLDSLYSIVQMPGGVPVATMAIGEAGAT
FT                   NAALTALRILSIEDQNLADALAHFHEEQGKIAEESSGELI"
FT   gene            49302..50321
FT                   /gene="purK"
FT                   /locus_tag="SpyM3_0028"
FT   CDS             49302..50321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SpyM3_0028"
FT                   /product="phosphoribosylaminoimidazole carboxylase II"
FT                   /note="best blastp hit: gb|AAK33171.1| (AE006476)
FT                   phosphoribosylaminoimidazole carboxylase II [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78635"
FT                   /db_xref="GOA:Q8K8Y2"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Y2"
FT                   /protein_id="AAM78635.1"
FT                   /translation="MAIAAIYMGHKVITLDPASDCPASRVSEVIVAPYDDVEALGQLAA
FT                   RCDVLTYEFENVDADGLDAVVSACQLPQGTDLLRISQNRIVEKDFLANKAGVTVAPYKV
FT                   VTSSLDLGGLDLTKTYVLKTATGGYDGHGQKIIRSAEDLPEAQQLANSAQCVLEEFVNF
FT                   DLEISVIVSGNGEDVTVFPVQENIHRNNILSKTIVPARISDQLADKAKKTAVQIAKKLQ
FT                   LSGTLCVEMFATADDIIVNEIAPRPHNSGHYSIEACDFSQFDTHILGVLGAPLPTIHLH
FT                   APAVMLNVLGQHVQQAIDYVTENPSAHLHMYGKLEAKHNRKMGHVTLFAEDADEVEEF"
FT   gene            50342..51682
FT                   /locus_tag="SpyM3_0029"
FT   CDS             50342..51682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit:
FT                   gi|15616965|ref|NP_240178.1| Asparaginyl-tRNA synthetase
FT                   [Buchnera sp. APS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78636"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Y1"
FT                   /protein_id="AAM78636.1"
FT                   /translation="MELREFKAWLLKNHFEEDELYKESIKCYQVEAYKAAYIFSYLANH
FT                   KFIAKLAIDYSGVPSNFMSKCPDDEVRKSSWQKCVNSLKNEDEWEQTVNEKLIQAWEDD
FT                   NVFKLPFKIKEKYSHMRVLRNNAAHAKDCRISESTVLELWNEIEYIYPYFVINGTIDAW
FT                   MEDLEKLVRYSNSSIESQNQLQNKFGDFSTENKTLIVKKIIQKYLVDSEWDETYPDIVM
FT                   NFLLYIFQESNYINQIGKDLTEKEELYLSIGTGIYHFQAEAIDIYSQFEESLSDYTFRY
FT                   FCEEFSDNFWKFIDSMDSEVNKENLTATSLEILKKNSAILVNAEFNESRFLSDNSLFFK
FT                   SVLDKIKHLYYYTMHHTGQRHHNTNTFDYSKFNSYIPYINYIFYRISSNPGLKEDEKVI
FT                   DFVKRCNNLISSDYSAESWYSERQMQDVIKKINEKYTILEDSGRESD"
FT   gene            52051..53343
FT                   /gene="purB"
FT                   /locus_tag="SpyM3_0030"
FT   CDS             52051..53343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SpyM3_0030"
FT                   /product="adenylosuccinate lyase"
FT                   /note="best blastp hit: gb|AAK33173.1| (AE006476)
FT                   adenylosuccinate lyase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78637"
FT                   /db_xref="GOA:Q8K8Y0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Y0"
FT                   /protein_id="AAM78637.1"
FT                   /translation="MIERYSRPEMAAIWTEENKYRAWLEVEILADEAWAELGEIPKEDV
FT                   AKIREKADFDIDRILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTNIVADKAREHKMTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NQERFEHAAAGVEAGKISGAVGNFANIPLFVEQYVCDKLGIRSQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMVTAYENVSLWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNLTVFPEN
FT                   MMRNMESTFGLIYSQRVMLKLIEKGMTREEAYDLVQPKTAYSWDNQVDFKPLLEEDTKV
FT                   TSCLTQEEIDELFNPIYYTKRVDDIFKRLGI"
FT   gene            53474..54385
FT                   /locus_tag="SpyM3_0031"
FT   CDS             53474..54385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK76056.1| (AE007488)
FT                   transcriptional regulator PlcR, putative [Streptococcus
FT                   pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78638"
FT                   /db_xref="GOA:Q8K8X9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8X9"
FT                   /protein_id="AAM78638.1"
FT                   /translation="MLEHFGGKVKVLRLEKRISREDLCGDESELSVRQLARIELGQSIP
FT                   SLSKVIFIAKALNVSVGYLTDGADLELPKRYKELKYLILRTPTYMDDGKLQVREEQFDE
FT                   IFEDYYDKLPEEEKVAVDIIQAKFEVYQTGDINFGYSILKEFLPQLKRKSIYNLNELLL
FT                   IDLYLIILVVSHFSDDIFDVQFYEEITESMLKQHNNLSLEDLFLLNNILLSCADTYIRL
FT                   KMFGHLKETLQLSHFIMSTIQDFQKMPMYCMYEWKLSIFYLKDINRARNYFEQSILFTQ
FT                   MTGDTYLVQKLRGEWNKDIHYI"
FT   gene            54605..55603
FT                   /gene="ruvB"
FT                   /locus_tag="SpyM3_0032"
FT   CDS             54605..55603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SpyM3_0032"
FT                   /product="putative Holliday junction DNA helicase subunit
FT                   B"
FT                   /note="best blastp hit: gb|AAK33175.1| (AE006476) putative
FT                   Holliday junction DNA helicase, subunit B [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78639"
FT                   /db_xref="GOA:P0DF50"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF50"
FT                   /protein_id="AAM78639.1"
FT                   /translation="MARILDNDVMGNEEFSDRTLRPQYLHEYIGQDKVKEQFAIFIEAA
FT                   KRRDESLDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSGPAVEKAGDLVAILNELEPG
FT                   DILFIDEIHRMPMSVEEVLYSAMEDFYIDIMIGAGDTSRSIHLDLPPFTLIGATTRAGM
FT                   LSNPLRARFGITGHMEYYQEKDLTEIVERTATIFEIKIDHEAARKLACRSRGTPRIANR
FT                   LLKRVRDYAQIIGDGIITAQITDRALTMLDVDREGLDYIDQKILRTMIEMYQGGPVGLG
FT                   TLSVNIAEERNTVEEMYEPYLIQKGFLMRTRTGRVATQKAYRHLGYPYQNT"
FT   gene            55741..56178
FT                   /locus_tag="SpyM3_0033"
FT   CDS             55741..56178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0033"
FT                   /product="putative protein-tyrosine phosphatase"
FT                   /note="best blastp hit: gb|AAK33176.1| (AE006477) putative
FT                   protein-tyrosine phosphatase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78640"
FT                   /db_xref="GOA:Q7CFL6"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFL6"
FT                   /protein_id="AAM78640.1"
FT                   /translation="MKKVCFVCLGNICRSPMAEFVMKSIVSSDVMMIESRATSDWEHGN
FT                   PIHSGTQSILKTYQINYDITKCSKQITITDFNTFDYIIGMDSDNVKNLKEMSQHQWDSK
FT                   IYLFREGGVPDPWYTNDFEETYQLVRKGCQDWLSRLMSKEY"
FT   gene            56201..56602
FT                   /locus_tag="SpyM3_0034"
FT   CDS             56201..56602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit:gb|AAK76092.1| (AE007492)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]; gb|AAL00641.1| (AE008548) hypothetical protein
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78641"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR014590"
FT                   /db_xref="UniProtKB/TrEMBL:F7IUL1"
FT                   /protein_id="AAM78641.1"
FT                   /translation="MIDMQDIVKKWSITRAKLEIVSVIVILVCAISVFSVRISNKTSLT
FT                   YDKGRIHYTGYVINHKMNGEGKLVYPNGDIYEGTFKNGLFEGKGTFTAKTGWLYNGEFH
FT                   KGQANGKGVLKAKNNKVYKGIFKQGIFQK"
FT   gene            56599..58374
FT                   /locus_tag="SpyM3_0035"
FT   CDS             56599..58374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0035"
FT                   /product="putative acyltransferase"
FT                   /note="best blastp hit: gb|AAK33178.1| (AE006477) putative
FT                   acyltransferase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78642"
FT                   /db_xref="GOA:Q8K8X7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8X7"
FT                   /protein_id="AAM78642.1"
FT                   /translation="MRIKWFSFVRVTGLLLVLLYHFFKNVFPGGFIGVDIFFTFSGYLI
FT                   TALLIDEYTKKESIDIIGFLKRRFYRIVPPLVLMILLTIPFTFLIKKDFIANIGSQITA
FT                   VLGFTTNIYEILTGSSYESQFIPHLFVHTWSLAIEVHFYLFWGVFVWLLARRKETQKQL
FT                   RGLLFLISLGIFAISFLSMSIRSFMTSNFSLIYFSSLSHSFPFFLGAMFATITGINETT
FT                   VRFQKNVRLWPRQYVLAAMVGAFTLLLVLTVTLDFNHITTYLFGFALASLFASIMIYAA
FT                   RVLHEQTPDVQEPKAITYIADISYGIYLFHWPFYIIFSQLMSHILAVILTVFFSILFAT
FT                   VSYYIVEPLVQGRKPNLLGLEIDCSPYYKWIVGGTLALALLTLGTCMIAPKVGKFEKQL
FT                   LVSSLQQAQSNMERTHTLAAGDANALSDVGIIGDSVALRSSAAFSKIMPQAQLDAAVSR
FT                   NFKEAFDLFNNQIKSKSLSKTVVLAVGVNSLDNYSQAVQSFIEALPKGHRLVLVSPYNA
FT                   KNASQVAEARDYGLKLSKKYKYVTIADWYKVAVEHPDIWYGSDGVHYSEDSQGAELYVS
FT                   TIQTAVEKSAKKPAK"
FT   gene            58683..61325
FT                   /gene="adh2"
FT                   /locus_tag="SpyM3_0036"
FT   CDS             58683..61325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh2"
FT                   /locus_tag="SpyM3_0036"
FT                   /product="putative alcohol dehydrogenase II"
FT                   /note="best blastp hit: gb|AAK76091.1| (AE007491) alcohol
FT                   dehydrogenase, iron-containing [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78643"
FT                   /db_xref="GOA:Q8K8X6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8X6"
FT                   /protein_id="AAM78643.1"
FT                   /translation="MTEGHNTVETTSVSVTIDALVQKGLAALAEMRKLDQEQVDYIVAK
FT                   ASVAALDAHGELAKHAYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTG
FT                   LTLIAEPVGVICGITPTTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRD
FT                   AAIAAGAPENCVQWVETPSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGA
FT                   GNVPAYVEKSANIRQAAHDIVMSKSFDNGMVCASEQAVIVDKEIYDDFVAEFKSYHTYF
FT                   VNKKEKALLEEFCFGAKANSKNCAGAKLNPNIVGKPATWISAQAGFTVPEGTNILAAEC
FT                   KEVSENEPLTREKLSPVIAVLKSESREDGVEKARQMVEFNGLGHSAAIHTADAELAKEF
FT                   GTRIRAIRVIWNSPSTFGGIGDVYNAFLPSLTLGCGSYGRNAVGDNVSAINLLNIKKVG
FT                   RRRNNMQWFKVPSKTYFERDSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRR
FT                   NKVVYQIFAEVEPDPDITTVMKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEV
FT                   DFHDLVQKFMDIRKRAFKFPELGKKTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIA
FT                   DYSLTPTVAIVDPALVLTVPGFIAADTGMDVLTHATEAYVSQMANDFTDGLALQAIKIV
FT                   FDNLEKSVKTADFEAREKMHNASTMAGMAFANAFLGISHSMAHKIGAQFHTVHGRTNAI
FT                   LLPYVIRYNGTRPAKTATWPKYNYYRADEKYQDIAKLLGLSASTPEEAVESYAKAVYDL
FT                   GCRVGIQMNFKAQGIDENEWKEHSRELAYLAYEDQCSPANPRLPMVDHMQEIIEDAYYG
FT                   YAERPGRRK"
FT   gene            61578..62594
FT                   /gene="adh1"
FT                   /locus_tag="SpyM3_0037"
FT   CDS             61578..62594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh1"
FT                   /locus_tag="SpyM3_0037"
FT                   /product="putative alcohol dehydrogenase I"
FT                   /note="best non-GAS blastp hit: gb|AAK74463.1| (AE007341)
FT                   alcohol dehydrogenase, zinc-containing [Streptococcus
FT                   pneumoniae TIGR4]; gb|AAK99066.1| (AE008407) Alcohol
FT                   dehydrogenase, propanol-preferring. [Streptococcus
FT                   pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78644"
FT                   /db_xref="GOA:Q8K8X5"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8X5"
FT                   /protein_id="AAM78644.1"
FT                   /translation="MKAVVVNQASTGVEVVEHDLPNVGHGEALVKVEYCGVCHTDLHVA
FT                   HGDFGQVPGRILGHEGIGIVEEIGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLC
FT                   RSVKNAGYSVDGGMSEYAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPG
FT                   QWIVIFGAGGLGNLAVQYAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVPG
FT                   YIQEKTGGAHGVVVTAVSKVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKV
FT                   VGSLVGTRKDLEEAFAFGAEGLVVPVVEKVPVDTAPEVFDEMERGLIQGRKVLDFIS"
FT   gene            62982..64271
FT                   /locus_tag="SpyM3_0038"
FT   CDS             62982..64271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0038"
FT                   /product="putative multi antimicrobial extrusion (MATE)
FT                   family transporter"
FT                   /note="best non-GAS blastp hit: gb|AAL00679.1| (AE008551)
FT                   multi antimicrobial extrusion (MATE) family transporter
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78645"
FT                   /db_xref="GOA:Q8K8X4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8X4"
FT                   /protein_id="AAM78645.1"
FT                   /translation="MIYSRRKIFSLALPSMIENILQMLMGMVDNYLVAQIGLVAVSGVS
FT                   IANNIISIYQSLFIALGAAVSSLIARSIGENNQNKQLNYMAGVLQVTLLLSVGLGLLSV
FT                   VGHHQVLEWLGAEASVTLVGGRYLSIVGGMIVSLGLLTSLGAIVRAQGYPKIPMQVSLL
FT                   INVLNAIFSALSIYVWGFGLLGVAWATVLSRLVGVFLLCQFIPIKQVAKRLMRPLDKII
FT                   FDLSLPAAGERLMMRAGDVLIIGIVVRFGTTALAGNAIGETLTQFNYMPGLAMATATII
FT                   LVARQLGGGKVTEIRYIIREAFILSTLMMLVMGALTYLLGPSLLPLFTQNTDAQRSAMV
FT                   VLLFSLLGAPATAGTLVYTAVWQGLGKAKLPFYATTIGMWVIRIGLGYVIGVVWQYGLI
FT                   GVWMATVLDNTSRWFILSKQFKKYQEITFH"
FT   gene            64470..64778
FT                   /gene="rpsJ"
FT                   /locus_tag="SpyM3_0039"
FT   CDS             64470..64778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SpyM3_0039"
FT                   /product="30S ribosomal protein S10"
FT                   /note="best blastp hit: gb|AAK33181.1| (AE006477) 30S
FT                   ribosomal protein S10 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78646"
FT                   /db_xref="GOA:P0DE62"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE62"
FT                   /protein_id="AAM78646.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLVDIINPTQKTVDALMKLDLPSGVNVEIKL"
FT   gene            65026..65652
FT                   /gene="rplC"
FT                   /locus_tag="SpyM3_0040"
FT   CDS             65026..65652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SpyM3_0040"
FT                   /product="50S ribosomal protein L3"
FT                   /note="best blastp hit: gb|AAK33182.1| (AE006477) 50S
FT                   ribosomal protein L3 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78647"
FT                   /db_xref="GOA:P0DE52"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE52"
FT                   /protein_id="AAM78647.1"
FT                   /translation="MTKGILGKKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETDG
FT                   YEAVQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNIEGLEVGAELSVEQFEAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKRLAGRMG
FT                   GNRVTVQNLEIVQVIPEKNVILVKGNVPGAKKSLITIKSAVKAAK"
FT   gene            65676..66299
FT                   /gene="rplD"
FT                   /locus_tag="SpyM3_0041"
FT   CDS             65676..66299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="SpyM3_0041"
FT                   /product="50S ribosomal protein L4"
FT                   /note="best blastp hit: gb|AAK33183.1| (AE006477) 50S
FT                   ribosomal protein L4 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78648"
FT                   /db_xref="GOA:P0DE54"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE54"
FT                   /protein_id="AAM78648.1"
FT                   /translation="MANVKLFDQTGKEVSSVELNDAIFGIEPNESVVFDVVISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSAKVAEDKFVAVEGLSFAAPKTAEFAKVLSALSIDTKVLVLVEEGNEFA
FT                   ALSARNLPNVTVATAATASVLDIVNADKLLVTKEAISTIEEVLS"
FT   gene            66299..66595
FT                   /gene="rplW"
FT                   /locus_tag="SpyM3_0042"
FT   CDS             66299..66595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SpyM3_0042"
FT                   /product="50S ribosomal protein L23"
FT                   /note="best blastp hit: gb|AAK33184.1| (AE006477) 50S
FT                   ribosomal protein L23 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78649"
FT                   /db_xref="GOA:P0DE24"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE24"
FT                   /protein_id="AAM78649.1"
FT                   /translation="MNLYDVIKKPVITEKSMIALEAGKYTFEVDTRAHKLLIKQAVEAA
FT                   FDGVKVASVNTVNVKPKAKRVGRYTGFTSKTKKAIITLTADSKAIELFAAEAE"
FT   gene            66613..67446
FT                   /gene="rplB"
FT                   /locus_tag="SpyM3_0043"
FT   CDS             66613..67446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SpyM3_0043"
FT                   /product="50S ribosomal protein L2"
FT                   /note="best blastp hit: gb|AAK33185.1| (AE006477) 50S
FT                   ribosomal protein L2 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78650"
FT                   /db_xref="GOA:P0DE34"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE34"
FT                   /protein_id="AAM78650.1"
FT                   /translation="MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKSKAGRNN
FT                   NGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPDADIKVGNALPLANIPVGTVVHNIELKPGKGGELVRAAGASAQ
FT                   VLGQEGKYVLVRLQSGEVRMILGTCRATIGTVGNEQQSLVNIGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK"
FT   gene            67585..67863
FT                   /gene="rpsS"
FT                   /locus_tag="SpyM3_0044"
FT   CDS             67585..67863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SpyM3_0044"
FT                   /product="30S ribosomal protein S19"
FT                   /note="best blastp hit: gb|AAK33186.1| (AE006478) 30S
FT                   ribosomal protein S19 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78651"
FT                   /db_xref="GOA:P0DE82"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE82"
FT                   /protein_id="AAM78651.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRR"
FT   gene            67879..68223
FT                   /gene="rplV"
FT                   /locus_tag="SpyM3_0045"
FT   CDS             67879..68223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SpyM3_0045"
FT                   /product="50S ribosomal protein L22"
FT                   /note="best blastp hit: gb|AAK33187.1| (AE006478) 50S
FT                   ribosomal protein L22 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78652"
FT                   /db_xref="GOA:P0DE22"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE22"
FT                   /protein_id="AAM78652.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPN
FT                   KAARVIEKTLNSAIANAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRT
FT                   THVTVVVSEK"
FT   gene            68263..68889
FT                   /gene="rpsC"
FT                   /locus_tag="SpyM3_0046"
FT   CDS             68263..68889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SpyM3_0046"
FT                   /product="30S ribosomal protein S3"
FT                   /note="best blastp hit: gb|AAK33188.1| (AE006478) 30S
FT                   ribosomal protein S3 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78653"
FT                   /db_xref="GOA:P0DE90"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE90"
FT                   /protein_id="AAM78653.1"
FT                   /translation="MRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFINKELADASVSTI
FT                   EIERAVNKVIVSLHTAKPGMVIGKGGANVDALRGQLNKLTGKQVHINIIEIKQPDLDAH
FT                   LVGENIARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIARAEGYSEGTV
FT                   PLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   gene            68893..69306
FT                   /gene="rplP"
FT                   /locus_tag="SpyM3_0047"
FT   CDS             68893..69306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SpyM3_0047"
FT                   /product="50S ribosomal protein L16"
FT                   /note="best blastp hit: gb|AAK33189.1| (AE006478) 50S
FT                   ribosomal protein L16 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78654"
FT                   /db_xref="GOA:P0DE08"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE08"
FT                   /protein_id="AAM78654.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVSFGEYGLQATTSHWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   gene            69316..69522
FT                   /gene="rpmC"
FT                   /locus_tag="SpyM3_0048"
FT   CDS             69316..69522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SpyM3_0048"
FT                   /product="50S ribosomal protein L29"
FT                   /note="best blastp hit: gb|AAK33190.1| (AE006478) 50S
FT                   ribosomal protein L29 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78655"
FT                   /db_xref="GOA:P0DE32"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE32"
FT                   /protein_id="AAM78655.1"
FT                   /translation="MKLQEIKDFVKELRGLSQEELAKKENELKKELFDLRFQAAAGQLE
FT                   KTARLDEVKKQIARVKTVQSEMK"
FT   gene            69548..69808
FT                   /gene="rpsQ"
FT                   /locus_tag="SpyM3_0049"
FT   CDS             69548..69808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SpyM3_0049"
FT                   /product="30S ribosomal protein S17"
FT                   /note="best blastp hit: gb|AAK33191.1| (AE006478) 30S
FT                   ribosomal protein S17 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78656"
FT                   /db_xref="GOA:P0DE78"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE78"
FT                   /protein_id="AAM78656.1"
FT                   /translation="MERNQRKTLYGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEKAVII"
FT   gene            69833..70201
FT                   /gene="rplN"
FT                   /locus_tag="SpyM3_0050"
FT   CDS             69833..70201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SpyM3_0050"
FT                   /product="50S ribosomal protein L14"
FT                   /note="best blastp hit: gb|AAK33192.1| (AE006478) 50S
FT                   ribosomal protein L14 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78657"
FT                   /db_xref="GOA:P0DE04"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR023571"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE04"
FT                   /protein_id="AAM78657.1"
FT                   /translation="MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKTGARRPDGSYIKFDDNAAVIIRDDKTPRGTRIFGPVAR
FT                   ELREGGYMKIVSLAPEVL"
FT   gene            70280..70585
FT                   /gene="rplX"
FT                   /locus_tag="SpyM3_0051"
FT   CDS             70280..70585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SpyM3_0051"
FT                   /product="50S ribosomal protein L24"
FT                   /note="best blastp hit: gb|AAK33193.1| (AE006478) 50S
FT                   ribosomal protein L24 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78658"
FT                   /db_xref="GOA:P0DE26"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE26"
FT                   /protein_id="AAM78658.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLKALPKVNKVIVEGVGMIKKHQ
FT                   KPNTENPQGAIVEKEAPIHVSNVQVLDKNGVAGRVGYKVVDGKKVRYSKKSGEVLD"
FT   gene            70609..71151
FT                   /gene="rplE"
FT                   /locus_tag="SpyM3_0052"
FT   CDS             70609..71151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="SpyM3_0052"
FT                   /product="50S ribosomal protein L5"
FT                   /note="best blastp hit: gb|AAK33194.1| (AE006478) 50S
FT                   ribosomal protein L5 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78659"
FT                   /db_xref="GOA:P0DE56"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE56"
FT                   /protein_id="AAM78659.1"
FT                   /translation="MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAV
FT                   SNAKNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEISFDDVDKVRGLDIVIVTTANT
FT                   DEESRELLKGLGMPFAK"
FT   gene            71167..71352
FT                   /gene="rpsN.1"
FT                   /locus_tag="SpyM3_0053"
FT   CDS             71167..71352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN.1"
FT                   /locus_tag="SpyM3_0053"
FT                   /product="30S ribosomal protein S14"
FT                   /note="best blastp hit: gb|AAK33195.1| (AE006478) 30S
FT                   ribosomal protein S14 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78660"
FT                   /db_xref="GOA:P0DE72"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE72"
FT                   /protein_id="AAM78660.1"
FT                   /translation="MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFR
FT                   ELAYKGQIPGVVKASW"
FT   gene            71503..71901
FT                   /gene="rpsH"
FT                   /locus_tag="SpyM3_0054"
FT   CDS             71503..71901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SpyM3_0054"
FT                   /product="30S ribosomal protein S8"
FT                   /note="best blastp hit: gb|AAK33196.1| (AE006478) 30S
FT                   ribosomal protein S8 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78661"
FT                   /db_xref="GOA:P0DF00"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF00"
FT                   /protein_id="AAM78661.1"
FT                   /translation="MVMTDPIADFLTRIRNANQVKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEVIEDDKQGIIRVFLKYGKNGERVITNLKRISKPGLRVYAKRDDMPKVLNGLGIA
FT                   IISTSEGLLTDKEARQKNVGGEVIAYVW"
FT   gene            72104..72640
FT                   /gene="rplF"
FT                   /locus_tag="SpyM3_0055"
FT   CDS             72104..72640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SpyM3_0055"
FT                   /product="50S ribosomal protein L6"
FT                   /note="best blastp hit: gb|AAK33197.1| (AE006478) 50S
FT                   ribosomal protein L6 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78662"
FT                   /db_xref="GOA:P0DE58"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE58"
FT                   /protein_id="AAM78662.1"
FT                   /translation="MSRIGNKVITMPAGVELTNNNNVITVKGPKGELTREFNKNIEIKV
FT                   EGTEITVVRPNDSKEMKTIHGTTRANLNNMVVGVSEGFKKDLEMKGVGYRAQLQGTKLV
FT                   LSVGKSHQDEVEAPEGITFTVANPTSISVEGINKEVVGQTAAYIRSLRSPEPYKGKGIR
FT                   YVGEYVRLKEGKTGK"
FT   gene            72745..73101
FT                   /gene="rplR"
FT                   /locus_tag="SpyM3_0056"
FT   CDS             72745..73101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SpyM3_0056"
FT                   /product="50S ribosomal protein L18"
FT                   /note="best blastp hit: gb|AAK33198.1| (AE006478) 50S
FT                   ribosomal protein L18 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78663"
FT                   /db_xref="GOA:P0DE12"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE12"
FT                   /protein_id="AAM78663.1"
FT                   /translation="MISKPDKNKIRQKRHRRVRGKLSGTADRPRLNVFRSNTGIYAQVI
FT                   DDVAGVTLASASTLDKDVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYHGRV
FT                   KALADAARENGLKF"
FT   gene            73120..73614
FT                   /gene="rpsE"
FT                   /locus_tag="SpyM3_0057"
FT   CDS             73120..73614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SpyM3_0057"
FT                   /product="30S ribosomal protein S5"
FT                   /note="best blastp hit: gb|AAK33199.1| (AE006478) 30S
FT                   ribosomal protein S5 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78664"
FT                   /db_xref="GOA:P0DE94"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE94"
FT                   /protein_id="AAM78664.1"
FT                   /translation="MAFKDNAVELEERVVAINRVTKVVKGGRRLRFAALVVVGDGNGRV
FT                   GFGTGKAQEVPEAIRKAVEAAKKNMIEVPMVGTTIPHEVYTNFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVIELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDL
FT                   A"
FT   gene            73629..73811
FT                   /gene="rpmD"
FT                   /locus_tag="SpyM3_0058"
FT   CDS             73629..73811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SpyM3_0058"
FT                   /product="50S ribosomal protein L30"
FT                   /note="best blastp hit: gb|AAK33200.1| (AE006478) 50S
FT                   ribosomal protein L30 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78665"
FT                   /db_xref="GOA:P0DE36"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE36"
FT                   /protein_id="AAM78665.1"
FT                   /translation="MAQIKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRG
FT                   MVTAISHLVTVEDVK"
FT   gene            74027..74467
FT                   /gene="rplO"
FT                   /locus_tag="SpyM3_0059"
FT   CDS             74027..74467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SpyM3_0059"
FT                   /product="50S ribosomal protein L15"
FT                   /note="best blastp hit: gb|AAK33201.1| (AE006478) 50S
FT                   ribosomal protein L15 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78666"
FT                   /db_xref="GOA:P0DE06"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE06"
FT                   /protein_id="AAM78666.1"
FT                   /translation="MKLHELKAAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRIPKRGFTNINTKEYALVNLDQLNVFDDGTEVTPAILKDAGIVRA
FT                   EKSGVKVLGNGELTKKLTVKAAKFSKSAEAAIIAKGGSIEVI"
FT   gene            74484..75788
FT                   /gene="secY"
FT                   /locus_tag="SpyM3_0060"
FT   CDS             74484..75788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SpyM3_0060"
FT                   /product="putative preprotein translocase"
FT                   /note="best blastp hit: gb|AAK33202.1| (AE006478) putative
FT                   preprotein translocase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78667"
FT                   /db_xref="GOA:Q7CFK3"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFK3"
FT                   /protein_id="AAM78667.1"
FT                   /translation="MFLKILKDALKIKTVRNKIFFTIFIILVFRIGTHITVPGVNAKSL
FT                   EQLSELPFLNMLNLVSGNAMRNFSVFSMGVSPYITASIVVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYISLVLAFAQSIGITAGFNTLSNVALVKTPDIKTYLLIGALLTTGSVI
FT                   VTWLGEQITDKGFGNGVSMIIFAGIISSIPSAIATIREDYFVNVKASDLHSSYLIVGIL
FT                   IIAVLAIVFFTTYVQQAEYKIPIQYTKLMQGAPTSSYLPLKVNPAGVIPVIFASSITTI
FT                   PSTIIPFVQNGRDLPWLNRLQEIFNYQTPVGMIVYALLIILFSFFYTFVQVNPEKTAEN
FT                   LQKNSSYIPSVRPGRETEQFMSALLKKLATVGAIFLAFISLAPIAAQQALNLSSSIALG
FT                   GTSLLILISTGIEGMKQLEGYLLKRKYVGFMNTAE"
FT   gene            75938..76576
FT                   /gene="adk"
FT                   /locus_tag="SpyM3_0061"
FT   CDS             75938..76576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SpyM3_0061"
FT                   /product="adenylate kinase"
FT                   /note="best blastp hit: sp|P82549|KAD_STRPY ADENYLATE
FT                   KINASE (ATP-AMP TRANSPHOSPHORYLASE)"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78668"
FT                   /db_xref="GOA:P0DB92"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DB92"
FT                   /protein_id="AAM78668.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEEFGVAHISTGDMFRAAMANQTEM
FT                   GRLAKSYIDKGELVPDEVTNGIVKERLAEDDIAEKGFLLDGYPRTIEQAHALDATLEEL
FT                   GLRLDGVINIKVDPSCLVERLSGRIINRKTGETFHKVFNPPVDYKEEDYYQREDDKPET
FT                   VKRRLDVNMAQGEPILEHYRKLGLVTDIEGNQEITDVFADVEKALLELK"
FT   gene            76694..76912
FT                   /gene="infA"
FT                   /locus_tag="SpyM3_0062"
FT   CDS             76694..76912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SpyM3_0062"
FT                   /product="putative translation initiation factor IF-1"
FT                   /note="best blastp hit: gb|AAK33204.1| (AE006478) putative
FT                   translation initiation factor IF-1 [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78669"
FT                   /db_xref="GOA:P0DB82"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DB82"
FT                   /protein_id="AAM78669.1"
FT                   /translation="MAKEDVIEIEGKVVETMPNAMFTVELENGHQILATVSGKIRKNYI
FT                   RILVGDRVTVEMSPYDLTRGRITYRFK"
FT   gene            76938..77054
FT                   /gene="rpmJ"
FT                   /locus_tag="SpyM3_0063"
FT   CDS             76938..77054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="SpyM3_0063"
FT                   /product="50S ribosomal protein B"
FT                   /note="best blastp hit: gb|AAK33205.1| (AE006478) 50S
FT                   ribosomal protein B [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78670"
FT                   /db_xref="GOA:P0DE50"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE50"
FT                   /protein_id="AAM78670.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPTNPKHKQRQG"
FT   gene            77072..77437
FT                   /gene="rpsM"
FT                   /locus_tag="SpyM3_0064"
FT   CDS             77072..77437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SpyM3_0064"
FT                   /product="30S ribosomal protein S13"
FT                   /note="best blastp hit: gb|AAK33206.1| (AE006478) 30S
FT                   ribosomal protein S13 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78671"
FT                   /db_xref="GOA:P0DE68"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE68"
FT                   /protein_id="AAM78671.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDIRV
FT                   KDLTSDQEDAIRREVDAIKVEGDLRREVNMNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   gene            77482..77838
FT                   /gene="rpsK"
FT                   /locus_tag="SpyM3_0065"
FT   CDS             77482..77838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SpyM3_0065"
FT                   /product="30S ribosomal protein S11"
FT                   /note="best blastp hit: gb|AAK33207.1| (AE006478) 30S
FT                   ribosomal protein S11 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78672"
FT                   /db_xref="GOA:P0DE64"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE64"
FT                   /protein_id="AAM78672.1"
FT                   /translation="MKKNIESGVAHIHATFNNTIVMITDVHGNALAWSSAGALGFKGSR
FT                   KSTPFAAQMAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLEVTAIRDVTP
FT                   VPHNGARPPKRRRV"
FT   gene            77884..78822
FT                   /gene="rpoA"
FT                   /locus_tag="SpyM3_0066"
FT   CDS             77884..78822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SpyM3_0066"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /note="best blastp hit: gb|AAK33208.1| (AE006478)
FT                   DNA-directed RNA polymerase alpha subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78673"
FT                   /db_xref="GOA:P0DF28"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF28"
FT                   /protein_id="AAM78673.1"
FT                   /translation="MIEFEKPIITKIDENKDYGRFVIEPLERGYGTTLGNSLRRVLLSS
FT                   LPGAAVTSIKIDGVLHEFDTIPGVREDVMQIILNVKGLAVKSYVEDEKIIELEVEGPAE
FT                   VTAGDILTDSDIELVNPDHYLFTIAEGHSLRATMTVAKKRGYVPAEGNKKDDAPVGTLA
FT                   VDSIYTPVKKVNYQVEPARVGSNDGFDKLTIEIMTNGTIIPEDALGLSARVLIEHLNLF
FT                   TDLTEVAKSTEVMKETEKVNDEKVLDRTIEELDLSVRSYNCLKRAGINTVFDLTEKSEP
FT                   EMMKVRNLGRKSLEEVKVKLADLGLGLKNDK"
FT   gene            78837..79223
FT                   /gene="rplQ"
FT                   /locus_tag="SpyM3_0067"
FT   CDS             78837..79223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SpyM3_0067"
FT                   /product="50S ribosomal protein L17"
FT                   /note="best blastp hit: ref|NP_268487.1| (NC_002737)
FT                   ribosomal protein L17 [Streptococcus pyogenes]
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78674"
FT                   /db_xref="GOA:P0DE10"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE10"
FT                   /protein_id="AAM78674.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAYVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   gene            80046..81600
FT                   /locus_tag="SpyM3_r05"
FT   rRNA            80149..81483
FT                   /locus_tag="SpyM3_r05"
FT                   /product="16S ribosomal RNA"
FT   gene            81645..81720
FT                   /locus_tag="SpyM3_t29"
FT   tRNA            81645..81720
FT                   /locus_tag="SpyM3_t29"
FT                   /product="tRNA-Ala"
FT   gene            82016..84920
FT                   /locus_tag="SpyM3_r06"
FT   rRNA            82017..84916
FT                   /locus_tag="SpyM3_r06"
FT                   /product="23S ribosomal RNA"
FT   gene            85002..85119
FT                   /locus_tag="SpyM3_r15"
FT   gene            85137..85209
FT                   /locus_tag="SpyM3_t30"
FT   tRNA            85137..85209
FT                   /locus_tag="SpyM3_t30"
FT                   /product="tRNA-Val"
FT   gene            85215..85285
FT                   /locus_tag="SpyM3_t31"
FT   tRNA            85215..85285
FT                   /locus_tag="SpyM3_t31"
FT                   /product="tRNA-Gly"
FT   gene            85320..85393
FT                   /locus_tag="SpyM3_t32"
FT   tRNA            85320..85393
FT                   /locus_tag="SpyM3_t32"
FT                   /product="tRNA-Ile"
FT   gene            85416..85487
FT                   /locus_tag="SpyM3_t33"
FT   tRNA            85416..85487
FT                   /locus_tag="SpyM3_t33"
FT                   /product="tRNA-Glu"
FT   gene            85498..85587
FT                   /locus_tag="SpyM3_t34"
FT   tRNA            85498..85587
FT                   /locus_tag="SpyM3_t34"
FT                   /product="tRNA-Ser"
FT   gene            85597..85670
FT                   /locus_tag="SpyM3_t35"
FT   tRNA            85597..85670
FT                   /locus_tag="SpyM3_t35"
FT                   /product="tRNA-Met"
FT   gene            85691..85763
FT                   /locus_tag="SpyM3_t36"
FT   tRNA            85691..85763
FT                   /locus_tag="SpyM3_t36"
FT                   /product="tRNA-Phe"
FT   gene            85783..85863
FT                   /locus_tag="SpyM3_t37"
FT   tRNA            85783..85863
FT                   /locus_tag="SpyM3_t37"
FT                   /product="tRNA-Tyr"
FT   gene            85870..85940
FT                   /locus_tag="SpyM3_t38"
FT   tRNA            85870..85940
FT                   /locus_tag="SpyM3_t38"
FT                   /product="tRNA-Trp"
FT   gene            85952..86024
FT                   /locus_tag="SpyM3_t39"
FT   tRNA            85952..86024
FT                   /locus_tag="SpyM3_t39"
FT                   /product="tRNA-His"
FT   gene            86033..86104
FT                   /locus_tag="SpyM3_t40"
FT   tRNA            86033..86104
FT                   /locus_tag="SpyM3_t40"
FT                   /product="tRNA-Gln"
FT   gene            86124..86207
FT                   /locus_tag="SpyM3_t41"
FT   tRNA            86124..86207
FT                   /locus_tag="SpyM3_t41"
FT                   /product="tRNA-Leu"
FT   gene            86467..86652
FT                   /locus_tag="SpyM3_0068"
FT   CDS             86467..86652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0068"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33209.1| (AE006479)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8W8"
FT                   /protein_id="AAM78675.1"
FT                   /translation="MSFEIFTLIIGWKLVGYRVMECGSSFKQGDYRLVVHICLLNVRDE
FT                   MLSQQGHEDKADWPEP"
FT   misc_feature    87350..87865
FT                   /note="region contains multiple probable gene fragments;
FT                   best blastp hit= ref|NP_240927.1| (NC_002570) isopentenyl
FT                   monophosphate kinase [Bacillus halodurans]
FT                   sp|Q9KGK0|ISPE_BACHD
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK)
FT                   (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase)"
FT   gene            87975..88418
FT                   /gene="adcR"
FT                   /locus_tag="SpyM3_0069"
FT   CDS             87975..88418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcR"
FT                   /locus_tag="SpyM3_0069"
FT                   /product="putative repressor protein"
FT                   /note="best non-GAS blastp hit: gb|AAK76226.1| (AE007505)
FT                   adc operon repressor AdcR [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78676"
FT                   /db_xref="GOA:F7IUN4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F7IUN4"
FT                   /protein_id="AAM78676.1"
FT                   /translation="MGTLEKKLDNLVNTILLKAENQHELLFGACQSDVKLTNTQEHILM
FT                   LLSQQRLTNTDLAKALNISQAAVTKAIKSLVKQDMLAGTKDTVDARVTYFELTELAKPI
FT                   ASEHTHHHDETLNVYNRLLQKFSAKELEIVDKFVTVFAEELEG"
FT   gene            88422..89141
FT                   /gene="adcC"
FT                   /locus_tag="SpyM3_0070"
FT   CDS             88422..89141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcC"
FT                   /locus_tag="SpyM3_0070"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="best non-GAS blastp hit: emb|CAA96186.1| (Z71552)
FT                   AdcC protein [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78677"
FT                   /db_xref="GOA:Q8K8W7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8W7"
FT                   /protein_id="AAM78677.1"
FT                   /translation="MRYISVENLSFQYESEPVLEGITYHLDSGEFVTMTGENGAAKSTL
FT                   IKATLGILQPKAGRVTIAKKNKDGKQLRIAYLPQQVASFNAGFPSTVYEFVKSGRYPRS
FT                   GWFRHLNKHDEEHVQASLEAVGMWENRHKRIGSLSGGQKQRVVIARMFASDPDIFVLDE
FT                   PTTGMDSGTTDTFYELMHHSAHQHGKSVLMITHDPEEVKAYADRNIHLVRNQKLPWRCF
FT                   NIHEVETDDEKGGHGHA"
FT   gene            89134..89949
FT                   /gene="adcB"
FT                   /locus_tag="SpyM3_0071"
FT   CDS             89134..89949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcB"
FT                   /locus_tag="SpyM3_0071"
FT                   /product="putative ABC transporter (permease)"
FT                   /note="best non-GAS blastp hit:emb|CAA96187.1| (Z71552)
FT                   AdcB protein [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78678"
FT                   /db_xref="GOA:Q7CFK0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFK0"
FT                   /protein_id="AAM78678.1"
FT                   /translation="MLDILSYDFMQRAVMAVVAISIFAPILGIFLILRRQSLMSDTLSH
FT                   VSLAGVALGVVLGISPTITTIIVVVLAAILLEYLRVVYKHYMEISTAILMSLGLALSLI
FT                   IMSKSHSSSSMSLEQYLFGSIITISMEQVVALFAIAAIILILTVLFIRPMYILTFDEDT
FT                   AFVDGLPVRLMSVLFNIVTGVAIALTIPAAGALLVSTIMVLPASIAMRLGKNFKTVILL
FT                   GIVIGFSGMLSGIFLSYFFETPASATITMIFISIFLLVSLGGMLKKRLF"
FT   gene            complement(89989..90372)
FT                   /locus_tag="SpyM3_0072"
FT   CDS             complement(89989..90372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0072"
FT                   /product="putative histidine triad (HIT) protein"
FT                   /note="best blastp hit: gb|AAK33213.1| (AE006479) putative
FT                   histidine triad (HIT) protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78679"
FT                   /db_xref="GOA:Q8K8W6"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8W6"
FT                   /protein_id="AAM78679.1"
FT                   /translation="MTECIFCHQLKANQLLTQSQYFKVVFDIDPIQKGYLLLISKDHYT
FT                   SLTQLPKEVRYDLINLQAALVAKLEQHLPISGVTSVSNDKELMDEGTHFHLHLIPRLTN
FT                   DSFWEGITINQENWDLAPFLKHL"
FT   gene            complement(90428..91684)
FT                   /gene="tyrS"
FT                   /locus_tag="SpyM3_0073"
FT   CDS             complement(90428..91684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="SpyM3_0073"
FT                   /product="putative tyrosine-tRNA ligase"
FT                   /note="best blastp hit: gb|AAK33214.1| (AE006479) putative
FT                   tyrosine-tRNA ligase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78680"
FT                   /db_xref="GOA:P0DG62"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG62"
FT                   /protein_id="AAM78680.1"
FT                   /translation="MNIFEELKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLH
FT                   LGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQ
FT                   LSTFLDFENGDNKAELVNNYDWFSQISFIDFLRDVGKYFTVNYMMSKDSVKKRIETGIS
FT                   YTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLRKKADKTGHVMTVPLI
FT                   TDSTGKKFGKSEGNAVWLDADKTSPYEMYQFWLNVMDDDAVRFLKIFTFLSLDEIAEIE
FT                   SQFNAARHERLAQKTLAREVVTLVHGEEAYKQALNITEQLFAGNIKNLSANELKQGLSN
FT                   VPNYHVQSEDSLNLVDMLVTAGISPSKRQAREDVQNGAIYINGDRIQDLDYQLSNDDKI
FT                   DDQLTVIRRGKKKYAVLTY"
FT   gene            91788..94088
FT                   /gene="pbp1B"
FT                   /locus_tag="SpyM3_0074"
FT   CDS             91788..94088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp1B"
FT                   /locus_tag="SpyM3_0074"
FT                   /product="putative penicillin-binding protein 1b"
FT                   /note="best blastp hit: gb|AAK33215.1| (AE006480) putative
FT                   penicillin-binding protein 1b [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78681"
FT                   /db_xref="GOA:Q8K8W4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8W4"
FT                   /protein_id="AAM78681.1"
FT                   /translation="MVKWNTKQKRISHQRLGLLDLGPVLLRTLRLLSNFFYIVIFLFGM
FT                   MGFGMAFGYLASQIESVKVPSKESLVKQVESLTMISQMNYSDNSLISTLDTDLLRTPVA
FT                   NDAISENIKKAIVSTEDEHFQEHKGVVPKAVFRATLASVLGFGEASGGSTLTQQLVKQQ
FT                   VLGDDPTFKRKSKEIVYALALERYMSKDNILCDYLNVSPFGRNNKGQNIAGVEEAARGI
FT                   FGVSAKDLTVPQAAFLAGLPQSPIVYSPYLSTGQLKSEKDMAYGIKRQQNVLYNMYRTG
FT                   VLSKKEYEDYKAYPIQKDFIQPGSAIVNNHDYLYYTVLADAKKAMYSYLIKRDKVSSRD
FT                   LKNDETKAAYEERALTELQQGGYTITTTINKPIYNAMQTAAAQFGGLLDDGTGTVQMGN
FT                   VLTDNATGAVLGFVGGRDYALNQNNHAFNTVRSPGSSIKPIIAYGPAIDQGLMGSASVL
FT                   SNYPTTYSSGQKIMHADSEGTAMMPLQEALNTSWNIPAFWTQKLLREKGVDVENYMTKM
FT                   GYKIADYSIESLPLGGGIEVSVAQQTNAYQMLSNNGLYQKQYIVDKITASDGTVVYKHE
FT                   NKPIRIFSAATATILQELLRGPITSGATTTFKNRLAAINPWLANADWIGKTGTTENYTD
FT                   VWLVLSTPKVTLGGWAGHDDNTSLAPLTGYNNNSNYLAYLANAINQADPNVIGVGQRFN
FT                   LDPGVIKANVLKSTGLQPGTVNVNGHTFSVGGEMTTSLWSQKGPGAMTYRFAIGGTDAD
FT                   YQKAWGNFGFRKN"
FT   gene            94352..97918
FT                   /gene="rpoB"
FT                   /locus_tag="SpyM3_0075"
FT   CDS             94352..97918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="SpyM3_0075"
FT                   /product="putative DNA-dependent RNA polymerase subunit
FT                   beta"
FT                   /note="best blastp hit: gb|AAK33216.1| (AE006480) putative
FT                   DNA-dependent RNA polymerase subunit beta [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78682"
FT                   /db_xref="GOA:P0DF30"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF30"
FT                   /protein_id="AAM78682.1"
FT                   /translation="MAGHEVRYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDSGL
FT                   KEVFEDVLPISNFTDTMELEFVGYEFKEPKYTLEEARIHDASYSAPIFVTFRLVNKETG
FT                   EIKTQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVDKNGKVGYGSTVI
FT                   PNRGAWLELETDSKDIAYTRIDRTRKIPFTTLVRALGFSGDDEIVDIFGESDLVRNTIE
FT                   KDIHKNPSDSRTDEALKEIYERLRPGEPKTADSSRSLLIARFFDARRYDLAAVGRYKVN
FT                   KKLNIKTRLLNQIIAENLVDAETGEILVEAGTEMTRSVIESIEEHLDGDLNKFVYTPND
FT                   YAVVTEPVVLQKFKVVSPIDPDRVVTIVGNANPDDKVRALTPADILAEMSYFLNLAEGL
FT                   GKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQDNDVLTPQQIINIRPV
FT                   TAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGR
FT                   MCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGRVTNEIVWLTADEEDEY
FT                   TVAQANSKLNEDGTFAEEIVMGRHQGNNQEFSASVVDFVDVSPKQVVAVATACIPFLEN
FT                   DDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVIAQHNGKVVFSDAEKV
FT                   EIRRQDGSLDVYHITKFRRSNSGTAYNQRTLVKVGDIVEKGDFIADGPSMENGEMALGQ
FT                   NPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNV
FT                   GEEALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDT
FT                   SLRVPHGGDGIVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGV
FT                   VSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVFD
FT                   GASSEDLWDTVREAGMDSDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARS
FT                   VGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYE
FT                   AITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDDNEVELRDLDEGEDDDIMHVDD
FT                   LEKAREKQAQETQEVSETTDEK"
FT   gene            98009..101632
FT                   /gene="rpoC"
FT                   /locus_tag="SpyM3_0076"
FT   CDS             98009..101632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="SpyM3_0076"
FT                   /product="putative DNA-dependent RNA polymerase beta prime
FT                   subunit"
FT                   /note="best blastp hit: gb|AAK33217.1| (AE006480)
FT                   DNA-dependent RNA polymerase, B' subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78683"
FT                   /db_xref="GOA:P0DF32"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF32"
FT                   /protein_id="AAM78683.1"
FT                   /translation="MVDVNRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREG
FT                   LFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHI
FT                   WYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPKDTPLEPKSLLTEREYREKLQEYG
FT                   HGSFVAKMGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKAVRRLDVLDAFNKSGN
FT                   KPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGII
FT                   VQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFS
FT                   GRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKEYAGNVKAAKRMVERGDERIW
FT                   DILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAI
FT                   HVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIF
FT                   KDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDSQRHKIMVTTVGKILFNDIMPEDL
FT                   PYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDGLDINVPFKKKNLGNIIAETFKRFRTT
FT                   ETSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMT
FT                   DDDRYVAVTTTWREAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMA
FT                   APNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDV
FT                   IIREDDCGTDRGLLIRAITDGKEVTETLEVRLQGRYTRKSVKHPETGEVLIGADQLITE
FT                   DMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGE
FT                   PGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKGEAVITEVKGNVVEIEEDAST
FT                   RTKKVYVQGKTGMGEYVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVET
FT                   YLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANK
FT                   DIVISGGIPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKE
FT                   NVIIGKIIPAGTGMARYRNIEPQAMNEIEVIDHTEVSAEAE"
FT   gene            101802..102149
FT                   /locus_tag="SpyM3_0077"
FT   CDS             101802..102149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0077"
FT                   /product="putative DNA binding protein"
FT                   /note="best blastp hit: gb|AAK33218.1| (AE006481) putative
FT                   DNA binding protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78684"
FT                   /db_xref="InterPro:IPR010434"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8W1"
FT                   /protein_id="AAM78684.1"
FT                   /translation="MYGDWEPWWFIDGWQDDIIDEQQFSDWQEALDYFNQEWQRMKAIF
FT                   PSYHSQKNLLATFWEKEDKRWCEDCDEDLQQFHSLLLLKNKDIVPSNNYIPEFEQRNDS
FT                   PQVAYLCKLNL"
FT   gene            102242..103180
FT                   /gene="comYA"
FT                   /locus_tag="SpyM3_0078"
FT   CDS             102242..103180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYA"
FT                   /locus_tag="SpyM3_0078"
FT                   /product="putative ABC transporter subunit ComYA"
FT                   /note="best non-GAS blastp hit: gb|AAC45310.1| (U81957)
FT                   putative ABC transporter subunit ComYA [Streptococcus
FT                   gordonii]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78685"
FT                   /db_xref="GOA:Q8K8W0"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8W0"
FT                   /protein_id="AAM78685.1"
FT                   /translation="MVQALAKAILAKAEQVQAQDIYILPRADQYDLFLRIGDERRLVDV
FT                   YQSDRMAPLISHFKFVAGMIVGEKRRCQVGSCDYKLSKDKQLSLRLSSVGDYRGQESLV
FT                   IRLLHHQNKSVHYWFDGLTKVANQVGGRGLYLFAGPVGSGKTTLMYQLISSYHQEAQVI
FT                   SIEDPVEIKNHQILQLQVNDDIGMTYDNLIKLSLRHRPDILVIGEIRDSQTARAVIRDS
FT                   LTGAMVFSTVHAKSISGVYARLLELGVTKAELSNCLALIAYQRLLNGGALIDSTQNEFE
FT                   YYSSSNWNQQIDQLLEAGHLNPKQAKLEKII"
FT   gene            103116..104150
FT                   /gene="comYB"
FT                   /locus_tag="SpyM3_0079"
FT   CDS             103116..104150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYB"
FT                   /locus_tag="SpyM3_0079"
FT                   /product="putative ABC transporter subunit ComYB"
FT                   /note="best non-GAS blastp hit: gb|AAC45311.1| (U81957)
FT                   putative ABC transporter subunit ComYB [Streptococcus
FT                   gordonii]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78686"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8V9"
FT                   /protein_id="AAM78686.1"
FT                   /translation="MISFLRQDISIPSKLSLKKLSSKHQHKFIQLLANLLSTGFSFAEV
FT                   IAFLKRSQLLQLDYVLKMEESLLKGQGLADMLSGLGFSDAILTQISLADRHGNIETTLV
FT                   AIQHYLNQMARIRRKTVEVITYPLILLLFLFVMMLGLRRYLVPQLETQNQITYFLNHFP
FT                   AFFIGFCSGLILLFGMVWLRWRSQSRLKLYSRLSRYPFLGKLLKQYLTSYYAREWGTLI
FT                   GQGLDLMTILDIMAIEKSSLMKELAEDIRMSLLEGQAFHIKVATYPFFKKELSLMIEYG
FT                   EIKSKLGAELEIYAQESWEQFFSQLYQVTQLIQPAIFLVVAVTIVMIYAAILLPIYQNM
FT                   GGIF"
FT   gene            104152..104478
FT                   /gene="comYC"
FT                   /locus_tag="SpyM3_0080"
FT   CDS             104152..104478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYC"
FT                   /locus_tag="SpyM3_0080"
FT                   /product="putative competence protein"
FT                   /note="best non-GAS blastp hit: gb|AAC45312.1| (U81957)
FT                   ComYC [Streptococcus gordonii]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78687"
FT                   /db_xref="GOA:Q7CFJ9"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFJ9"
FT                   /protein_id="AAM78687.1"
FT                   /translation="MINQWNNLRHKKLKGFTLLEMLLVILVISVLMLLFVPNLSKQKDR
FT                   VTETGNAAVVKLVENQAELYELSQGSKPSLSQLKADGSITEKQEKAYQDYYDKHKNEKA
FT                   RLSN"
FT   gene            104438..104881
FT                   /locus_tag="SpyM3_0081"
FT   CDS             104438..104881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0081"
FT                   /product="putative competence protein"
FT                   /note="best non-GAS blastp hit: gb|AAL00663.1| (AE008550)
FT                   Competence protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78688"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8V8"
FT                   /protein_id="AAM78688.1"
FT                   /translation="MTNIKMKKPVLAIKAFTLLETLLSLSVMSFIILGLSVPVTKSYQK
FT                   VEEHLFFSHFEHLYRHQQKLAILQQKQRVLDISSTKIVTEGNSLTVPKSITVNHPYRLV
FT                   IDQMGGNHSLAKIIFDMTDRRFKYQFYLGSGNYQKTSQSLHSP"
FT   gene            104838..105122
FT                   /locus_tag="SpyM3_0082"
FT   CDS             104838..105122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK06217.1|AE006440_3
FT                   (AE006440) hypothetical protein [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78689"
FT                   /db_xref="InterPro:IPR021749"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8V7"
FT                   /protein_id="AAM78689.1"
FT                   /translation="MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYR
FT                   KQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRYISIHDDEGEVMKIE"
FT   gene            105115..105549
FT                   /gene="comYD"
FT                   /locus_tag="SpyM3_0083"
FT   CDS             105115..105549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYD"
FT                   /locus_tag="SpyM3_0083"
FT                   /product="putative competence protein"
FT                   /note="best non-GAS blastp hit: emb|CAA75315.1| (Y15043)
FT                   homology to ComYD from Streptcoccus gordonii, and ComGD
FT                   from Bacillus subtilis [Lactococcus lactis subsp.
FT                   cremoris]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78690"
FT                   /db_xref="InterPro:IPR016977"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8V6"
FT                   /protein_id="AAM78690.1"
FT                   /translation="MSKQLSNIKAFTLLEALIALLVISGSLLVYQGLTQTLLKRSHYLA
FT                   RHDQDNWLLFSHQLREELSGARFYKVADNKLYVEKGKKVLAFGQFKSHDFRKSASNGKG
FT                   YQPMLFGISRSHIHIEQSQICITLKWKSGLERTFYYAFQD"
FT   gene            105533..105859
FT                   /locus_tag="SpyM3_0084"
FT   CDS             105533..105859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0084"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33225.1| (AE006481)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78691"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFJ8"
FT                   /protein_id="AAM78691.1"
FT                   /translation="MPFKTNLKAGILLYAMFMASIFLLVLQVYLSQVTALHKEYQAQTD
FT                   YVKARLIAEIVYQDHRYKASNPVFFKGGQVICRERKERWMLIVKLDQQRQYQFEYLKPK
FT                   QYSQ"
FT   gene            105957..106910
FT                   /locus_tag="SpyM3_0085"
FT   CDS             105957..106910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK06112.1|AE006431_4
FT                   (AE006431) hypothetical protein [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78692"
FT                   /db_xref="InterPro:IPR016843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8V5"
FT                   /protein_id="AAM78692.1"
FT                   /translation="MTFEKIEEAYQLLLENCQLIENDLKTHIYDAIVEQNSFYLGAEGA
FT                   SPQVAQNSDKLKALCLTKEEWRKAYQFLFIKAAQTEQLQANHQFTPDAIGFILLYLLEQ
FT                   LSDKDSLEVLEIGSGTGNLAQTLLNNTSKSLDYVGIELDDLLIDLSASIAEIMDSSAHF
FT                   IQEDAVRPQLLKESDIVISDLPVGYYPNDDIAKRYKVASSDKHTYAHHLLMEQSLKYLK
FT                   KDGFAIFLAPVNLLTSPQSQLLKQWLKDYAQVVALIMLPDSIFGHPSNAKSIIVLQKQI
FT                   DHPMETFVYPIRDLKLAENIHDFMENFKKWKLSNVN"
FT   gene            106969..108165
FT                   /gene="ackA"
FT                   /locus_tag="SpyM3_0086"
FT   CDS             106969..108165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="SpyM3_0086"
FT                   /product="acetate kinase"
FT                   /note="best blastp hit: gb|AAK33227.1| (AE006481) acetate
FT                   kinase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78693"
FT                   /db_xref="GOA:P0CZ46"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CZ46"
FT                   /protein_id="AAM78693.1"
FT                   /translation="MSKTIAINAGSSSLKWQLYQMPEEAVLAQGIIERIGLKDSISTVK
FT                   YDGKKEEQILDIHDHTEAVKILLNDLIHFGIIAAYDEITGVGHRVVAGGELFKESVVVN
FT                   DKVLEQIEELSVLAPLHNPGAAAGIRAFRDILPDITSVCVFDTSFHTSMAKHTYLYPIP
FT                   QKYYTDYKVRKYGAHGTSHKYVAQEAAKMLGRPLEELKLITAHIGNGVSITANYHGKSV
FT                   DTSMGFTPLAGPMMGTRSGDIDPAIIPYLIEQDPELKDAADVVNMLNKKSGLSGVSGIS
FT                   SDMRDIEAGLQEDNPDAVLAYNIFIDRIKKCIGQYFAVLNGADALVFTAGMGENAPLMR
FT                   QDVIGGLTWFGMDIDPEKNVFGYRGDISTPESKVKVLVISTDEELCIARDVERLKNTK"
FT   gene            108351..108659
FT                   /locus_tag="SpyM3_0087"
FT   CDS             108351..108659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0087"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33228.1| (AE006481)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78694"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8V4"
FT                   /protein_id="AAM78694.1"
FT                   /translation="MYVFIEPNDLKDYLITVYDERNRAIRKQTQVYCFYLMIVLFVALF
FT                   FFFPCLILRDLVSYKLPLIFAYLYLIIRSLVAKKMEALGKITTNSQKPPFDTSQVLC"
FT   gene            complement(108742..109512)
FT                   /gene="proC"
FT                   /locus_tag="SpyM3_0088"
FT   CDS             complement(108742..109512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="SpyM3_0088"
FT                   /product="putative pyrroline carboxylate reductase"
FT                   /note="best blastp hit: gb|AAK33229.1| (AE006481) putative
FT                   pyrroline carboxylate reductase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78695"
FT                   /db_xref="GOA:Q8K8V3"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8V3"
FT                   /protein_id="AAM78695.1"
FT                   /translation="MKIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLTL
FT                   PYAMSHQDLIDQVDLVILGIKPQLFETVLKSLHFKQPIISMAAGISLQRLATFVGQDLP
FT                   LLRIMPNMNAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISEKDFDTFTALAG
FT                   SSPAYIYLFIEALAKAGVKNGMPKAKALEIVTQTVLASASNLKTSSQSPHDFIDAICSP
FT                   GGTTIAGLMELERLGLTTTVSSAIDKTIDKAKSL"
FT   gene            complement(109560..110627)
FT                   /gene="pepA"
FT                   /locus_tag="SpyM3_0089"
FT   CDS             complement(109560..110627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="SpyM3_0089"
FT                   /product="putative glutamyl-aminopeptidase"
FT                   /note="best blastp hit: gb|AAK33230.1| (AE006481) putative
FT                   glutamyl-aminopeptidase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78696"
FT                   /db_xref="GOA:Q8K8V2"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017538"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8V2"
FT                   /protein_id="AAM78696.1"
FT                   /translation="MTDLFSKIKEVTELDGIAGYEHSVRDYLRTKITPLVDRVETDGLG
FT                   GIFGIRDSKAEKAPRILVAAHMDEVGFMVSDIKVDGTLRVVGIGGWNPLVVSSQRFTLY
FT                   TRTGQVIPLISGSVPPHFLRGANGSASLPHIEDIVFDGGFTDKAEAERFGITPGDIIVP
FT                   QSETILTANQKNIISKAWDNRYGVLMITEMLEALKGQDLNNTLIAGANVQEEVGLRGAH
FT                   VSTTKFDPELFFAVDCSPAGDIYGNPGTIGDGTLLRFYDPGHVMLKDMRDFLLTTAEDA
FT                   GVNFQYYCGKGGTDAGAAHLQNGGVPSTTIGVCARYIHSHQTLYAMDDFVEAQAFLQAI
FT                   IKKLDRSTVDLIKCY"
FT   gene            111092..111376
FT                   /locus_tag="SpyM3_0090"
FT   CDS             111092..111376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0090"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33232.1| (AE006481)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78697"
FT                   /db_xref="InterPro:IPR028105"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFJ7"
FT                   /protein_id="AAM78697.1"
FT                   /translation="MSKKKIGMISGIFGFSLAIGLGIVIKDYCQDRQRRQMTRDLRTFF
FT                   SPLGQIEVLYINPCQVKQDYISGGVVMSNGKQYQFTYHSRQISFEEDKG"
FT   gene            111373..111690
FT                   /gene="trx.1"
FT                   /locus_tag="SpyM3_0091"
FT   CDS             111373..111690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx.1"
FT                   /locus_tag="SpyM3_0091"
FT                   /product="putative thioredoxin"
FT                   /note="best blastp hit: gb|AAK75980.1| (AE007482)
FT                   thioredoxin, putative [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78698"
FT                   /db_xref="GOA:Q8K8V1"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8V1"
FT                   /protein_id="AAM78698.1"
FT                   /translation="MIRPTSYESLAALIEKEDKLVLFFTADWCPDCQFIYPIMPEIEAE
FT                   LTDMTFVCVNRDQFIEVAQKWNIFGIPSFVVIEKGQEVGRLVNKMRKTKTEIMHFLAAY
FT                   Q"
FT   gene            111708..112334
FT                   /locus_tag="SpyM3_0092"
FT   CDS             111708..112334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp hit: gb|AAK75979.1| (AE007482) conserved
FT                   hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4],similar to phenylalanyl-tRNA synthetase (beta
FT                   subunit)[Listeria monocytogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78699"
FT                   /db_xref="GOA:F7IVD5"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027855"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVD5"
FT                   /protein_id="AAM78699.1"
FT                   /translation="MIFAYNKEQVGDVLMVILQDTKDIKRQVERKGKVARVFAEESGKT
FT                   LAWNIFEASSLITIEGNGQIFLTDEDLARLNAELAKEGFSERLEPIVGPVFVVGQIVEM
FT                   VAHPDSDHLNICQVAIGEDQTVQIVAGAPNAALGLKTIVALPGAIMPNGSLIFPGKLRG
FT                   EESYGMMCSPRELALPNAPQKRGIIELDESAVVGEAFDPAKHWKG"
FT   gene            112486..112881
FT                   /gene="ssb.1"
FT                   /locus_tag="SpyM3_0093"
FT   CDS             112486..112881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb.1"
FT                   /locus_tag="SpyM3_0093"
FT                   /product="single-stranded DNA-binding protein,
FT                   phage-associated"
FT                   /note="best blastp hit: gb|AAL00527.1| (AE008538)
FT                   Single-stranded DNA-binding protein [Streptococcus
FT                   pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78700"
FT                   /db_xref="GOA:Q8K8V0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8V0"
FT                   /protein_id="AAM78700.1"
FT                   /translation="MYNKVIAIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGERE
FT                   ADFISVVVWGKLAETLVSYASKGSLMSIDGELRTRKYDKDGQVHYVTEVLCQSFQLLES
FT                   RAQRAMRENNVTNDLVDLVLEEDTLPF"
FT   gene            complement(113141..113782)
FT                   /locus_tag="SpyM3_0094"
FT   CDS             complement(113141..113782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0094"
FT                   /product="putative deoxyguanosine kinase/deoxyadenosine
FT                   kinase(I)subunit"
FT                   /note="best blastp hit: gb|AAK33233.1| (AE006482) putative
FT                   deoxyguanosine kinase/deoxyadenosine kinase(I)subunit
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78701"
FT                   /db_xref="GOA:F7IVQ2"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVQ2"
FT                   /protein_id="AAM78701.1"
FT                   /translation="MLIVLAGTIGAGKSSLAAALGEHLGTDVFYEAVDNNPVLDLYYQD
FT                   PKKYAFLLQIYFLNKRFKSIKEAYQADNNILDRSIFEDELFLKLNYKNGNVTKTELDIY
FT                   QELLANMLEELEGMPKKRPDLLIYIDVSFDKMLERIEKRGRSFEQVDGNPSLEQYYHQV
FT                   HGEYPTWYEDYKVSPKMKIDGNSLDFVQNPQDLATVLKMIDTKLKELHLL"
FT   gene            complement(113802..114779)
FT                   /locus_tag="SpyM3_0095"
FT   CDS             complement(113802..114779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0095"
FT                   /product="putative transcriptional regulator"
FT                   /note="best non-GAS blastp hit: gb|AAK76240.1| (AE007507)
FT                   TIM-barrel protein, putative, NifR3 family [Streptococcus
FT                   pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78702"
FT                   /db_xref="GOA:Q7CFJ4"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFJ4"
FT                   /protein_id="AAM78702.1"
FT                   /translation="MIKLNSSFRIGDVEIPHRTVLAPMAGVTNSAFRTIAKEFGAGLVV
FT                   MEMISEKGLLYNNEKTLHMLHIDENEHPMSIQLFGGDAEGLKRAADFIQTNTKADIVDI
FT                   NMGCPVNKVVKNEAGAKWLRDPDKIYHIVKEVTSVLDIPLTVKMRTGWADSSLAVENAL
FT                   AAESAGVSALAMHGRTREQMYTGTCDHETLARVSKAITKIPFIGNGDVRSVQDAKFMIE
FT                   EIGVDAVMIGRAAMNNPYLFTQINHFFETGQELPDLPFAKKLDIAKDHLKRLINLKGET
FT                   IAVREFRGLAPHYLRGTAGAAKVRGAVSRAETLAEVEAIFETVR"
FT   gene            complement(114766..115638)
FT                   /locus_tag="SpyM3_0096"
FT   CDS             complement(114766..115638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0096"
FT                   /product="putative heat shock protein"
FT                   /note="best blastp hit: gb|AAK33235.1| (AE006482) putative
FT                   heat shock protein HSP33 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78703"
FT                   /db_xref="GOA:P0DB68"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DB68"
FT                   /protein_id="AAM78703.1"
FT                   /translation="MDKIIKSIAQSGAFRAYVLDSTETVALAQEKHNTLSSSTVALGRT
FT                   LIANQILAANQKGDSKITVKVIGDSSFGHIISVADTKGHVKGYIQNTGVDIKKTATGEV
FT                   LVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDFAYYLTESEQTPSAIGLNVLLD
FT                   ENDKVKVAGGFMVQVLPGASEEEIARYEKRLQEMPAISHLLASKNHVEALLEAIYGDEP
FT                   YKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGAEIVCQFCGTKYQFNESD
FT                   LEALINDKA"
FT   gene            complement(115764..117299)
FT                   /gene="nra"
FT                   /locus_tag="SpyM3_0097"
FT   CDS             complement(115764..117299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nra"
FT                   /locus_tag="SpyM3_0097"
FT                   /product="negative transcriptional regulator"
FT                   /note="best blastp hit: gb|AAC97147.1| (U49397) Nra
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78704"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8U8"
FT                   /protein_id="AAM78704.1"
FT                   /translation="MPYVKKKKDSFLVETYLEQSIRDKSELVLLLFKSPTIIFSHVAKQ
FT                   TGLTAVQLKYYCKELDDFFGNNLDITIKKGKIICCFVKPVKEFYLHQLYDTSTILKLLV
FT                   FFIKNGTSSQPLIKFSKKYFLSSSSAYRLRESLIKLLREFGLRVSKNTIVGEEYRIRYL
FT                   IAMLYSKFGIVIYPLDHLDNQIIYRFLSQSATNLRTSPWLEEPFSFYNMLLALSWKRHQ
FT                   FAVSIPQTRIFRQLKKLFIYDCLTRSSRQVIENAFSLTFSQGDLEYLFLIYITTNNSFA
FT                   SLQWTPQHIETCCHIFEKNDTFRLLLEPILKRLPQLNHSKQDLIKALMYFSKSFLFNLQ
FT                   HFVIEIPSFSLPTYTGNSNLYKALKNIVNQWLAQLPGKRHLNEKHLQLFCSHIEQILKN
FT                   KQPALTVVLISSNFINAKLLTDTIPRYFSDKGIHFYSFYLLRDDIYQIPSLKPDLVITH
FT                   SRLIPFVKNDLVKGVTVAEFSFDNPDYSIASIQNLIYQLKDKKYQDFLNEQLQ"
FT   gene            117729..119963
FT                   /gene="cbp"
FT                   /locus_tag="SpyM3_0098"
FT   CDS             117729..119963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbp"
FT                   /locus_tag="SpyM3_0098"
FT                   /product="putative collagen binding protein"
FT                   /note="best blastp hit: gb|AAC97148.1| (U49397) Cpa
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78705"
FT                   /db_xref="GOA:Q8K8U7"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8U7"
FT                   /protein_id="AAM78705.1"
FT                   /translation="MQKRDKTNYGSANNKRRQTTIGLLKVFLTFVALIGIVGFSIRAFG
FT                   AEEQSVPNKQSSVQDYPWYGYDSYSKGYPDYSPLKTYHNLKVNLDGSKEYQAYCFNLTK
FT                   HFPSKSDSVRSQWYKKLEGTNENFIKLADKPRIEDGQLQQNILRILYNGYPNDRNGIMK
FT                   GIDPLNAILVTQNAIWYYTDSSYISDTSKAFQQEETDLKLDSQQLQLMRNALKRLINPK
FT                   EVESLPNQVPANYQLSIFQSSDKTFQNLLSAEYVPDTPPKPGEEPPAKTEKTSVIIRKY
FT                   AEGDYSKLLEGATLKLAQIEGSGFQEKIFDSNKSGEKVELPNGTYVLSELKPPQGYGVA
FT                   TPITFKVAAEKVLIKNKEGQFVENQNKEIAEPYSVTAFNDFEEIGYLSDFNNYGKFYYA
FT                   KNTNGTNQVVYCFNADLHSPPDSYDHGANIDPDVSESKEIKYTHVSGYDLYKYAATPRD
FT                   KDADFFLKHIKKILDKGYKKKGDTYKTLTEAQFRAATQLAIYYYTDSADLTTLKTYNDN
FT                   KGYHGFDKLDDATLAVVHELITYAEDVTLPMTQNLDFFVPNSSRYQALIGTQYHPNELI
FT                   DVISMEDKQAPIIPITHKLTISKTVTGTIADKKKEFNFEIHLKSSDGQAISGTYPTNSG
FT                   ELTVTDGKATFTLKDGESLIVEGLPSGYSYEITETGASDYEVSVNGKNAPDGKATKASV
FT                   KEDETVAFENRKDLVPPTGLTTDGAIYLWLLLLVPFGLLVWLFGRKGTKK"
FT   gene            119960..120481
FT                   /locus_tag="SpyM3_0099"
FT   CDS             119960..120481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0099"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAL86407.1|AF447492_4 (AF447492)
FT                   LepA [Streptococcus pyogenes]; similar to amino acids 1-173
FT                   of LepA signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78706"
FT                   /db_xref="GOA:Q8K8U6"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8U6"
FT                   /protein_id="AAM78706.1"
FT                   /translation="MTNYLNRLNENPLLKAFIRLVLKISIIGFLGYILFQYVFGVMIVN
FT                   TNQMSPAVSAGDGVLYYRLTDRYHINDVVVYEVDDTLKVGRIAAQAGDEVNFTQEGGLL
FT                   INGHPPEKEVPYLTYPHSSGPNFPYKVPTGTYFILNDYREERLDSRYYGALPINQIKGK
FT                   ISTLLRVRGI"
FT   gene            120502..121536
FT                   /locus_tag="SpyM3_0100"
FT   CDS             120502..121536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp hits: gb|AAC97152.1| (U49397) unknown
FT                   [Streptococcus pyogenes], and gb|AAL86408.1|AF447492_5
FT                   (AF447492) EftLSL.A [Streptococcus pyogenes]; possible T3
FT                   antigen has similarity with T6 antigen gb|AAL11467.1|
FT                   (AY049087) T6 antigen [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78707"
FT                   /db_xref="InterPro:IPR017503"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8U5"
FT                   /protein_id="AAM78707.1"
FT                   /translation="MKKNKLLLATAILATALGTASLNQNVKAETAGVSENAKLIVKKTF
FT                   DSYTDNEVLMPKADYTFKVEADSTASGKTKDGLEIKPGIVNGLTEQIISYTNTDKPDSK
FT                   VKSTEFDFSKVVFPGIGVYRYTVSEKQGDVEGITYDTKKWTVDVYVGNKEGGGFEPKFI
FT                   VSKEQGTDVKKPVNFNNSFATTSLKVKKNVSGNTGELQKEFDFTLTLNESTNFKKDQIV
FT                   SLQKGNEKFEVKIGTPYKFKLKNGESIQLDKLPVGITYKVNEMEANKDGYKTTASLKEG
FT                   DGQSKMYQLDMEQKTDESADEIVVTNKRDTQVPTGVVGTLAPFAVLSIVAIGGVIYITK
FT                   RKKA"
FT   gene            121558..122277
FT                   /locus_tag="SpyM3_0101"
FT   CDS             121558..122277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp hit: gb|AAL86409.1|AF447492_6 (AF447492)
FT                   EftLSL.B [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78708"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR015986"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8U4"
FT                   /protein_id="AAM78708.1"
FT                   /translation="MTIVQVINKAIDTLILIFCLVVLFLAGFGLWDSYHLYQQADASNF
FT                   KKFKTAQQQPKFEDLLALNEDVIGWLNIPGTHIDYPLVQGKTNLEYINKAVDGSVAMSG
FT                   SLFLDTRNHNDFTDDYSLIYGHHMAGNAMFGEIPKFLKKDFFSKHNKAIIETKERKKLT
FT                   VTIFACLKTDAFNQLVFNPNAITNQDQQRQLVDYISKRSKQFKPVKLKHHTKFVAFSTC
FT                   ENFSTDNRVIVVGTIQE"
FT   gene            122330..122881
FT                   /locus_tag="SpyM3_0102"
FT   CDS             122330..122881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0102"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAL86410.1|AF447492_7 (AF447492)
FT                   unknown [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78709"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8U3"
FT                   /protein_id="AAM78709.1"
FT                   /translation="MILTMLAFNQTVLAKDSTVQTSISVENVLERAGDSTPFSIALESI
FT                   DAMKTIEEITIAGSGKASFSPLTFTTVGQYTYRVYQKPSQNKDYQADTTVFDVLVYVTY
FT                   DEDGTLVAKVISRRAGDEEKSAITFKPKWLVKPIPPRQPNIPKTPLPLAGEVKSLLGIL
FT                   SIVLLGLLVLLYVKKLKSRL"
FT   gene            complement(123041..124246)
FT                   /locus_tag="SpyM3_0103"
FT   CDS             complement(123041..124246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0103"
FT                   /product="putative multiple sugar metabolism regulator"
FT                   /note="best blastp hit: gb|AAL86411.1|AF447492_8 (AF447492)
FT                   MsmRL [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78710"
FT                   /db_xref="GOA:Q8K8U2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR024022"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8U2"
FT                   /protein_id="AAM78710.1"
FT                   /translation="MVRFDLKHVQTLHSLSQLPISVMSQDKALIQVYGNDDYLLCYYQF
FT                   LKHLAIPQAAQDVIFYEGLFEESFMIFPLCHYIIAIGPFYPYSLNKDYQEQLANNCLKH
FT                   SSHRSKEELLSYMALVPHFPINNVRNLLIAIDAFFDTQFETTCQQTIHQLLQHSKQMTA
FT                   DPDIIHRLKHISKASSQLPPVLEHLNHIMDLVKLGNPQLLKQEINRIPLSSITSSSISA
FT                   LRAEKNLTVIYLTRLLEFSFVENTDVAKHYSLVKYYMALNEEASDLLKVLRIRCAAIIH
FT                   FSESLTNKSISDKRQMYNSVLHYVDSHLYSKLKVSDIAKRLYVSESHLRSVFKKYSNVS
FT                   LQHYILSTKIKEAQLLLKRGIPVGEVAKSLYFYDTTHFHKIFKKYTGISSKDYLAKYRD
FT                   NI"
FT   gene            124970..126940
FT                   /locus_tag="SpyM3_0104"
FT   CDS             124970..126940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0104"
FT                   /product="protein F2 like fibronectin-binding protein"
FT                   /note="best blastp hit: gb|AAL11472.1| (AY049089)
FT                   fibronectin binding protein [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78711"
FT                   /db_xref="InterPro:IPR004237"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR008970"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8U1"
FT                   /protein_id="AAM78711.1"
FT                   /translation="MSSSDEETLKQYASKYTSNRRGDTSGNLKKQIAKVLTEGYPTNKS
FT                   DWLNGLTENEKIEVTQDAIWYFTETTVPADRSYTNRNVNSQKMKEVYQKLIDTTDIDKY
FT                   EDVQFDLFVPQDTNLQAVISVEPVIESLPWTSLKPIAQKDITAKKIWVDAPKEKPIIYF
FT                   KLYRQLPGEKEVAVDDAELKQINSEGQQEISVTWTNQLVTDEKGMAYIYSVKEVDKNGE
FT                   LLEPKDYIKKEDGLTVTNTYVKPTSGHYDIEVTFGNGHIDITEDTTPDIVSGENQMKQI
FT                   EGEDSKPIDEVTENNLIEFGKNTMPGEEDGTNSNKYEEVEDSRPVDTLSGLSSEQGQSG
FT                   DMTIEEDSATHIKFSKRDIDGKELAGATMELRDSSGKTISTWISDGQVKDFYLMPGKYT
FT                   FVETAAPDGYEVATAITFTVNEQGQVTVNGKATKGDAHIVMVDAYKPTKGSGQVIDIEE
FT                   KLPDEQGHSGSTTEIEDSKSSDVIIGGQGEVVDTTEDTQSGMTGHSGSTTEIEDSKSSD
FT                   VIIGGQGEVVDTTEDTQSGMTGHSGSTTKIEDSKSSDVIVGGQGQIVETTEDTQTGMHG
FT                   DSGRKTEVEDTKLVQSFHFDNKEPESNSEIPKKDKSKSNTSLPATGEKQHNKFFWMVTS
FT                   CSLISSVFVISLKSKKRLSSC"
FT   gene            complement(127206..127823)
FT                   /locus_tag="SpyM3_0105"
FT   CDS             complement(127206..127823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0105"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33244.1| (AE006483)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78712"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8U0"
FT                   /protein_id="AAM78712.1"
FT                   /translation="MLFSSYKSVHAHDNIDEKGKVHLYWQGNYYVDNYVDYTKTLTADK
FT                   KSIEWTVTFNSAKEQWVYPDFSVFLPKGVKAPTEITYEHHYWDGTVHSEKRSNTQWHYD
FT                   WEKQQTNFNQEFDKFPGYTGWSPSLDKFYKLKNDGKFSHVLVDTYGRQSHTYFSHKMVW
FT                   KFKTELEEGYKDKWNKLPFIAGIKQNNPLAASFPSYKGEFGE"
FT   gene            128224..129630
FT                   /gene="atoE"
FT                   /locus_tag="SpyM3_0106"
FT   CDS             128224..129630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoE"
FT                   /locus_tag="SpyM3_0106"
FT                   /product="putative short-chain fatty acids transporter"
FT                   /note="best blastp hit: gb|AAK33245.1| (AE006483) putative
FT                   short-chain fatty acids transporter [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78713"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8T9"
FT                   /protein_id="AAM78713.1"
FT                   /translation="MNNIKTKKRFMDRYIDGFMKWMPESLFICFILTFLVVTMSVLMTD
FT                   SPFIGTEKTGGIIYGWVNGFWGLLSFAMQMTILLATGNAVASSPPAHKMFKSLAKLPQT
FT                   RTQIFIFSIVVGSIFGFLHWGLGMMVAIVFGKELLVQARQKGIKVHTPLFVATLFFTFL
FT                   PATSGLSGAAVLYSATPDYLRNSVADAYKQVVPESVPLTESVLNLPFISLLVVCMLVPL
FT                   CFALLAHPKDETKIMELDDEIYHHSLDTASHVVIARNTPAEKMNASRLVMYLVGGAIVS
FT                   YSLYHFSVVGLSGLDLNSFNFLFLGLGLLLCGQQGPEYYGSLFKDGVMSSWGLVLQFPF
FT                   YAGIFGIIQSTGLGLEISHFFVAISNGTTWPVFAYLYSALLNIAVPSGGSKFVIEAPYI
FT                   VPATIEVGNDLGKILQAYQLGDATTNLIVPFWALSYLSNFKLKFNQIVAYTIPCVLVVT
FT                   GIAIIYLFVF"
FT   gene            complement(129700..130611)
FT                   /locus_tag="SpyM3_0107"
FT   CDS             complement(129700..130611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0107"
FT                   /product="putative transcriptional regulator"
FT                   /note="best blastp hit: gb|AAK34404.1| (AE006595) putative
FT                   transcriptional regulator (LysR family) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78714"
FT                   /db_xref="GOA:Q8K8T8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8T8"
FT                   /protein_id="AAM78714.1"
FT                   /translation="MNISSLAYFIEIVNCDFNLTKAAQKSHISQPALSSYIKTIEKEEG
FT                   VVLFQRQKGRLVGLTSVGERFFENAKVVIASHEQLMADLRSESKKYKGEISIGIPQLIS
FT                   GIVFSELIPKLIEENPEVKFHIVETGAYELQKKLFLKEVDFAILLTPTTLDATIADIDI
FT                   LLRDQLCLYMSHKTFQETFDSNPNISIKALHRQNLVTFDKTFMINHQLTTLFEEANSLP
FT                   VVKCYSASWDFLLNCTRYSSYLTILPRPITHFAHMDGLVEVQLTEHPKWEVVLASLKHN
FT                   KTSHLKHYIKHTILDYFMNQRF"
FT   gene            130732..131916
FT                   /locus_tag="SpyM3_0108"
FT   CDS             130732..131916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0108"
FT                   /product="putative acetyl-CoA acetyltransferase"
FT                   /note="best blastp hit: gb|AAK33246.1| (AE006483) putative
FT                   acetyl-CoA acetyltransferase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78715"
FT                   /db_xref="GOA:Q8K8T7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8T7"
FT                   /protein_id="AAM78715.1"
FT                   /translation="MTKEVVITSAYRTPIGNFGGVFKSLSAVDLGVTVVTKILADTGLK
FT                   SDAIDEVIFGNVLHAGLGQNVARQVALNAGLSYDTPAFTIDMVCGSGLKAVELGAQKIQ
FT                   TGNADIVLVGGTENMSQAPYVLQGQRWGSRMGDSKVVDTMLKDGLSDAFAGYHMGITAE
FT                   NIVQQYGLTREEQDAFAADSQRKAQLAIEKGRFKEEIAPVTIPQRKGEPLLVDQDEYPK
FT                   FGTTVDKLAKLRSAFIKDEGTVTAGNASGINDGAAAILLMSKEKAEELGLPILAKITSY
FT                   ASAGVDPSIMGCGPIPATKKALAKAQLTIDDIDLIEANEAFAAQALAVSRDLGFDNEKV
FT                   NVNGGAIALGHPIGASGARILVTLLAEMAKRDVRHGLATLCIGGGQGQSIIVTR"
FT   gene            131928..132587
FT                   /gene="atoD.2"
FT                   /locus_tag="SpyM3_0109"
FT   CDS             131928..132587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoD.2"
FT                   /locus_tag="SpyM3_0109"
FT                   /product="putative acetyl-CoA:acetoacetyl-CoA transferase
FT                   alpha subunit"
FT                   /note="best blastp hit: gb|AAK33247.1| (AE006483) putative
FT                   acetyl-CoA:acetoacetyl-CoA transferase alpha subunit
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78716"
FT                   /db_xref="GOA:Q8K8T6"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8T6"
FT                   /protein_id="AAM78716.1"
FT                   /translation="MKENKRIAIAEAISHIKDGDTIMVGGFMANGTPEALIDALVDKGT
FT                   KDLTLICNDAGFVDRGVGKMVANHQFKTIYATHIGLNKEAGRQMTAGETTIELIPQGTF
FT                   AEKIRIGAYGIGGFYTPTGVGTLVAEGKETKTIKGKTYLLEYPFEADVALIFANKADEM
FT                   GNLQYSGSENNFNQLMAACAKTTIVQAREIVPVGTIQPECVHTPHIFVDYIVKEGV"
FT   gene            132590..133237
FT                   /locus_tag="SpyM3_0110"
FT   CDS             132590..133237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0110"
FT                   /product="butyrate-acetoacetate CoA-transferase, beta
FT                   subunit"
FT                   /note="best blastp hit:gb|AAK33248.1| (AE006483)
FT                   butyrate-acetoacetate CoA-transferase, beta subunit
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78717"
FT                   /db_xref="GOA:Q8K8T5"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8T5"
FT                   /protein_id="AAM78717.1"
FT                   /translation="MAVALSKEEIQNRIAKRVAKELEDGTLVNLGIGLPTKVANFVPEE
FT                   MTVYFQSENGFIGLGSKSDDPNSTIVNAGGQPVTVYPGAAFFNSADSFGIIRGGHVDLT
FT                   VLGALEIAENGDIANYLIPGKMVPGMGGAMDLLVGAKKVIVAMEHTNKGKHKLLKECTL
FT                   PLTAKGVVDLIITEMGVFKVTPDGIQVIEISEGFTFDEVQAATGVPLSIAEG"
FT   gene            complement(133359..134039)
FT                   /locus_tag="SpyM3_0111"
FT   CDS             complement(133359..134039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: emb|CAB73814.1| (AL139078)
FT                   helix-turn-helix containing protein [Campylobacter jejuni]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78718"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFJ3"
FT                   /protein_id="AAM78718.1"
FT                   /translation="MDKETLNYWKTVITFLHDVLGDNYEIILHVIDKNDIYIGELVNSH
FT                   ISGRSKQSPLTTFALDLITNKVYKEKDFVTNYKAIVSPQHKEVRGSTFFIKDKKGNLEG
FT                   MLCINLDISAYQGVARDLLKLVNLNLEHFIPTAKEPKTVTPQPEEAVEILTSNIQDIIG
FT                   QIIDPSLLRHNVHLSQDVKIDIVAKLYEKGVFQLKGAVSKVADILCISEPSVYRYLKKI
FT                   EADQ"
FT   gene            134213..134578
FT                   /locus_tag="SpyM3_0112"
FT   CDS             134213..134578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33250.1| (AE006484) conserved
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78719"
FT                   /db_xref="GOA:Q7CFJ2"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFJ2"
FT                   /protein_id="AAM78719.1"
FT                   /translation="MKSYPEPMGPYSTYTIEGHFLYTAGQLPLNPVTGQLSDGFEAQCR
FT                   QVFVNLQSILAEQKLDLNHIYKLNVYLTDVTNVEILNHVMTDLFEEPYPVRTAVQVSAL
FT                   PLQALIEVEAVARVKQL"
FT   gene            134615..135634
FT                   /locus_tag="SpyM3_0113"
FT   CDS             134615..135634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0113"
FT                   /product="putative regulatory protein"
FT                   /note="best blastp hit: gb|AAK33251.1| (AE006484) putative
FT                   regulatory protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78720"
FT                   /db_xref="GOA:Q7CFJ1"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFJ1"
FT                   /protein_id="AAM78720.1"
FT                   /translation="MDIIIGTSLLILVLAIFSLFNYKAPHGAKAMGALASAACASFLVE
FT                   AFQDSFFGKVLGFQFLSEVGGANGSLSGVAAAILVAIAIGVSPGYAVLIGLSVSGTGII
FT                   PGFVAGYVVSFLIKWMEKNIPGGLDLISIIIVGAPLTRFLAQLITPVINSTLLTIGDIL
FT                   TSSANSNPIIMGMILGGTIVVVATAPLSSMALTAMLGLTGIPMAIGALSVFGSSFMNGV
FT                   LFYRLKLGERKDNIAFAIEPLTQADVTSANPIPIYVTNFVGGAACGVLIALMKLVNDTP
FT                   GTATPIAGFAVMFAYNPVAKVLITALGCIIISLIVGYIGGSVFKNYRLVTKQELQARN"
FT   gene            136088..136408
FT                   /locus_tag="SpyM3_0114"
FT   CDS             136088..136408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0114"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33252.1| (AE006484)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78721"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFJ0"
FT                   /protein_id="AAM78721.1"
FT                   /translation="MNTLLSLMNSIEQEARTIYDSYDAKKKALADKKEEELKQLFLEYE
FT                   QETQLLLEAKREVFFEANRQEQKASKKRLATQQLALHAILEEHKLTVVRELVDKVVETY
FT                   GH"
FT   gene            136398..138398
FT                   /gene="ntpI"
FT                   /locus_tag="SpyM3_0115"
FT   CDS             136398..138398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpI"
FT                   /locus_tag="SpyM3_0115"
FT                   /product="V-type Na+-ATPase subunit I"
FT                   /note="best blastp hit: gb|AAK33253.1| (AE006484) V-type
FT                   Na+ -ATPase subunit I [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78722"
FT                   /db_xref="GOA:Q7CFI9"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFI9"
FT                   /protein_id="AAM78722.1"
FT                   /translation="MAISQMKKLAMVFEKDYLDLVLKTLQQSQLVEVRDMKQLKHWQDA
FT                   FNKGNVKLPQIVQYDLTHQKPLLDDEALQYLLQSQQELENGLASLSAFLPPIGKLTALR
FT                   QKTPSLSFKQFEERHRQQAAQTALKMMSQKIERLEQLQSKIDQLTEYCQELEKWRSLTV
FT                   LPQDLAQFHFLSARVGTIPSTANNHFYHQLKQHKGLFIEEVYHTEFEYGLVLFWQAQDT
FT                   IHLQKYQFKPLLYKEQLLPSEQLRINKELLTNWLAEKDSLLKELRQSQKILAQLQVEID
FT                   YVLSQYQRQQTKKQLLGTRHLIALEGWIEADSVNQLKGLMTKTLGDMFYLDSYDVTPDD
FT                   WEDVPIKLRNHRYIAPFELVTEMYALPKYQEKDPTPFLAPLYLTFFGMMVADLGYGLLL
FT                   YAVTLAALVFFNLQKTSKRLVTFFNILAISVAIWGLIYGSFFGFDLPVALLSTKTDVIT
FT                   ILVVSLLFGFVTLIFGLLLGAWQQVRMKAYATAYTSSLAWTFILLGLLLFILGKNVSGL
FT                   AYLSVIGKWLALGNAFGILVVSLLKSKSLLGLGSGLYNLYGISSYLSDLVSFTRLMALG
FT                   LSGASIGAAFNMIVGIFPPVTRFTVGIFIFILLHAINIFLSMLSGYVHGARLIFVEFFG
FT                   KFYEGGGKAFNPLKLADNYVNVNEETDLEDN"
FT   gene            138400..138879
FT                   /gene="ntpK"
FT                   /locus_tag="SpyM3_0116"
FT   CDS             138400..138879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpK"
FT                   /locus_tag="SpyM3_0116"
FT                   /product="V-type Na+-ATPase subunit K"
FT                   /note="best blastp hit: gb|AAK33254.1| (AE006484) V-type
FT                   Na+ -ATPase subunit K [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78723"
FT                   /db_xref="GOA:Q7CFI8"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFI8"
FT                   /protein_id="AAM78723.1"
FT                   /translation="MEHLAHYFTAHGGVFFAALGIVLAVALSGMGSAYGVGKGGQAAAA
FT                   LLKEEPEKFTSALILQLLPGSQGIYGFAIGILIWMKLTPELSVNQGLAYFLVSLPIAIV
FT                   GYFSAKHQGNVSVAGMQILAKRPKDFMKGVILAAMVETYAILAFVVSFILLNKIG"
FT   gene            138948..139532
FT                   /gene="ntpE"
FT                   /locus_tag="SpyM3_0117"
FT   CDS             138948..139532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpE"
FT                   /locus_tag="SpyM3_0117"
FT                   /product="putative V-type Na+-ATPase subunit E"
FT                   /note="best blastp hit: gb|AAK33255.1| (AE006484) putative
FT                   V-type Na+ -ATPase subunit E [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78724"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8T4"
FT                   /protein_id="AAM78724.1"
FT                   /translation="MNDITQLRQNVLEKAHQEGQQCLKIATDSLDTDFKERQQQGLHDL
FT                   KAKRQKELKALEQQFQVAQQQLKNQERQALLALKQDSIKELFEASLEKMTNFSKEEELA
FT                   FLKQVLSKYPEQPLQVTFGEKTGQKFSSYDCAELRLAFPQLSYNQELIPQEAGFLVSLD
FT                   QVDDNYLYRYLLESVVKEESSRIIDRLFSEI"
FT   gene            139548..140546
FT                   /gene="ntpC"
FT                   /locus_tag="SpyM3_0118"
FT   CDS             139548..140546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpC"
FT                   /locus_tag="SpyM3_0118"
FT                   /product="putative V-type Na+-ATPase subunit C"
FT                   /note="best blastp hit: gb|AAK33256.1| (AE006484) putative
FT                   V-type Na+ -ATPase subunit C [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78725"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8T3"
FT                   /protein_id="AAM78725.1"
FT                   /translation="MPTFLELNTTISVKEKELLTKEQFDKLLQAPNTTTLARLLHQSVY
FT                   HLTVDDLNDLDRLESILMAELTKTYRWAFAETPQPDIVQLFTLRYTYHNVKVLLKAKAS
FT                   QADLSHLLLPIGDKPLVALEYLIRTMTSDEFPKEVVTEIQSIWAEYQDYQDIRVLEIGT
FT                   DLAYFKALKQIAQRLEDPVFQQAVLIVIDLYNLITVRRAKSQNKPISFMMQLLSDEASR
FT                   PSKTFITLEDDKDLMTWFENVTPDSYMTALKPYSEKLRQGTLQTTELEYLVDECLYHLF
FT                   AKAKYQVDGPYVLARFLLAKSFEVKNLRLLAAALANDLPKERVIERMRPIA"
FT   gene            140543..140863
FT                   /gene="ntpG"
FT                   /locus_tag="SpyM3_0119"
FT   CDS             140543..140863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpG"
FT                   /locus_tag="SpyM3_0119"
FT                   /product="putative V-type Na+-ATPase subunit G"
FT                   /note="best blastp hit: gb|AAK75416.1| (AE007430) v-type
FT                   sodium ATP synthase, subunit G [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78726"
FT                   /db_xref="GOA:Q8K8T2"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8T2"
FT                   /protein_id="AAM78726.1"
FT                   /translation="MTKTLYKVGVIGNRDVILPFQMIGFQTFPVIKPQDAINQLRQLAM
FT                   EDFGIIYITEDIAAAIPEALTHYDNQVLPAVIPLPTHQGAQGIGLSRIQAMAEKAVGQN
FT                   IL"
FT   gene            141118..142839
FT                   /gene="ntpA"
FT                   /locus_tag="SpyM3_0120"
FT   CDS             141118..142839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpA"
FT                   /locus_tag="SpyM3_0120"
FT                   /product="putative V-type Na+-ATPase alpha subunit"
FT                   /note="best blastp hit: gb|AAK33257.1| (AE006484) putative
FT                   V-type Na+ -ATPase alpha subunit [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78727"
FT                   /db_xref="GOA:P0DA06"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA06"
FT                   /protein_id="AAM78727.1"
FT                   /translation="MQEANIQDICRVGHLGLVGEIIEMRRDQASIQVYEETSGIGPGEP
FT                   VVTTGCPLSVELGPGLISEMFDGIQRPLDRFQKATDSDFLIRGVAIPSLDRKAKWAFIP
FT                   KLSVGQEVVAGDILGTVQETAVIEHRIMVPYKVSGTLVAIHAGDFTVTDTVYEIKQEDG
FT                   SIYQGSLMQTWPVRQSRPVAQKLIPVEPLVTGQRVIDTFFPVTKGGAAAVPGPFGAGKT
FT                   VVQHQIAKFANVDIVIYVGCGERGNEMTDVLNEFPELIDPNTGQSIMERTVLIANTSNM
FT                   PVAAREASIYTGITIAEYFRDMGYSVAIMADSTSRWAEALREMSGRLQEMPGDEGYPAY
FT                   LGSRIAEYYERAGRVRTLGSQEREGTITAIGAVSPPGGDISEPVTQNTLRIIKVFWGLD
FT                   APLAQRRHFPAINWLTSYSLYQDDVGSYIDRKQESNWSNKVTRAMAILQREASLEEIVR
FT                   LVGLDSLSEQDRLTMAVARQIREDYLQQNAFDSVDTFTSFPKQEAMLTNILTFNEEASK
FT                   ALSLGAYFNEIMEGTAQVRDRIARSKFIPEENLEQIKGLTQKVTKEIHHVLAKGGI"
FT   gene            142840..144255
FT                   /gene="ntpB"
FT                   /locus_tag="SpyM3_0121"
FT   CDS             142840..144255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpB"
FT                   /locus_tag="SpyM3_0121"
FT                   /product="putative V-type Na+-ATPase subunit B"
FT                   /note="best blastp hit: gb|AAK33258.1| (AE006484) putative
FT                   V-type Na+ -ATPase subunit B [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78728"
FT                   /db_xref="GOA:P0DA08"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA08"
FT                   /protein_id="AAM78728.1"
FT                   /translation="MSVLKEYRTVSEVVGPLMIVDQVAGVHYNELVDITLHNGERRKGQ
FT                   VLEVQGDKAMVQLFEGSTGINLAKTKVRFTGHPLELAVSEDMVGRIFDGMGQPIDGGPE
FT                   LIPEKYLDIDGQAINPVARDYPDEFIQTGISAIDHLNTLVRGQKLPVFSGSGLPHNELA
FT                   AQIARQATVLNSDDNFAVVFAAMGITFEEAEFFMNDLRETGAIDRSVLFINLANDPAIE
FT                   RIATPRIALTTAEYLAYEKGMHVLVIMTDMTNYCEALREVSAARREVPGRRGYPGYLYT
FT                   NLSTLYERAGRLIGKKGSVTQIPILTMPEDDITHPIPDLTGYITEGQIILSQELYKNGF
FT                   RPPINVLPSLSRLKDKGSGEGKTRQDHAATMNQLFAAYAQGKQAKELAVVLGESALSET
FT                   DKLYVAFTNRFEEEYINQGFYTNRSIEESLDLGWELLSILPRTELKRIKDDMLDRYLPK
FT                   ADTTMTKVFVAND"
FT   gene            144300..144926
FT                   /gene="ntpD"
FT                   /locus_tag="SpyM3_0122"
FT   CDS             144300..144926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpD"
FT                   /locus_tag="SpyM3_0122"
FT                   /product="putative V-type Na+-ATPase subunit D"
FT                   /note="best blastp hit: gb|AAK33259.1| (AE006484) putative
FT                   V-type Na+ -ATPase subunit D [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78729"
FT                   /db_xref="GOA:P0DA00"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA00"
FT                   /protein_id="AAM78729.1"
FT                   /translation="MARLNVKPTRMELSNLKNRLKTATRGHKLLKDKRDELMRRFVDLI
FT                   RENNELRQTIEKELAANMKEFVLAKASENSLMVEELFAVPVHEVTLWIDIENIMSVNVP
FT                   KFHVQSNTAREQEQGEFAYSYLSSNSEMDNTIQKTKELLEKLLRLAEVEKTCQLMADDI
FT                   EKTRRRVNGLEYAIIPQLEETIHYIELKLEEAERASLVRIMKITS"
FT   gene            complement(145046..146308)
FT                   /locus_tag="SpyM3_0123"
FT   CDS             complement(145046..146308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0123"
FT                   /product="putative toxic anion resistance protein"
FT                   /note="best blastp hit: gb|AAK33260.1| (AE006485) putative
FT                   toxic anion resistance protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78730"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8S9"
FT                   /protein_id="AAM78730.1"
FT                   /translation="MADFNFDIDQIADNAVVKTDKTTDIISDLPTDTNGQISFFEKLSA
FT                   DQQTAITAKAPALVDTFLADQNALLDFGQSAVEGVNATVNHILAEQKKLQIPQVDDLLK
FT                   STNRELNGFIAKYKDATPVDLDKKPNFLQKLFKQSRDTLQEFYFDSQNIEQKMDSMAAA
FT                   VVKQEDTLARNIVSAELLIEDNTKSIEHLVGVIAFIEASQKEASQRAAALQKDLKTKDS
FT                   ATPDYQIKADLLARTTEVINTLEQQHTEYLSRLYVAWATTPQMRNLVKVSSDMRQKLGM
FT                   LRRNTIPTMKLSIAQLGMMQQSVKSGMTADAIVNANNAALQMLAETSKEAIPALEQSAQ
FT                   NPTLSMKSVTSLAESLVAQNNGIIAAIDHGRKERAQLESAIIRSAETINDSVKLRDQNI
FT                   VQALLSEGKETQKTIDKTTHA"
FT   gene            complement(146321..147199)
FT                   /locus_tag="SpyM3_0124"
FT   CDS             complement(146321..147199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0124"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33261.1| (AE006485)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78731"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8S8"
FT                   /protein_id="AAM78731.1"
FT                   /translation="MIRKYDRTSTKKKSLNWIWLIIAFFMISSFIGGSSFTESLLDILP
FT                   AIAIGGTGYAIFRVRSHQKRLAKAKVAKQLEDLKAKIQLADRKVRLLDTYLADHDDFQY
FT                   NVLAQQLLPQLSDIKAKAITLKDQLDPKIYRRITKKANDVESDITLQLETLQIATTLNP
FT                   QPLKTPSPNFINKAPELKPYYDNIQTDHQAILAKIQGADNQEELLALHEANMRRFEDIL
FT                   TGYLKIKEEPKNYYNAAARLEQAKQAIQQFDEDLDETLRRLNESDLKDFDISLRIMQGA
FT                   TQRRTTHHQKD"
FT   gene            147637..148929
FT                   /gene="purA"
FT                   /locus_tag="SpyM3_0125"
FT   CDS             147637..148929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="SpyM3_0125"
FT                   /product="putative adenylosuccinate synthetase"
FT                   /note="best blastp hit: gb|AAK33262.1| (AE006485) putative
FT                   adenylosuccinate synthetase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78732"
FT                   /db_xref="GOA:P0DD54"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD54"
FT                   /protein_id="AAM78732.1"
FT                   /translation="MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVI
FT                   DGKKFKLHLIPSGIFFPQKISVIGNGVVVNPKSLVKELAYLHDEGVTTDNLRISDRAHV
FT                   ILPYHIQLDQLQEDAKGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRIN
FT                   LAEKNRLFEKMYNSTPLDFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTEL
FT                   FDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTV
FT                   KICVAYDLDGKRIDYYPASLEQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRR
FT                   VGELVGVRISTFSVGPGREQTNILESVWASI"
FT   gene            149256..150299
FT                   /locus_tag="SpyM3_0126"
FT   CDS             149256..150299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0126"
FT                   /product="putative ABC transporter"
FT                   /note="best blastp hit: gb|AAK33263.1| (AE006485) putative
FT                   ABC transporter (lipoprotein) [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78733"
FT                   /db_xref="GOA:Q8K8S6"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8S6"
FT                   /protein_id="AAM78733.1"
FT                   /translation="MNKKVMSLGLVSTALFTLGGCTNNSSKQTTDNSLKIAMITNQTGI
FT                   DDKSFNQSAWEGLQAWGKENKLEKGKGYDYFQSANESEFTTNLESAVTNGYNLVFGIGF
FT                   PLHDAVEKVAANNPDNHFAIVDDVIKGQKNVASITFSDHEAAYLAGVAAAKTTKTKQVG
FT                   FVGGMEGDVVKRFEKGFEAGVKSVDDTIKVRVAYAGSFADAAKGKTIAAAQYAEGADVI
FT                   YHAAGGTGAGVFSEAKSINEKRKEEDKVWVIGVDRDQSEDGKYTTKDGKSANFVLTSSI
FT                   KEVGKALVKVAVKTSEGQFPGGQITTFGLKEGGVSLTTDALTQDTKKAIEAAKKAIIEG
FT                   TITVPEN"
FT   gene            150472..151011
FT                   /gene="nusG"
FT                   /locus_tag="SpyM3_0127"
FT   CDS             150472..151011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="SpyM3_0127"
FT                   /product="putative transcription antitermination factor"
FT                   /note="best blastp hit: sp|P82547|NUSG_STRPY TRANSCRIPTION
FT                   ANTITERMINATION PROTEIN NUSG"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78734"
FT                   /db_xref="GOA:P0DC78"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC78"
FT                   /protein_id="AAM78734.1"
FT                   /translation="MLDSFDKGWFVLQTYSGYENKVKENLLQRAQTYNMLDNILRVEIP
FT                   TQTVNVEKNGQTKEIEENRFPGYVLVEMVMTDEAWFVVRNTPNVTGFVGSHGNRSKPTP
FT                   LLEEEIRAILLSMGQTIDVFDTNIKEGDVVQIIDGAFMGQEGRVVEIENNKVKLMLNMF
FT                   GSETVAEVELYQIAEL"
FT   gene            151382..152737
FT                   /gene="nga"
FT                   /locus_tag="SpyM3_0128"
FT   CDS             151382..152737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nga"
FT                   /locus_tag="SpyM3_0128"
FT                   /product="nicotine adenine dinucleotide glycohydrolase
FT                   precursor"
FT                   /note="best blastp hit: gb|AAF19836.1|AF203370_1 (AF203370)
FT                   nicotine adenine dinucleotide glycohydrolase precursor
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78735"
FT                   /db_xref="GOA:Q7CFI6"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010900"
FT                   /db_xref="PDB:4KT6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFI6"
FT                   /protein_id="AAM78735.1"
FT                   /translation="MRNKKVTLAHIVAKTSVAIALAGAMGSSLLANSTTYAVSGKENKK
FT                   SDVKYETTKVMEANATSSKEDNHVMHTLDGSMSTVWEENSPGGGVGEVLSYKFASPMHI
FT                   GRILIVNGDTSSKENYYKKNRIAKADVKYYNGNKLVLFQKIELGDTYTKKPHHIEIDKK
FT                   LDVDRIDIEVTEVHQGQNKDILALSEVTFGNMERDIFEKKFKEIKDKWVTDKQADEFIE
FT                   TADKYADKAVQMSAVASRAEYYRMYVSRKYHYKKEFVEKLKQVYKESGASHVTSKKDVM
FT                   LAFDDAKRKSTIGRQENGLFVTSFAEDMALLFTDQGKLKSADQIENIKGVDSGKYSDGV
FT                   YQYEYDSELTKNIDKLGYIRTASGDTPGANSLNIPGCQTWSGKHIENSESELIFPSISV
FT                   KDLKSKAVLAEIDAKGYFEIIDPTIIAPNGDHKKVTGRFKIKKMQDRMQDRK"
FT   gene            152742..153227
FT                   /locus_tag="SpyM3_0129"
FT   CDS             152742..153227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0129"
FT                   /product="hypothetical protein"
FT                   /note="best non-GAS blastp hit: = gb|AAB37625.1| (U80437)
FT                   C43E11.11 gene product [Caenorhabditis elegans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78736"
FT                   /db_xref="PDB:4KT6"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8S5"
FT                   /protein_id="AAM78736.1"
FT                   /translation="MYKVPKGLEHYQKMFQKEVTVNDLKKYLIGSDKEYRITRRDSYMG
FT                   DISDPEVILEYGVYPAFIKGYTQLKANIEEALLEMSNSGQALDIYQAVQTLNAENMLLN
FT                   YYESLPFYLNRQSILANITKALKDAHIREAMAHYKLGEFAHYQDTMLDMVERTIETF"
FT   gene            153251..154966
FT                   /gene="slo"
FT                   /locus_tag="SpyM3_0130"
FT   CDS             153251..154966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slo"
FT                   /locus_tag="SpyM3_0130"
FT                   /product="streptolysin O"
FT                   /note="best blastp hit: sp|P21131|TACY_STRPY Streptolysin O
FT                   precursor (Thiol-activated cytolysin)"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78737"
FT                   /db_xref="GOA:P0DF96"
FT                   /db_xref="InterPro:IPR001869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF96"
FT                   /protein_id="AAM78737.1"
FT                   /translation="MSNKKTFKKYSRVAGLLTAALIIGNLVTANAESNKQNTASTETTT
FT                   TNEQPKPESSELTTEKAGQKTDDMLNSNDMIKLAPKEMPLESAEKEEKKSEDKKKSEED
FT                   HTEEINDKIYSLNYNELEVLAKNGETIENFVPKEGVKKADKFIVIERKKKNINTTPVDI
FT                   SIIDSVTDRTYPAALQLANKGFTENKPDAVVTKRNPQKIHIDLPGMGDKATVEVNDPTY
FT                   ANVSTAIDNLVNQWHDNYSGGNTLPARTQYTESMVYSKSQIEAALNVNSKILDGTLGID
FT                   FKSISKGEKKVMIAAYKQIFYTVSANLPNNPADVFDKSVTFKELQRKGVSNEAPPLFVS
FT                   NVAYGRTVFVKLETSSKSNDVEAAFSAALKGTDVKTNGKYSDILENSSFTAVVLGGDAA
FT                   EHNKVVTKDFDVIRNVIKDNATFSRKNPAYPISYTSVFLKNNKIAGVNNRTEYVETTST
FT                   EYTSGKINLSHQGAYVAQYEILWDEINYDDKGKEVITKRRWDNNWYSKTSPFSTVIPLG
FT                   ANSRNIRIMARECTGLAWEWWRKVIDERDVKLSKEINVNISGSTLSPYGSITYK"
FT   gene            complement(155105..155347)
FT                   /locus_tag="SpyM3_0131"
FT   CDS             complement(155105..155347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0131"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33269.1| (AE006486)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78738"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8S4"
FT                   /protein_id="AAM78738.1"
FT                   /translation="MKNKLSLFMIATAAVVGFSLATPKNQTVSANEAVATQACADGTNC
FT                   CGYNFYGYCRPISWLFYKTKHLLTGDQPTTDTVTK"
FT   gene            complement(155747..155902)
FT                   /locus_tag="SpyM3_0132"
FT   CDS             complement(155747..155902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0132"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33270.1| (AE006486)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78739"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8S3"
FT                   /protein_id="AAM78739.1"
FT                   /translation="MKKKLSLFMIATAAVAGLSLATLGNHQTVSANDASFYGQNAPDSW
FT                   LLYTVW"
FT   gene            156817..158037
FT                   /gene="metB"
FT                   /locus_tag="SpyM3_0133"
FT   CDS             156817..158037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="SpyM3_0133"
FT                   /product="putative cystathionine beta-lyase"
FT                   /note="best blastp hit: gb|AAK33272.1| (AE006486) putative
FT                   cystathionine beta-lyase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78740"
FT                   /db_xref="GOA:Q8K8S2"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8S2"
FT                   /protein_id="AAM78740.1"
FT                   /translation="MVCATIGVGPLSKREFIGVNAIAEVHEMRENTTLLHGYTVIDEFT
FT                   GAASVPIYQTSTFHNSELYCPSQKHLYTRFSNPTTEALEDGLACLEKATYAVAYASGMA
FT                   AISTVLMLLKAGDHVIFPLEVYGGTCQFATAILPNYQIETSFVDMADLATVKASIRPNT
FT                   RMIYLETPSNPLLKICDISELVQLAKAYGVLTVADNTFMTSLYQEPLAMGVDIVVESVT
FT                   KFINGHSDVVAGLAATNNEAIYNQLKLFQKNFGAIVGVEDAWLILRGMKTMGIRMEQAV
FT                   KNAQQLANYLAKHPKVLKVHYPGLDSHPNHDTHLQQAKNGGAVLSFELASKEELMTFTH
FT                   RIQLPILAVSLGGVESILSHPATMSHACLSSQARLEQGVVDGLLRLSCGVENIEDLLAD
FT                   FEQALAF"
FT   gene            158248..160749
FT                   /gene="leuS"
FT                   /locus_tag="SpyM3_0134"
FT   CDS             158248..160749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="SpyM3_0134"
FT                   /product="putative putative leucyl-tRNA synthetase"
FT                   /note="best blastp hit: gb|AAK33273.1| (AE006486) putative
FT                   leucyl-tRNA synthetase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78741"
FT                   /db_xref="GOA:P0DG44"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG44"
FT                   /protein_id="AAM78741.1"
FT                   /translation="MTFYDHTAIEPKWQAFWADNHTFKTGTDASKPKFYALDMFPYPSG
FT                   AGLHVGHPEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAEN
FT                   IANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELG
FT                   TAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITVYAERLLEDLEEVDWPESIKDMQRN
FT                   WIGKSTGANVTFKVKDTDKNFTVFTTRPDTLFGATYAVLAPEHALVDAITTADQAEAVA
FT                   DYKRQASLKSDLARTDLAKEKTGVWTGSYAINPVNGKEIPVWIADYVLASYGTGAIMAV
FT                   PAHDERDWEFAKQFNLDIIPVLEGGNVEEAAFTEDGLHINSGFLDGLDKASAIAKMVEW
FT                   LEAEGVGNEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPESELPLVLPVTKDIR
FT                   PSGTGESPLANVTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADEE
FT                   LLKQWLPVDIYVGGAEHAVLHLLYARFWHKVLYDLGVVPTKEPFQKLFNQGMILGTSYR
FT                   DSRGALVATDKVEKRDGSFFHVETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRV
FT                   YEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLITTKEITEENSGALDKVYNETVKAVTE
FT                   QVDQMKFNTAIAQLMVFVNAANKEDKLFSDYAKGFVQLIAPFAPHLGEELWQALTASGE
FT                   SISYVPWPSYDESKLVENDVEIVVQIKGKVKAKLVVAKDLSREELQEVALANEKVQAEI
FT                   AGKDIIKVIAVPNKLVNIVIK"
FT   gene            161056..162489
FT                   /locus_tag="SpyM3_0135"
FT   CDS             161056..162489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0135"
FT                   /product="putative PTS system membrane component"
FT                   /note="best non-GAS blastp hit: gb|AAK76103.1| (AE007492)
FT                   PTS system, membrane component, putative [Streptococcus
FT                   pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78742"
FT                   /db_xref="GOA:Q8K8S0"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8S0"
FT                   /protein_id="AAM78742.1"
FT                   /translation="MEMLLAPLNWFSQNILQNPAFFVGLLVLIGYLLLKKPIYEVFAGF
FT                   VKATVGYLILNVGAGGLVTTFRPILVALAKKFELKAAVIDPYFGLAAANTKLEEMGFIS
FT                   VATTALLIGFGVNILLVALRKVTKVRTLFITGHIMVQQAATISVFVLLLIPQFQNAFGA
FT                   WAVGIICGLYWAVSSNMTVEATQRLTGGGGFAIGHQQQFAIWFVDKVAPFFGKKEENLD
FT                   NLKLPTFLNIFHDTVVASATLMLVFFGAILAVLGPDIMSDVGLIGPGAFNPAKQAFFMY
FT                   ILQTSLTFSVYLFILMQGVRMFVSELTNAFQGISSKLLPGSFPAVDVAASYGFGSSNAV
FT                   LSGFAFGLIGQLITIALLVIFKNPILIITGFVPVFFDNAAIAVYADKRGGWKAAVALSF
FT                   ISGIIQVALGAVAVGLLGLTGGYHGNIDLVLPWLPFGYLFKFLGIAGYVLVCIFLLAIP
FT                   QLQFAKAKDKEAYYRGEAQ"
FT   gene            162560..162838
FT                   /locus_tag="SpyM3_0136"
FT   CDS             162560..162838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0136"
FT                   /product="putative PTS system IIB component"
FT                   /note="best non-GAS blastp hit:gb|AAK76102.1| (AE007492)
FT                   PTS system, IIB component [Streptococcus pneumoniae TIGR4],
FT                   and gb|AAL00651.1| (AE008549) Phosphotransferase system
FT                   sugar-specific EII component [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78743"
FT                   /db_xref="GOA:Q7CFI5"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFI5"
FT                   /protein_id="AAM78743.1"
FT                   /translation="MVKVLTACGNGMGSSMVIKMKVENALRQLGVTDIQSASCSVGEAK
FT                   GLASGYDIVVASNHLIHELDGRTKGHLVGLDNLMDDNEIKTKLQEVL"
FT   gene            162961..163446
FT                   /locus_tag="SpyM3_0137"
FT   CDS             162961..163446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0137"
FT                   /product="putative PTS system IIA component"
FT                   /note="best non-GAS blastp hit:gb|AAK76101.1| (AE007492)
FT                   PTS system, IIA component [Streptococcus pneumoniae TIGR4],
FT                   and gb|AAL00650.1| (AE008549) Phosphotransferase system
FT                   sugar-specific EII component [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78744"
FT                   /db_xref="GOA:F7IW21"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:F7IW21"
FT                   /protein_id="AAM78744.1"
FT                   /translation="MNLKQAFIDNNSIRLGLSADTWQEAVQLAVQPLIDSKAVTSAYYD
FT                   AIIASTEKYGPYYVLMPGMAMPHAEAGLGVNRNAFALITLTKPVTFSDGKEVSVLLTLA
FT                   ATDPSIHTTVAIPQIVALFELDNAIERLVACQSPKEVLEMVEESKDSPYLEGMDLNA"
FT   gene            163537..164199
FT                   /locus_tag="SpyM3_0138"
FT   CDS             163537..164199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0138"
FT                   /product="putative hexulose-6-phosphate synthase"
FT                   /note="HumpS; best non-Gas blastp hit: gb|AAL00649.1|
FT                   (AE008549) Hexulose-6-phosphate synthase (HumpS)
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78745"
FT                   /db_xref="GOA:Q8K8R9"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8R9"
FT                   /protein_id="AAM78745.1"
FT                   /translation="MTHIPNLQVALDHSDLQGAVKAAVAVGHEVDVIEAGTVCLLQVGS
FT                   ELVEVLRSLFPEKIIVADTKCADAGDTVAKNNAKRGADWMTCICCATIPTMEAALKAIK
FT                   EVRGDRGEIQIELYGDWTYEQAQLWLDAGISQAIYHQSRDALLAGETWGEKDLNKVKTL
FT                   IDMGFRVSVTGGLDVDTLKLFEGVDVFTFIAGRGITEAEDPAAAARAFKDEIRRIWG"
FT   gene            164204..165067
FT                   /locus_tag="SpyM3_0139"
FT   CDS             164204..165067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0139"
FT                   /product="putative hexulose-6-phosphate isomerase"
FT                   /note="best blastp hit: gb|AAL00648.1| (AE008549)
FT                   Hexulose-6-phosphate isomerase [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78746"
FT                   /db_xref="GOA:Q8K8R8"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8R8"
FT                   /protein_id="AAM78746.1"
FT                   /translation="MARPIGIYEKATPKQFTWRERLQFAKDLGFDFVEMSVDESDARLA
FT                   RLEWTKEERLDLVKAIYETGIRIPTICFSGHRRYPLGSNDPAIEAKSLKLMKQCIELAQ
FT                   DLGVRTIQLAGYDVYYEEKSPETRARFIKNLRQSCDWAEEAQVMLSIEIMDDPFINSIE
FT                   KYLAVEKEIDSPYLFVYPDVGNVSAWHNDLWSEFYNGHKSIAALHLKDTYAVTETSKGQ
FT                   FRDVPFGQGCVDWQELFAVLKKTNYNGPFLIEMWSENCDTVEETKAAIKEAQDFLYPLI
FT                   EKAGLA"
FT   gene            165069..165773
FT                   /gene="araD"
FT                   /locus_tag="SpyM3_0140"
FT   CDS             165069..165773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="SpyM3_0140"
FT                   /product="putative L-ribulose 5-phosphate 4-epimerase"
FT                   /note="best non-GAS blastp hit: gb|AAL00647.1| (AE008549)
FT                   L-ribulose 5-phosphate 4-epimerase [Streptococcus
FT                   pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78747"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8R7"
FT                   /protein_id="AAM78747.1"
FT                   /translation="MAKNLQEMRERVCAANKSLPQHGLVKFTWGNVSEVCRELGRIVIK
FT                   PSGVDYDLLTPENMVVTDLDGNVVEGDLNPSSDLPTHVELYKAWPEVGGIVHTHSTEAV
FT                   GWAQAGRDIPFYGTTHADYFYGPVPCARSLTKAEVDGAYEQETGSVILEEFSKRGLDPM
FT                   AVPGIVVRNHGPFTWGKTPEQAVYHSVVLEEVAKMNRLTEQINPRVEPAPRYIMDKHYL
FT                   RKHGPNAYYGQK"
FT   gene            166098..167744
FT                   /locus_tag="SpyM3_0141"
FT   CDS             166098..167744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0141"
FT                   /product="putative transcriptional regulator"
FT                   /note="best non-GAS blastp hit: gb|AAK76097.1| (AE007492)
FT                   transcriptional regulator, BglG family [Streptococcus
FT                   pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78748"
FT                   /db_xref="GOA:Q8K8R6"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8R6"
FT                   /protein_id="AAM78748.1"
FT                   /translation="MMILDKKSYDLLSYLLKLETPETVMAISHALNQSRRKVYYQLDKI
FT                   NKALPKGVDQIISYPRLGILLTADQKAACRLLLEEVTDYNYVMKSDERRRLSSIYIAVS
FT                   TERVTIDKLMQINDVSRNTILNDLTELREELEDKQYKIQLHATKARGYYFGCHPMALIQ
FT                   YLYKLLVDVYQGGNTSFIDIFNRKLSEIQGLSVYFSKDILTYFHEYLFLSQASLGKTIN
FT                   TQDSQFMLQILPFMLLSYRNMRLDSETKSALKQEFHLIWKRKEYHIAQDLARELYHNFK
FT                   LHLDDIEVSMVAMLMLSFRKDQDHHVESQDYDDMRATISHFIDQLESRYQLHFTHKQDL
FT                   LKQLTTHCKALVYRKAYGIFLVNPLTDHIKEKYEELFAMTQSCATILEQDWTISLTDDD
FT                   IAYLTIHLGGELRHNNTEQEKTKLVIVSDDGIGIQKLLFKQCQRYLANGQIEAVFTTEQ
FT                   YQSVYDLLAVDMIVATTDTLKTKIPMLIVNPILSDDDIIKLIRFSKQGRLSEHSRFSTE
FT                   LTKAIEAVVKDESDRYALVSKIEKLIHRELL"
FT   gene            167997..169088
FT                   /locus_tag="SpyM3_0142"
FT   CDS             167997..169088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33282.1| (AE006487) conserved
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78749"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8R5"
FT                   /protein_id="AAM78749.1"
FT                   /translation="MTKVQDITRESWILNTFPEWGTWLNEEIEQEVVPADNFAMWWLGN
FT                   CGIWIKTPGSANVVMDLWSNRGKATKQVKDMVRGHQMANMAGARKLQPNLRAQPMVIDP
FT                   FMINELDYYLVSHYHSDHIDINTAAAIINNPKLNHVKFVGPYECGEVWKNWGVPKDRIM
FT                   ILKPGDSFEFKDIKITAVESFDRTCLVTLPIQGADAQDGDLAGLAITDDDMARKAVNYI
FT                   FETPGGTIYHGADSHFSNYFAKHGRDYDIDVVLNNYGENPIGIQDKMTSVDLLRMAENL
FT                   RAKVVIPVHYDIWSNFMASTDEILELWKMRKERLQYDFHPFIWEVGGKYTYPQDQNRIE
FT                   YHHPRGFDDCFLEDSNIQFKALL"
FT   gene            169576..170772
FT                   /gene="opuAA"
FT                   /locus_tag="SpyM3_0143"
FT   CDS             169576..170772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAA"
FT                   /locus_tag="SpyM3_0143"
FT                   /product="putative glycine betaine/proline ABC transporter"
FT                   /note="best blastp hit: gb|AAK33283.1| (AE006487) putative
FT                   glycine betaine/proline ABC transporter (ATP-binding
FT                   protein) [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78750"
FT                   /db_xref="GOA:Q7CFI3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFI3"
FT                   /protein_id="AAM78750.1"
FT                   /translation="METILEVKHLSKIFGKKQKAALEMVKTGKNKSEIFKKTGATVGVY
FT                   DASFEVKKGEIFVIMGLSGSGKSTLVRMLNRLIEPSAGSILLEGKDISTMSADQLREVR
FT                   RHDINMVFQSFALFPHKTILENTEFGLELRGVPKEERQRLAEKALDNSGLLDFKDQYPN
FT                   QLSGGMQQRVGLARALANSPKILLMDEAFSALDPLIRREMQDELLDLQDSMKQTIIFIS
FT                   HDLNEALRIGDRIALMKDGQIMQIGTGEEILTNPANDFVREFVEDVDRSKVLTAQNIMI
FT                   KPLTTTVELDGPQVALNRMHNEEVSMLMATNRRRQLVGSLTADAAIEARKKGLPLSEVI
FT                   DRDVRTVSKDTIITDILPLIYDSSAPIAVTDDNNRLLGVIIRGRVIEALANISDEDLN"
FT   gene            170830..172515
FT                   /gene="opuABC"
FT                   /locus_tag="SpyM3_0144"
FT   CDS             170830..172515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuABC"
FT                   /locus_tag="SpyM3_0144"
FT                   /product="putative glycine-betaine binding permease
FT                   protein"
FT                   /note="best blastp hit: gb|AAK33284.1| (AE006487) putative
FT                   glycine-betaine binding permease protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78751"
FT                   /db_xref="GOA:Q8K8R4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8R4"
FT                   /protein_id="AAM78751.1"
FT                   /translation="MEQLTEWLTKTFSGLFDIMQVVGSFLMDWMTKTLLFIHPLLFIVL
FT                   VTAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVASLISVLIGIPLGIW
FT                   MAKNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNL
FT                   AIRDIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGA
FT                   PGLGREVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSKPQEKAKAGKTNKWIGL
FT                   AALAVFLIAALGRGIMAMTSGMADKGETVNIAYVQWDSEVASTHVIAEVLKNEGYHVTL
FT                   TPLDNAVMWQTVANGNADFSTSAWLPVTHGQQYQKYKSKLDDLGPNLKGTKLGLAVPKY
FT                   MTDVNSIEDLSKQADQKITGIEPGAGIMAAAKKTLKEYHNLSSWELVAASTGAMTTSLD
FT                   QAIKKKDPIVVTAWSPHWMFAKYDLKYLKDPKETFGSTENINTIARKGLKKDLPNVYKI
FT                   IDKFHWTQKDMAAVMLDINKGMSPEAAAKKWVEANKSKVSSWTK"
FT   gene            172646..175288
FT                   /gene="polA.1"
FT                   /locus_tag="SpyM3_0145"
FT   CDS             172646..175288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA.1"
FT                   /locus_tag="SpyM3_0145"
FT                   /product="DNA-directed DNA polymerase I"
FT                   /note="best blastp hit: gb|AAK33285.1| (AE006487)
FT                   DNA-directed DNA polymerase I [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78752"
FT                   /db_xref="GOA:Q8K8R3"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8R3"
FT                   /protein_id="AAM78752.1"
FT                   /translation="MENKNKLLLIDGSSVAFRAFFALYNQIDRFKNHSGLHTNAIYGFH
FT                   LMLDHMMKRVQPTHVLVAFDAGKTTFRTEMYADYKAGRAKTPDEFREQFPYIREMLTAL
FT                   GIAYYELEHYEADDIIGTLDKMAERTEVPFDVTIVSGDKDLIQLTDENTVVEISKKGVA
FT                   EFEEFTPAYLMEKMGLTPNQFIDLKALMGDKSDNIPGVTKIGEKTGLKLLHKFGSLEGI
FT                   YEHIDGFKASKMKENLINDRDQAFLSKTLATINTASPITIGLDDIVYNGPDVASLSQFY
FT                   DEMDFVQLKKGLASQMPQEPVAAISYQEVTNVSADLFSAEDIFYFETLRDNYHREAIIG
FT                   FAWGHGEQIYASTDLSLLATDSFKQVFQKPIATYDFKRSKVLLSHLGIELVAPSYDARL
FT                   ANYLLSTVEDNELSTIARIFTDISLEEDDTVYGKGAKRAVPDKDVLLEHLARKVKVLLD
FT                   SKSQMLDKLTAHEQLDLYQNIELPLANVLAKMEIEGIKVNRATLQDMAEQNKVIIEALT
FT                   QEIYDMAGQEFNINSPKQLGSILFEKMQLPLEMTKKTKTGYSTAVDVLERLAPIAPIVA
FT                   KILDYRQITKLQSTYVIGLQDYILADGKIHTRYVQDLTQTGRLSSVDPNLQNIPIRLEQ
FT                   GRLIRKAFTPSHEDAVLLSSDYSQIELRVLAHISGDEHLIAAFNEGADIHTSTAMRVFG
FT                   IDKAADVTANDRRNAKAVNFGIVYGISDFGLSNNLGITRKQAKSYIDTYFERYPGIKAY
FT                   MENVVREAKDKGYVETLFKRRRELPDINSRNFNVRSFAERTAINSPIQGSAADILKIAM
FT                   INLDKALQAGGFRAKMLLQVHDEIVLEVPNDELTAIKKLVKDTMEAAVDLAVPLCVDES
FT                   TGQSWYEAK"
FT   gene            175475..175930
FT                   /locus_tag="SpyM3_0146"
FT   CDS             175475..175930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK04253.1|AE006253_4
FT                   (AE006253) hypothetical protein [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78753"
FT                   /db_xref="GOA:Q7CFI2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFI2"
FT                   /protein_id="AAM78753.1"
FT                   /translation="MIYSFQNPSEDVLKAYLESAKTIAVVGLSDRKDTAAYGVAKFMQA
FT                   MDYRIIPVNPKLAGQLILGEKVYASIKAIPFEVDIVDVFRRSEFLPEVARDFLAGQAKV
FT                   FWAQLGLENQEAQTILRSAGKEAIVMNRCLKIDYLQLVAKPECITNH"
FT   gene            175982..176449
FT                   /gene="spf"
FT                   /locus_tag="SpyM3_0147"
FT   CDS             175982..176449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spf"
FT                   /locus_tag="SpyM3_0147"
FT                   /product="putative ferric uptake regulator"
FT                   /note="best non-GAS blastp hit: gb|AAF00079.1|AF095596_1
FT                   (AF095596) ferric uptake regulator homolog [Staphylococcus
FT                   aureus]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78754"
FT                   /db_xref="GOA:Q7CFI1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="PDB:4I7H"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFI1"
FT                   /protein_id="AAM78754.1"
FT                   /translation="MDIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHP
FT                   SADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVC
FT                   EICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQAKDQPDF"
FT   gene            complement(176552..177415)
FT                   /locus_tag="SpyM3_0148"
FT   CDS             complement(176552..177415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAL00672.1| (AE008551)
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78755"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8R2"
FT                   /protein_id="AAM78755.1"
FT                   /translation="MSIKAIKGQARDTLKNLSGKYLLFLIPTLLFMFHFGIEIHQGYVL
FT                   SSGIEVSLAASYFPLLLGLILSLFILSASFTMIDVVRHFRQKVSFAESTTAFSKEFFGN
FT                   LLVLAITKWLFFLIWSLIWFFGLFIFLSGLSAFLVNAKSGSSTVISLIFLLFGAVLSLI
FT                   GFGIYINRYYAYSLSEYLLYDKVKEGTYLGAIAVIKTSVAMMKGYKWKLFFLQLSFTGW
FT                   FLLNIVTFGLLNIYLLPYFTTANVIFYDQLKKRFKDKDDPIEGEHLSLHQLNKKPTPMM
FT                   YDDQKD"
FT   gene            177634..178776
FT                   /gene="tgt"
FT                   /locus_tag="SpyM3_0149"
FT   CDS             177634..178776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="SpyM3_0149"
FT                   /product="putative tRNA-guanine transglycosylase"
FT                   /note="best blastp hit: gb|AAK33298.1| (AE006488) putative
FT                   tRNA-guanine transglycosylase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78756"
FT                   /db_xref="GOA:P0DF86"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF86"
FT                   /protein_id="AAM78756.1"
FT                   /translation="MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATV
FT                   KTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYS
FT                   LADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVK
FT                   KSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLA
FT                   VGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNG
FT                   TCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHN
FT                   LYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF"
FT   gene            178994..179305
FT                   /locus_tag="SpyM3_0150"
FT   CDS             178994..179305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75525.1| (AE007439)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78757"
FT                   /db_xref="GOA:F7IWF4"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR016694"
FT                   /db_xref="UniProtKB/TrEMBL:F7IWF4"
FT                   /protein_id="AAM78757.1"
FT                   /translation="MTDCFGIDLDQEYRCLHYHTPLDIVGLKCAFCQTYYACYHCHDQL
FT                   TDHAFVPTGHQETSPVICGHCRKLLSLAEYGCGCCPYCQSPFNPACHRHKDIYFLKES"
FT   gene            179309..179848
FT                   /locus_tag="SpyM3_0151"
FT   CDS             179309..179848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0151"
FT                   /product="putative biotin synthase"
FT                   /note="best blastp hit: gb|AAK33300.1| (AE006489) putative
FT                   biotin synthase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78758"
FT                   /db_xref="GOA:Q8K8R1"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8R1"
FT                   /protein_id="AAM78758.1"
FT                   /translation="MFTTKELVKVAMMTTLIIILGFIPAIPLGFIPVPIVLQNLGVMLA
FT                   GLMLGGKKGTLSVFLFLVIGLFLPVFSGSRTTIPVLMGPSAGYVIAYLLVPIVFSLLYR
FT                   NWFSKSTPLAFLALLISGVVLVDVLGAIWLAAYTGMSLVTSLLSNLVFIPGDTIKAIIA
FT                   TIIAVKYKDSFLNTKQ"
FT   gene            179988..180767
FT                   /locus_tag="SpyM3_0152"
FT   CDS             179988..180767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK04817.1|AE006305_9
FT                   (AE006305) conserved hypothetical protein [Lactococcus
FT                   lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78759"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8R0"
FT                   /protein_id="AAM78759.1"
FT                   /translation="MKLTTLGSWGAYPYQDAGTTSYLVTGHDGFQLLMDAGSRALNELE
FT                   KEISPLDLDAVIISHYHPDHVADLGVLRHYFQLYPKHLWQPKVLPIYGHDEDRHEFAKL
FT                   SIPDVSEGRAYDVTGVEQIGPFDITFLKTVHPVVCYAFRIVERATGQVLVFTGDSGYFE
FT                   GLADFAKEADLFLADVYLYEGNENHMAHLTSKEAGLMASQAGVKKLVLTHMPPVPPEGI
FT                   DPDNHLEVLRQETQAYAGNIPVDLALPHKSWNLGSLS"
FT   gene            180767..181282
FT                   /locus_tag="SpyM3_0153"
FT   CDS             180767..181282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0153"
FT                   /product="putative cytidine/deoxycytidylate deaminase
FT                   family protein"
FT                   /note="best non-GAS blastp hit:gb|AAK74212.1| (AE007319)
FT                   cytidine/deoxycytidylate deaminase family protein
FT                   [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78760"
FT                   /db_xref="GOA:P0DA20"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA20"
FT                   /protein_id="AAM78760.1"
FT                   /translation="MPYSLEEQTYFMQEALKEAEKSLQKAEIPIGCVIVKDGEIIGRGH
FT                   NAREESNQAIMHAEMMAINEANAHEGNWRLLDTTLFVTIEPCVMCSGAIGLARIPHVIY
FT                   GASNQKFGGADSLYQILTDERLNHRVQVERGLLAADCANIMQTFFRQGRERKKIAKHLI
FT                   KEQSDPFD"
FT   gene            complement(181896..183116)
FT                   /locus_tag="SpyM3_0154"
FT   CDS             complement(181896..183116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0154"
FT                   /product="hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK76749.1|AE001438_2
FT                   (AE001438) Transglutaminase-like predicted protease domain
FT                   fused ChW-repeats and cell-adhesion domain [Clostridium
FT                   acetobutylicum]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78761"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Q8"
FT                   /protein_id="AAM78761.1"
FT                   /translation="MKQKIKILTVIGLMTVGMSACHNTSKPSNTDSVFSLTGKKRQQIV
FT                   KQVRQRYYFQQLSKTEQENYLTLYDSLAQFREIISLTPASKKSLIKTIDAFVMDNPEFY
FT                   WITSADYRFEFSDQTVFVTFPIPEDAKNVYQDLQAIGNDIVANTPSKDRYEQVKYFYEV
FT                   IIRDTDYNKKAFEAYQSGSQAQVASNQDIKSVFIDHLSVCNGYAQAFQFLCQKAGIPVA
FT                   YIRGTGTSQQPQQSFAHAWNAVQINNTYYGVDVTWGDPVFDNHLSHQKQGTINYSFLCL
FT                   PDYLMALSHQPSKDIAFNTKERFENVWTIPSCTDDSLLYSKRHQSYISTFDSDAILASL
FT                   ENQLLNRQEPLSLQFAHQDDYQQMVTDLTTNQTGYHNLFNQYWNNYTGFTYGLLPETLS
FT                   ISFASRN"
FT   gene            183529..184233
FT                   /gene="speG"
FT                   /locus_tag="SpyM3_0155"
FT   CDS             183529..184233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="SpyM3_0155"
FT                   /product="pyrogenic exotoxin G precursor"
FT                   /note="best blastp hit: gb|AAD30988.1|AF124499_1 (AF124499)
FT                   exotoxin G precursor [Streptococcus pyogenes], and
FT                   gb|AAK33303.1| (AE006489) exotoxin G precursor
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78762"
FT                   /db_xref="GOA:P0DG08"
FT                   /db_xref="InterPro:IPR006123"
FT                   /db_xref="InterPro:IPR006126"
FT                   /db_xref="InterPro:IPR006173"
FT                   /db_xref="InterPro:IPR006177"
FT                   /db_xref="InterPro:IPR008992"
FT                   /db_xref="InterPro:IPR013307"
FT                   /db_xref="InterPro:IPR016091"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG08"
FT                   /protein_id="AAM78762.1"
FT                   /translation="MKTNILTIIILSCVFSYGSQLAYADENLKDLKRSLRFAYNITPCD
FT                   YENVEIAFVTTNSIHINTKQKRSECILYVDSIVSLGITDQFIKGDKVDVFGLPYNFSPP
FT                   YVDNIYGGIVKHSNQGNKSLQFVGILNQDGKETYLPSEVVRIKKKQFTLQEFDLKIRKF
FT                   LMEKYNIYDSESRYTSGSLFLATKDSKHYEVDLFNKDDKLLSRDSFFKRYKDNKIFNSE
FT                   EISHFDIYLKTY"
FT   gene            184694..186043
FT                   /gene="pgi"
FT                   /locus_tag="SpyM3_0156"
FT   CDS             184694..186043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="SpyM3_0156"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /note="best blastp hit: gb|AAK33304.1| (AE006489)
FT                   glucose-6-phosphate isomerase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78763"
FT                   /db_xref="GOA:P0DB24"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DB24"
FT                   /protein_id="AAM78763.1"
FT                   /translation="MSHITFDYSKVLESFAGQHEIDFLQGQVTEADKLLREGTGPGSDF
FT                   LGWLDLPENYDEEEFARILTAAEKIKSDSEVLVVIGIGGSYLGAKAAIDFLNHHFANLQ
FT                   TAKERKAPQILYAGNSISSTYLADLVEYVQDKEFSVNVISKSGTTTEPAIAFRVFKELL
FT                   VKKYGQEEASKRIYATTDKVKGAVKVEADANNWETFVVPDNVGGRFSVLTAVGLLPIAA
FT                   SGADITALMEGANAARKDLSSDKISENIAYQYAAVRNLLYRKGYITEILANYEPSLQYF
FT                   GEWWKQLAGESEGKDQKGIYPTSANFSTDLHSLGQFIQEGYRNLFETVIRVDNPRKNVI
FT                   IPELAEDLDGLGYLQGKDVDFVNKKATDGVLLAHTDGGVPNMFVTLPAQDEFTLGYTIY
FT                   FFELAIAVSGYMNAVNPFDQPGVEAYKRNMFALLGKPGFEALSAELNARL"
FT   gene            complement(186392..187630)
FT                   /locus_tag="SpyM3_0157"
FT   CDS             complement(186392..187630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0157"
FT                   /product="putative regulatory protein RofA related"
FT                   /note="best blastp hit: gb|AAK33305.1| (AE006489) putative
FT                   regulatory protein - RofA related [Streptococcus pyogenes
FT                   M1 GAS]; possible pseudogene aligns with C-terminal portion
FT                   (amino acids 91-502) of RofA [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78764"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVZ3"
FT                   /protein_id="AAM78764.1"
FT                   /translation="MLTFLLLDNPKHKSIAVYTRKQGISQSKAYRLIHKLKHYLQDIGL
FT                   NIVDNTVIGDELKIRYLIALLHKEYGIILYDIQPADIETIHAFIFAAQKNLQPSAFLDR
FT                   RFLFFDVLLMLTWKRHRYPVHLPHLALFEHLKSLPIFDNIKTIAVDEPAPRTRVTFSSD
FT                   DFDYLFLIYLTTDNSFLSGYWTSHQRQQLYHLITKDPDYHLLIHRLQALVGNYSDIHEH
FT                   IPNLIPFFKRTLYNLQTLITFDGYYFDQYQGNMLLLDKLETVIKDWLYDTGRQGSISSG
FT                   HLHLMCLYLEQILESSIAPINITVIESQETVGNVIANFITSTIPSYKVELSRVNILSDN
FT                   IYPYDKPVDLVVTSQKLLPFLKELGVFPKETRLFGLSLDCIQQQREDLIKTILALHQNH
FT                   YQKRLEELWRVPS"
FT   gene            complement(187633..187899)
FT                   /locus_tag="SpyM3_0158"
FT   CDS             complement(187633..187899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0158"
FT                   /product="putative regulatory protein"
FT                   /note="best blastp hit: gb|AAK33305.1| (AE006489) putative
FT                   regulatory protein - RofA related [Streptococcus pyogenes
FT                   M1 GAS]; possible pseudogene aligns with N-terminal portion
FT                   (amino acids 1-79) of RofA [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78765"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFH8"
FT                   /protein_id="AAM78765.1"
FT                   /translation="MLDYYLESDIIDQKILLAILLTEKELTMAAACSQTTLTALKIKQY
FT                   LRQFNALFKGYLRIELIKSRIYCEVLNDKREAFFMTFLPYQIL"
FT   gene            188587..189258
FT                   /locus_tag="SpyM3_0159"
FT   CDS             188587..189258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp hit: emb|CAB90755.1| (AJ400707)
FT                   hypothetical protein [Streptococcus uberis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78766"
FT                   /db_xref="GOA:Q8K8Q5"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Q5"
FT                   /protein_id="AAM78766.1"
FT                   /translation="MTRLLKRYPITIFLLGLTGLIFIAMQVVYGHLATGAQAIYQVGGM
FT                   FGLLVKAMPDQLWRLVTPIFIHIGFGHFFVNGLTLYFVGQIVEDLWGSSRFLLLYVLSG
FT                   VMGNAFTFWLTPETVAAGASTSLFGLFAAIVVLSFLGKNQALKDLGKSYQTLIVVNLLM
FT                   NLFMPNVSMAGHIGGVVGGALLSIVFPTKMRVITVKKTKRMLALVSYGIILVGVLVLGF
FT                   L"
FT   gene            complement(189357..190256)
FT                   /gene="hasC.2"
FT                   /locus_tag="SpyM3_0160"
FT   CDS             complement(189357..190256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hasC.2"
FT                   /locus_tag="SpyM3_0160"
FT                   /product="putative UDP-glucose pyrophosphorylase"
FT                   /note="best blastp match sp|P58098|HAC2_STRPY
FT                   UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE 2 (UDP-GLUCOSE
FT                   PYROPHOSPHORYLASE 2) (UDPGP 2)
FT                   (ALPHA-D-GLUCOSYL-1-PHOSPHATE URIDYLYLTRANSFERASE 2)
FT                   (URIDINE DIPHOSPHOGLUCOSE PYROPHOSPHORYLASE 2)"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78767"
FT                   /db_xref="GOA:P0DG72"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG72"
FT                   /protein_id="AAM78767.1"
FT                   /translation="MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEA
FT                   LKSGIEEILIVTGKSKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIRQS
FT                   HPRGLGDAVLQAKTFVGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVM
FT                   RVPHEDVSNYGIIAPQAKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILE
FT                   KQEPGAGNEVQLTDAIDTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKD
FT                   DLKAYIIQLGKALEKTKP"
FT   gene            complement(190289..191305)
FT                   /gene="gpdA"
FT                   /locus_tag="SpyM3_0161"
FT   CDS             complement(190289..191305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpdA"
FT                   /locus_tag="SpyM3_0161"
FT                   /product="putative NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /note="best blastp hit: gb|AAK33309.1| (AE006490) putative
FT                   NAD(P)H-dependent glycerol-3-phosphate dehydrogenase
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78768"
FT                   /db_xref="GOA:P0DB22"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DB22"
FT                   /protein_id="AAM78768.1"
FT                   /translation="MTKQKVAILGPGSWGTALSQVLNDNGHDVRLWGNIPDQIEEINTK
FT                   HTNRHYFKDIVLDKNITATLDLGQALSDVDAVLFVVPTKVTRLVARQVAAILDHKVVVM
FT                   HASKGLEPETHERLSTILEEEIPAHFRSEVVVVSGPSHAEETIVRDITLITAASKDIEA
FT                   AKYVQSLFSNHYFRLYTNTDVIGVETAGALKNIIAVGAGALHGLGYGDNAKAAVITRGL
FT                   AEITRLGVKLGADPLTYSGLSGVGDLIVTGTSVHSRNWRAGAALGRGEKLEDIERNMGM
FT                   VIEGIATTKVAYEIAQDLGVYMPITTAIYKSIYEGADIKESILGMMSNEFRSENEWH"
FT   gene            191603..192052
FT                   /locus_tag="SpyM3_0162"
FT   CDS             191603..192052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75988.1| (AE007482)
FT                   transcriptional regulator, MarR family [Streptococcus
FT                   pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78769"
FT                   /db_xref="GOA:F7IVM0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVM0"
FT                   /protein_id="AAM78769.1"
FT                   /translation="MSQVIGDLRELIHQIEQISDEIAKKYDVEHLAGPQGYVLVFLAKH
FT                   QNQEIFVKDIEKQLRISKSVASHLVKRMVKNGFINVMPSQVDKRYKQVVLAQVGRDKLP
FT                   LLRECRKDIEHYFLKEITKEELLTAKKVIEQLKQNMLTYKGDNDA"
FT   gene            192045..193751
FT                   /locus_tag="SpyM3_0163"
FT   CDS             192045..193751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0163"
FT                   /product="putative ABC transporter, ATP-binding/permease
FT                   protein"
FT                   /note="best non-GAS blastp hit: gb|AAK76137.1| (AE007496)
FT                   ABC transporter, ATP-binding/permease protein
FT                   [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78770"
FT                   /db_xref="GOA:Q8K8Q4"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Q4"
FT                   /protein_id="AAM78770.1"
FT                   /translation="MLKDAILRYKWYALGSFFMVIGVVASSLLQPHYLKSVLSAVIQNN
FT                   QEKIYEVGKPLLIIALLGLMSGAINTVLAAKIAQGVSADMREKTFRKIQDFSYANIEAF
FT                   NAGNLVVRLTNDINQIQSLVMMMFQILFRLPILFIGAFIMAVQTFPQLWWVIVVMVILI
FT                   ALIMGLVMRQMGPRFGKFQRLMDKINRIAKENLRGVRVVKSFVQEQQQYTKFKETSNDL
FT                   LALNLSIGYGFSLMQPALMLVSYLAVYVSINVVSTMVETDPTVIGNIASFMTYMMQIMF
FT                   SIIVVGSMGMQVSRAFVSMARIRQILSTEPAMTFKNEKEETISGSIVFDDVSFTYPNDD
FT                   EPTLKHISFAIEPGQMVGIVGATGSGKSTLVQLIPRLFDPQDGQILLGGKPIKTLSQTT
FT                   LRQSVSIVLQKAILFSGTIADNLRQGSAKADIDAMQKAAQIAQAKEFIDRMDSRYESQV
FT                   EERGSNLSGGQKQRLSIARGVINHPKILILDDSTSALDAKSEKRVQEALSHKLEGTTTV
FT                   IVAQKISSVVKADKILVLDQGQLIGEGTHAELVANNAIYREIYETQKGREE"
FT   gene            193754..195538
FT                   /locus_tag="SpyM3_0164"
FT   CDS             193754..195538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0164"
FT                   /product="putative ABC transporter ATP-binding/membrane
FT                   spanning protein"
FT                   /note="best non-GAS blastp hit: gb|AAL00687.1| (AE008552)
FT                   ABC transporter ATP-binding/membrane spanning protein -
FT                   unknown substrate [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78771"
FT                   /db_xref="GOA:Q8K8Q3"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Q3"
FT                   /protein_id="AAM78771.1"
FT                   /translation="MKTARFFWFYFKRYRFSFTVIAVAVILATYLQVKAPVFLGESLTE
FT                   LGKIGQAYYVAKMSGQTHFSPDLSAFNAVMFKLLMTYFFTVLANLIYSFLLTRVVSHST
FT                   NRMRKGLFGKLERLTVAFFDRHKDGEILSRFTSDLDNIQNSLNQSLVQVVTNIALYIGL
FT                   VWMMFRQDSRLALLTIASTPVALIFLVINIRLARKYTNIQQQEVSALNAFMDETISGQK
FT                   AIIVQGVQEDTVTAFLKHNERVRQATFKRRLFSGQLFPVMNGMSLINTAIVIFVGSTIV
FT                   LSDKSMPAAAALGLVVTFVQYSQQYYQPMMQIASSWGELQLAFTGAHRIQEMFDETEEV
FT                   RPQNAPAFTSLKEAVAINHVDFGYLPGQKALSDVSIVAPKGKMIAVVGPTGSGKTTIMN
FT                   LINRFYDVDAGSITFDGRDIRDYDLDSLRQKVGIVLQESVLFSGTITDNIRFGDQTISQ
FT                   DMVETAARATHIHDFIMSLPKGYNTYVSDDDNVFSTGQKQLISIARTLLTDPEVLILDE
FT                   ATSNVDTVTESKIQRAMEAIVAGRTSFVIAHRLKTILNADHIIVLKDGKVIEQGNHHEL
FT                   LHQKGFYAELYHNQFVFE"
FT   gene            195656..196423
FT                   /locus_tag="SpyM3_0165"
FT   CDS             195656..196423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: b|AAK05465.1|AE006369_1
FT                   (AE006369) conserved hypothetical protein [Lactococcus
FT                   lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78772"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Q2"
FT                   /protein_id="AAM78772.1"
FT                   /translation="MIDLQEILANMNPNQKINYDRVMQQMAKVWAKESVRPSILMHVCC
FT                   APCSTYTLEYLTQFADITVYFANSNIHPKDEYHRRAYVTQQFVSEFNAKTGNTVQFLEA
FT                   DYVPNEYVRQVRGLEEEPEGGDRCRVCFDYRLDKTAQKAVELGFDYFASALTISPHKNS
FT                   QTINDVGIDVQKVYTTKYLPSDFKKNNGYRRSVEMCEEYDIYRQCYCGCVYAAKMQGID
FT                   LVQVKKDAKAFMADKDLDNDFTHIRFSYRGDEM"
FT   gene            196533..196979
FT                   /gene="dut"
FT                   /locus_tag="SpyM3_0166"
FT   CDS             196533..196979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="SpyM3_0166"
FT                   /product="putative dUTPase, phage-associated"
FT                   /note="best blastp match gb|AAK33315.1| (AE006490) putative
FT                   dUTPase, phage-associated [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78773"
FT                   /db_xref="GOA:Q7CFH6"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFH6"
FT                   /protein_id="AAM78773.1"
FT                   /translation="MTKIRGFELVSSFTNPDLLPKRETTHAAGYDLSVAEAVTIAPGEI
FT                   KLVPTGVKAYMQDGEVLYLYDRSSNPRKKGIILINSVGVIDADYYGNEANEGHIFAQMQ
FT                   NITDHPVTLAVGERIVQGVFMPFLIADGDQARGERTGGFGSTGQ"
FT   gene            197060..198421
FT                   /gene="radA"
FT                   /locus_tag="SpyM3_0167"
FT   CDS             197060..198421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="SpyM3_0167"
FT                   /product="putative DNA repair protein"
FT                   /note="best blastp hit: gb|AAK33316.1| (AE006490) putative
FT                   DNA repair protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78774"
FT                   /db_xref="GOA:P0DD78"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD78"
FT                   /protein_id="AAM78774.1"
FT                   /translation="MAKKKATFICQECGYQSPKYLGRCPNCSAWSSFVEEVEVKEVKNA
FT                   RVSLAGEKSRPVKLKDVDNISYHRTQTDMSEFNRVLGGGVVPGSLILIGGDPGIGKSTL
FT                   LLQVSTQLANKGTVLYASGEESAEQIKLRSERLGDIDNEFYLYAETNMQAIRTEIENIK
FT                   PDFLIIDSIQTIMSPDITGVQGSVSQVREVTAELMQLAKTNNIATFIVGHVTKEGTLAG
FT                   PRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFL
FT                   EERLDGATGSAVVVTMEGSRPILAEVQSLVTPTVFGNARRTTTGLDFNRVSLIMAVLEK
FT                   RCGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKEKPTSPQEAFLGEIGLTGEI
FT                   RRVTRIEQRINEAAKLGFTKVYAPKNALQGIDISQGIEVVGVTTVGQVLKAVFS"
FT   gene            198610..199107
FT                   /locus_tag="SpyM3_0168"
FT   CDS             198610..199107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74215.1| (AE007320)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78775"
FT                   /db_xref="GOA:Q8K8Q0"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8Q0"
FT                   /protein_id="AAM78775.1"
FT                   /translation="MSYFEHFMAANQAYVALHGTAHLPLKPKTKVAIVTCMDSRLHVAQ
FT                   ALGLALGDAHILRNAGGRVTEDMIRSLVISQQQMGTREIVVLHHTDCGAQTFTNEGFAK
FT                   HIHEHLGVDVSGQDFLPFQDVEDSVRKDMAKLRASSLIPDDVVINGAVYDVATGKMTQV
FT                   ME"
FT   gene            199238..199948
FT                   /locus_tag="SpyM3_0169"
FT   CDS             199238..199948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: b|AAK04684.1|AE006292_4
FT                   (AE006292) conserved hypothetical protein [Lactococcus
FT                   lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78776"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVV8"
FT                   /protein_id="AAM78776.1"
FT                   /translation="MVDNRMRFTIDQNMQFPLVEIDLEHGGSVYLQQGSMVYHTENVTL
FT                   NTKLNGKGSGLGKLVGAIGRSMVSGESMFITQAMSNGDGKLALAPNTPGQIVALELGEK
FT                   QYRLNDGAFLALDGSAQYKMERQNIGKALFGGQGGLFVMTTEGLGTLLANSFGSIKKIT
FT                   LDGGTMTIDNAHVVAWSRELDYDIHLENGFMQSIGTGEGVVNTFRGHGEIYIQSLNLEQ
FT                   FAGTLKRYLPTSSN"
FT   gene            200131..201576
FT                   /gene="gluS"
FT                   /locus_tag="SpyM3_0170"
FT   CDS             200131..201576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gluS"
FT                   /locus_tag="SpyM3_0170"
FT                   /product="putative glutamyl-tRNA synthetase"
FT                   /note="best blastp hit: gb|AAK33319.1| (AE006491) putative
FT                   glutamyl-tRNA synthetase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78777"
FT                   /db_xref="GOA:P0DG34"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG34"
FT                   /protein_id="AAM78777.1"
FT                   /translation="MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARRHGGTFIIRIED
FT                   TDRKRHVEDGERSQLENLKWLGMDWDESPETHENYRQSERLALYQQYIDQLLAEGKAYK
FT                   SYVTEEELAAERERQEAAGETPRYINEFIGMSADEKAKYIAEREAAGIVPTVRLAVNES
FT                   GIYKWADMVKGDIEFEGGNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIA
FT                   NTPKQLMVYEALGWEAPEFGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVF
FT                   NFIALLGWNPGGEEEIFSREQLIALFDENRLSKSPAAFDQKKMDWMSNEYLKHADFETV
FT                   YALCKPFLEEAGRLTEKAEKLVELYKPQLKSADEIIPLTDLFFSDFPELTEAEKEVMAG
FT                   ETVSTVLQAFKAKLEAMSDEDFKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHG
FT                   PELPNTIYLLGRDKSIEHIKNML"
FT   gene            201971..203317
FT                   /locus_tag="SpyM3_0171"
FT   CDS             201971..203317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0171"
FT                   /product="putative histidine kinase"
FT                   /note="best blastp hit: gb|AAK33320.1| (AE006491) putative
FT                   histidine kinase, possibly involved in competence
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78778"
FT                   /db_xref="GOA:Q8K8P8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8P8"
FT                   /protein_id="AAM78778.1"
FT                   /translation="MANSEYMFLLLSIIVYYMTKIYIFSFLSDITLPVWKQLTILALAL
FT                   FFNQFPYLSPLLIDPLLFLVVLRQETKQLFSLKALFLAVAPSVLVDLLSRFMGTIVIPY
FT                   LFLSSGIYLGHIIFDLLAYLLIFPSFAIINYMIGKDYKMICQSGYSKRSHNFYQTLLIF
FT                   VLVYYVDIFVILGFTDPFLHFHHSLFVPTPYKLLFLMFILLLVYLLSYFNHSSKEYLKN
FT                   ELRREQQAYMTNLETYGKHLEKLYRDVRAFQSDYLSRIERLGQAIKSESITQIQDIYAQ
FT                   TVHEANDYWDDKHYNISKLRKINISSIKSLLSAKIISAEKSGIDLNVEVPDNIKETYIP
FT                   ELDLLLLMSIFCDNAIEAALEAQQPHMSIAYFLLDDYQMFVVTNTTKKKVDINKIFEEG
FT                   YSSKGSERGIGLSNAQRILKKYPYLSLRTKSFDKEFSQTLTMPKEEVDR"
FT   gene            203314..203892
FT                   /locus_tag="SpyM3_0172"
FT   CDS             203314..203892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0172"
FT                   /product="putative histidine kinase"
FT                   /note="best blastp match gb|AAK33321.1| (AE006491) putative
FT                   histidine kinase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78779"
FT                   /db_xref="GOA:Q8K8P7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8P7"
FT                   /protein_id="AAM78779.1"
FT                   /translation="MMVIYSMALFYATIFINSWVIFAKVSAIKLSWKRVSVIGISFVIA
FT                   NMIFDKVILIDQLFFIIVSLLSAPKKKLFEHMFNGFFTILIVELLFRVIGSFFLPAVLG
FT                   FSIGQINNNLKLLELCYLFVLPIFYLFSYIFSIDLSLIRFISEDKMKKWVFWMNTAMFS
FT                   YYFFAHFLVTVQSGFLALYFQYRSILVFI"
FT   gene            203913..204593
FT                   /locus_tag="SpyM3_0173"
FT   CDS             203913..204593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0173"
FT                   /product="putative histidine kinase"
FT                   /note="best blastp match gb|AAK33321.1| (AE006491) putative
FT                   histidine kinase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78780"
FT                   /db_xref="GOA:Q8K8P6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8P6"
FT                   /protein_id="AAM78780.1"
FT                   /translation="MKLDRFAKDQLSQKLTQAQNERIAYLENYNQSIEQLYREIRTVKH
FT                   DSENILISLKDSIDSGDIDLITRVYDTVIQQSATSMMRTNYEISSLDNIKEAVIRSIMN
FT                   SKLLEAQYLGIELYIEIPDVIDHLPIKLIDLIVLFTGLVDNAIETAKGSRRPFLSIAYF
FT                   KQDNKQLFIIENSTKTNRVDIAKRFDAQQQNSAHFLTVLDSYPQITLSTKSDHYRLRQL
FT                   LEMR"
FT   gene            204597..205337
FT                   /locus_tag="SpyM3_0174"
FT   CDS             204597..205337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0174"
FT                   /product="putative response regulator"
FT                   /note="best blastp match gb|AAK33322.1| (AE006491) putative
FT                   response regulator [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78781"
FT                   /db_xref="GOA:Q7CFH4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFH4"
FT                   /protein_id="AAM78781.1"
FT                   /translation="MMNIFILEDDFIQQTRIESIVVGILKETRIPCNQLEVFSTPQKLF
FT                   ESIQERGDHQLYFLDIEIGEYTRCGLELAAAIRQKDPNAVIVFVTTHSEFAPISFKYKV
FT                   SALDFIDKAGGQKQFKEQIEECIRYTYDMMSSRESKDMFLFETPQTRLKLPYKDILYFA
FT                   TATTPHKVCLWTQTERLEFYGNLSEIQAVAPKLFLCHRSYLVNLDKVVRIDKSKQLLYF
FT                   ENGDSCMVSRLKMKCLFERWEALR"
FT   gene            205877..206236
FT                   /gene="rnpA"
FT                   /locus_tag="SpyM3_0175"
FT   CDS             205877..206236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="SpyM3_0175"
FT                   /product="putative ribonuclease P protein component"
FT                   /note="best blastp match gb|AAK33323.1| (AE006491) putative
FT                   ribonuclease P protein component [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78782"
FT                   /db_xref="GOA:P0DF24"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF24"
FT                   /protein_id="AAM78782.1"
FT                   /translation="MKKTYRVKREKDFQAIFKDGKSTANRKFVIYHLNRGQDHFRVGIS
FT                   VGKKIGNAVTRNAVKRKIRHVIMALGHQLKSEDFVVIARKGVESLEYQELQQNLHHVLK
FT                   LAQLLEKGFESEEKH"
FT   gene            206202..207029
FT                   /locus_tag="SpyM3_0176"
FT   CDS             206202..207029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK76106.1| (AE007493)
FT                   SpoIIIJ family protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78783"
FT                   /db_xref="GOA:P0DC86"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC86"
FT                   /protein_id="AAM78783.1"
FT                   /translation="MRKVLRVKKNIKIARIVPLVLLLVACGRGEVTAQSSSGWDQLVYL
FT                   FARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSSQKMQDIQPELRELQRKYAG
FT                   KDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIALFQALTRVSFLKTGTFLWV
FT                   ELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIYVMPLMIFFMGFNLASGV
FT                   VLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRERRARKKAMKRK"
FT   gene            207041..207955
FT                   /locus_tag="SpyM3_0177"
FT   CDS             207041..207955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK76105.1| (AE007493)
FT                   jag protein, putative [Streptococcus pneumoniae TIGR4], and
FT                   gb|AAL00654.1| (AE008549) hypothetical protein
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78784"
FT                   /db_xref="GOA:Q8K8P5"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8P5"
FT                   /protein_id="AAM78784.1"
FT                   /translation="MVLFTGKTVEEAIETGLQELGLPRLKAHIKVISKEKKGFLGFGKK
FT                   PAQVDIEGISDKTVYKADKKATRGVPEDINRQNAPAVNSADVEPEEIKATQRLEAEDTK
FT                   VVPLMSEDSPAQIPSNLAETVTETKAQQPSIPVEESEVPQDAGNDGFSKDIEKAAQEVS
FT                   DYVTKIIYEMDIEATVETSNNRRQINLQIETPEAGRVIGYHGKVLKSLQLLAQNFLHDR
FT                   YSKNFSVSLNVHDYVEHRTETLIDFTQKVAKRVLESGQDYTMDPMSNSERKIVHKTVSS
FT                   IEGVDSYSEGNDPNRYVVVSLQR"
FT   gene            208270..208404
FT                   /gene="rpmH"
FT                   /locus_tag="SpyM3_0178"
FT   CDS             208270..208404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="SpyM3_0178"
FT                   /product="50S ribosomal protein L34"
FT                   /note="best blastp hit: gb|AAK33326.1| (AE006491) 50S
FT                   ribosomal protein L34 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78785"
FT                   /db_xref="GOA:P0DE46"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE46"
FT                   /protein_id="AAM78785.1"
FT                   /translation="MKRTYQPSKIRRQRKHGFRHRMSTKNGRRVLAARRRKGRKVLSA"
FT   gene            208678..209382
FT                   /locus_tag="SpyM3_0179"
FT   CDS             208678..209382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0179"
FT                   /product="putative N-acetylmannosamine-6-P"
FT                   /note="best blastp hit: gb|AAK33327.1| (AE006492) putative
FT                   N-acetylmannosamine-6-P epimerase [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78786"
FT                   /db_xref="GOA:P0DC68"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC68"
FT                   /protein_id="AAM78786.1"
FT                   /translation="MPDKPTKEKLMEQLKGGIIVSCQALPGEPLYSETGGIMPLLAKAA
FT                   QEAGAVGIRANSVRDIKEIQAITDLPIIGIIKKDYPPQEPFITATMAEVDQLAALNIAV
FT                   IAMDCTKRDRHDGLDIASFIRQVKEKYPNQLLMADISTFDEGLVAHQAGIDFVGTTLSG
FT                   YTPYSRQEAGPDVALIEALCKAGIAVIAEGKIHSPEEAKKINDLGVAGIVVGGAITRPK
FT                   EIAERFIEALKS"
FT   gene            209431..210489
FT                   /locus_tag="SpyM3_0180"
FT   CDS             209431..210489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0180"
FT                   /product="putative sugar transporter sugar binding
FT                   lipoprotein"
FT                   /note="best blastp hit: gb|AAK33328.1| (AE006492) putative
FT                   sugar transporter sugar binding lipoprotein [Streptococcus
FT                   pyogenes M1 GAS]; possible pseudogene aligns with
FT                   N-terminal portion (amino acids 1-352)"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78787"
FT                   /db_xref="GOA:F7IUG7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:F7IUG7"
FT                   /protein_id="AAM78787.1"
FT                   /translation="MNMKKLASLVMLGASVLGLAACGGKSQKEAGASKSDTAKTEITWW
FT                   AFPVFTQEKAEDGVGTYEKKLIAAFEKANPEIKVKLETIDFTSGPEKITTAIEAGTAPD
FT                   VLFDAPGRIIQYGKNGKLADLNDLFTKEFTKDVNNDKLIQASKAGDTAYMYPISSAPFY
FT                   MALNKKMFKDAGVLDLVKEGWTTDDFEKVLKALKDKGYNPGSFFANGQGGDQGPRAFFA
FT                   NLYSSHITDDKVTKYTTDDANSIKAMTKISNWIKDGLMMNGSQYDGSADIQNFANGQTS
FT                   FTILWAPAQPGIQAKLLEASKVDYLEIPFPSDDGKPELEYLVNGFAVFNNKDEQKVAAS
FT                   KTFIQFIADDKE"
FT   gene            210565..210750
FT                   /locus_tag="SpyM3_0181"
FT   CDS             210565..210750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0181"
FT                   /product="putative sugar transporter sugar binding
FT                   lipoprotein"
FT                   /note="best blastp hit: gb|AAK33328.1| (AE006492) putative
FT                   sugar transporter sugar binding lipoprotein [Streptococcus
FT                   pyogenes M1 GAS]; possible pseudogene aligns with
FT                   C-terminal portion (amino acids 379-439)"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78788"
FT                   /db_xref="GOA:F7ITT9"
FT                   /db_xref="UniProtKB/TrEMBL:F7ITT9"
FT                   /protein_id="AAM78788.1"
FT                   /translation="MEKIAEWTKFYSPYYNTIDGFAEMRTLWFPMVQAISNGDEKPEDA
FT                   LKAFTEKANKTIKKTQ"
FT   gene            210875..211741
FT                   /locus_tag="SpyM3_0182"
FT   CDS             210875..211741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0182"
FT                   /product="putative sugar transport system (permease)"
FT                   /note="best blastp hit: gb|AAK33329.1| (AE006492) sugar
FT                   transport system (permease) [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78789"
FT                   /db_xref="GOA:Q8K8P3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8P3"
FT                   /protein_id="AAM78789.1"
FT                   /translation="MRETLISYAFLAPVLVFFVIFVLIPMIMGFVTSFFNYSMTDFTFV
FT                   GFANYARMFQDPIFMKSLMNTLIIVIGSVPVVVFFSLFVAAKTYDKNVVARSFYRAVFF
FT                   LPVVTGSVAVTVVWKWIYDPMSGILNYVLKYAHVIEQNISWLGDKHWALLAIIAILLTT
FT                   SVGQPIILYIAAMGNIDNSLMEAARVDGATEFQVFWNIKWPSLLPTTLYIAVITTINSF
FT                   QCFALIQLLTSGGPNYSTSTLMYYLYEKAFKLSEYGYANTMGVFLAVMIAIISFAQFKI
FT                   LGNDVEY"
FT   gene            211754..212584
FT                   /locus_tag="SpyM3_0183"
FT   CDS             211754..212584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0183"
FT                   /product="putative sugar transport protein (permease)"
FT                   /note="best blastp hit: gb|AAK33330.1| (AE006492) probable
FT                   sugar transport protein (permease) [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78790"
FT                   /db_xref="GOA:Q8K8P2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8P2"
FT                   /protein_id="AAM78790.1"
FT                   /translation="MKKKKLTASDVLTTVILCILTILFIFPFYWIMTGAFKAQADTIMI
FT                   PPQWWPKAPTIENFKALVIQNPALKWLWNSVFISVVTMFLVCGTSSLAGYALAKKRFYG
FT                   QRILFSIFIAAMALPKQVVLVPLVRIVNFMGIHDTLAAVILPLVGWPFGVFLMKQFSEN
FT                   IPTELLESAKIDGCGEIRTFFNVAFPIVKPGFAALAIFTFINTWNDYFMQLVMLTSREN
FT                   LTISLGVATMQAEMATNYGLIMAGAAMAAVPIVTVFLVFQKSFTQGITMGAVKG"
FT   gene            212741..213403
FT                   /locus_tag="SpyM3_0184"
FT   CDS             212741..213403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75756.1| (AE007460)
FT                   hypothetical protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78791"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8P1"
FT                   /protein_id="AAM78791.1"
FT                   /translation="MTSKKQGLLHSLFKLDSKWMRASAALFDLLVFNLLFVLSCLPLLT
FT                   IGVAKMALYASLLDWREGQVSQLFTTYSSYFKHYFKRGMRLGLIELLIMSICVLDLFLI
FT                   RNQSGLVFQGFKVLCIAVLFLVVILFLYAYPQAVRKELPLLILFKRSLLLAGIFFPWTF
FT                   AFLVVIGLLVFTLPLTLLTLFGGVSLLAIIGISSLTYLYLIIMESLLRRFPLNNDIE"
FT   gene            213415..214329
FT                   /gene="nanH"
FT                   /locus_tag="SpyM3_0185"
FT   CDS             213415..214329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nanH"
FT                   /locus_tag="SpyM3_0185"
FT                   /product="putative acylneuraminate lyase"
FT                   /note="best blastp hit: gb|AAK33332.1| (AE006492) putative
FT                   acylneuraminate lyase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78792"
FT                   /db_xref="GOA:Q8K8P0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8P0"
FT                   /protein_id="AAM78792.1"
FT                   /translation="MTDLTKYQGIIPAFYACYDDQGAISPERVRALTQYYIDKGVQGLY
FT                   INGSSGECIYQSVFDRQLVLENVMAVAKGKLTIINHVACNNTKDSIELAAHSERLGVDA
FT                   IAAIPPIYFRLPEYAVADYWNAISSAAPHTDFIIYNIPQLAGVALTPSLYKTMLANKRV
FT                   IGVKNSSMPVQGIQTFCAIGGDDHIVFNGPDEQFLGGRLMGAAAGIGGTYGAMPELFLR
FT                   LNQLIVDKDLEKAKALQYTINEIIGVLVSAHGNMYGVIKEVLRINEGLDIGSVRSPLAE
FT                   LVEEDRVICQRAAALINQAKETF"
FT   gene            214351..215289
FT                   /locus_tag="SpyM3_0186"
FT   CDS             214351..215289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0186"
FT                   /product="putative glucose kinase"
FT                   /note="best blastp match gb|AAK33333.1| (AE006492) putative
FT                   glucose kinase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78793"
FT                   /db_xref="GOA:F7IW84"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:F7IW84"
FT                   /protein_id="AAM78793.1"
FT                   /translation="MKHYLAIDIGGTAIKYGLISETGDLLEKEEMATEAYKGGPSILEK
FT                   VKGLVKTYQDQMDLAGVAISSAGMVNPDEGEIFYAGPQIPNYAGTQFKKEIEETFGLPC
FT                   EVENDVNCAGLAEAISGSAKDYPVALCLTIGTGIGGCLLFNSQVFHGSSHSACEVGYLH
FT                   LSDGQFQDLASTTALVQEVALAYGDDISQWDGRRIFEQAKAGDAICIAAISKQVDYLGQ
FT                   GIANICYVVNPNVVVLGGGIMAQKDYLADKLKTALDSYLVSSLAKKTQLKFASHGNNAG
FT                   ILGAYYHFKQKNERSCSFITLEKIENNLASS"
FT   gene            complement(215400..216230)
FT                   /locus_tag="SpyM3_0187"
FT   CDS             complement(215400..216230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0187"
FT                   /product="putative phosphosugar-binding transcriptional
FT                   regulator"
FT                   /note="best non-GAS blastp hit: gb|AAK75753.1| (AE007460)
FT                   phosphosugar-binding transcriptional regulator, putative
FT                   [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78794"
FT                   /db_xref="GOA:Q8K8N9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8N9"
FT                   /protein_id="AAM78794.1"
FT                   /translation="MPKNHRLITKIEASLEHMTSLEKGIAHFFITTDLTPQELTASEIV
FT                   KRLHISQAALTRFAKKCGFTGYRAFAFDYLHSLQESQETFQSIHLELTKRVLMDYDALI
FT                   NKTYELVNEEKLLNLAKLIDASERVYFFGKGSSGLVAREMKLRFMRLGLICDAYSDTDG
FT                   FTWANSLVNENCLVFGFSLSGKTNSVITALHQASQRGAKTVLLTTDNQTEFDDSLDIIP
FT                   VSSTHQLHYGNRVSPQFPLLIMMDIIYAYVLAIDKPHKEKIFKNTIIDKENNGL"
FT   gene            216419..217306
FT                   /locus_tag="SpyM3_0188"
FT   CDS             216419..217306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK76058.1| (AE007488)
FT                   hydrolase, putative [Streptococcus pneumoniae TIGR4], and
FT                   gb|AAL00608.1| (AE008544) Conserved hypothetical protein
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78795"
FT                   /db_xref="GOA:Q8K8N8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8N8"
FT                   /protein_id="AAM78795.1"
FT                   /translation="MSASKGFYDQPKRQKFSPSFLMWLRSLCYNNIMTNKVEKLTIFDT
FT                   HTHLNVAEFQGHETEELTLAQEMGVAYHNVVGFDQATISGALALADQYPNVYATIGWHP
FT                   TEAGSYSEAVEESIVSQLSHPKVIALGEIGLDYYWMEDPKEVQIEVFKRQMQLAKDHDL
FT                   PFVVHTRDALEDTYEVIKAAGVGPRGGIMHSYSGSLEMAERFIELGMMISFSGVVTFKK
FT                   ALDIQEAAQHLPLDKILVETDAPYLTPVPKRGKQNHTAYTRYVVDKIAELRGMTVEEVA
FT                   KETTANAKRVFKLD"
FT   gene            217278..217868
FT                   /locus_tag="SpyM3_0189"
FT   CDS             217278..217868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK76057.1| (AE007488)
FT                   primase-related protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78796"
FT                   /db_xref="GOA:Q8K8N7"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8N7"
FT                   /protein_id="AAM78796.1"
FT                   /translation="MQRGYLSLTEKINIQEVLVVEGKDDTANLRRFYEVDTYETRGSAI
FT                   TEEDLERINRLNDLRGVIVLTDPDYNGERIRKLIMAAVPTARHAFLNRNEAVPSSKSKG
FT                   RSLGVEHANFEDLQKALAHVTQQYDDESYFDIRQTDLIRLGLLMASDSRKRREYLGEKL
FT                   RIGYANGKQLLKRLELFGITLAEVEEVMETYEE"
FT   gene            217982..218854
FT                   /gene="ksgA"
FT                   /locus_tag="SpyM3_0190"
FT   CDS             217982..218854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="SpyM3_0190"
FT                   /product="putative dimethyladenosine transferase"
FT                   /note="best blastp hit: gb|AAK33337.1| (AE006492) putative
FT                   dimethyladenosine transferase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78797"
FT                   /db_xref="GOA:P0DF12"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF12"
FT                   /protein_id="AAM78797.1"
FT                   /translation="MRIADYSVTKAVLDRHGFTFKKSFGQNFLTDTNILQKIVDTAEID
FT                   QNVNVIEIGPGIGALTEFLAENAAEVMAFEIDDRLVPILADTLRDFDNVQVVNQDILKA
FT                   DLQTQIKQFKNPDLPIKVVANLPYYITTPILMHLIESKIPFQEFVVMMQREVADRISAE
FT                   PNTKAYGSLSIAVQYYMTAKVAFIVPRTVFVPAPNVDSAILKMMRRDQPLIEVKDEDFF
FT                   FRVSRLSFVHRRKTLWNNLTSHFGKSEDIKAKLEKGLALADIKSSIRGEALSIQDFGKL
FT                   ADALKEVGL"
FT   gene            219405..220151
FT                   /locus_tag="SpyM3_0191"
FT   CDS             219405..220151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK76051.1| (AE007487)
FT                   conserved hypothetical protein TIGR00157 [Streptococcus
FT                   pneumoniae TIGR4], and gb|AAL00601.1| (AE008544) Conserved
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78798"
FT                   /db_xref="GOA:P0DF42"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF42"
FT                   /protein_id="AAM78798.1"
FT                   /translation="MDFSAEDNSEGYILAIYPRKNSLVRPPIVNIDQAVVIMSAKEPEF
FT                   NSNLLDRFLILLEHKAIHPVVYISKMDLLDSPEEIKAIGRQYQAIGYDFVTSLEELLPL
FT                   LADKITVFMGQTGVGKSTLLNRIAPELALETGEISDSLGRGRHTTRAVSFYNTHGGKIA
FT                   DTPGFSSLDYDIANAEDLNEAFPELRRLSHECKFRSCTHTHEPKCAVKAALETGELWPV
FT                   RYEHYLQFLSEIENRRETYKKVIKRK"
FT   gene            220161..220823
FT                   /gene="rpe"
FT                   /locus_tag="SpyM3_0192"
FT   CDS             220161..220823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="SpyM3_0192"
FT                   /product="putative ribulose-phosphate 3-epimerase"
FT                   /note="best blastp hit: gb|AAK33339.1| (AE006493) putative
FT                   ribulose-phosphate 3-epimerase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78799"
FT                   /db_xref="GOA:Q8K8N4"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8N4"
FT                   /protein_id="AAM78799.1"
FT                   /translation="MSTLKIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPN
FT                   ISFGADVVASMRKHSKLVFDCHLMVVDPERYVEAFAQAGADIMTIHTESTRHIHGALQK
FT                   IKAAGMKAGVVINPGTPATALEPLLDLVDQVLIMTVNPGFGGQAFIPECLEKVATVAKW
FT                   RDEKGLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLFKASDLVSQVQTLRTALHD"
FT   gene            220816..221448
FT                   /locus_tag="SpyM3_0193"
FT   CDS             220816..221448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK76049.1| (AE007487)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78800"
FT                   /db_xref="GOA:Q8K8N3"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8N3"
FT                   /protein_id="AAM78800.1"
FT                   /translation="MTKVALFSGGDLSYFTREFDYFVGIDSGSLFLLENGLPLNMAVGD
FT                   FDSVSQEAFTDIKEKAELFITAHPEKNDTDTELALKEVFARFPEAEVTIFGAFGGRMDH
FT                   LLSNIFLPSDPGIAPFMAQIALRDQQNMITYRPAGQHLIHQEEGMTYVAFMAEGEADLT
FT                   ITGAKFELTQDNFFKKKIYSSNAFIHQPITVSLPSGYLIIIQSKDWS"
FT   gene            221450..222721
FT                   /locus_tag="SpyM3_0194"
FT   CDS             221450..222721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK76048.1| (AE007487)
FT                   competence-induced protein Ccs50 [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78801"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8N2"
FT                   /protein_id="AAM78801.1"
FT                   /translation="MDLILFLLVLVLLGLGAYLLFKVNGLQHQLAQTLEGNADNLSDQM
FT                   TYQLDTANKQQLLELTQLMNRQQADLYQQLTDIRDVLHRSLSDSRDRSDKRLEKINQQV
FT                   NQSLKNMQESNEKRLEEMRQIVEEKLEETLKNRLHASFDSVSKQLESVNKGLGEMRSVA
FT                   QDVGTLNKVLSNTKTRGILGELQLGQIIEDIMTSSQYEREFVTVSGSSERVEYAIKLPG
FT                   NGQGGYIYLPIDSKFPLEDYYRLEDAYEVGDKLAIEASRKALLAAIKRFAKDIHKKYLN
FT                   PPETTNFGVMFLPTEGLYSEVVRNAAFFDSLRREENIVVAGPSTLSALLNSLSVGFKTL
FT                   NIQKNADDISKILGNVKLEFDKFGGLLAKAQKQMNTANNTLDQLISTRTNAIVRALNTV
FT                   ETYQDQATKSLLNMPLLEEENNEN"
FT   gene            222711..223649
FT                   /gene="cbf"
FT                   /locus_tag="SpyM3_0195"
FT   CDS             222711..223649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbf"
FT                   /locus_tag="SpyM3_0195"
FT                   /product="putative CMP-binding factor"
FT                   /note="best blastp hit: gb|AAK33342.1| (AE006493) putative
FT                   CMP-binding factor [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78802"
FT                   /db_xref="GOA:Q8K8N1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8N1"
FT                   /protein_id="AAM78802.1"
FT                   /translation="MKINQMKKDQLFEGFYLIKSAEVRKTRAGKDFISLTFQDDTGEIS
FT                   GNLWDAQPYNVEEFTAGKVVFMKGRREVYNGTPQVNQITLRNVRPGEPNDPKDFKEKAP
FT                   VSVEEVRDYLEQMLFKIENATWQRIVRALYRKYDKEFYTYPAAKTNHHAFESGLAYHTA
FT                   TMVRLADSIGDIYPDLNKSLLFAGIMLHDLAKVIELTGPDNTEYTVRGNLIGHISLINE
FT                   EITKVISELQIDDTKEEVIVLRHVILSHHGQLEYGSPVRPRIMEAEIIHMIDNIDANMM
FT                   MMTTALSRVSEGEMTNRIFAMDNRSFYKPNY"
FT   gene            223916..224755
FT                   /gene="purR"
FT                   /locus_tag="SpyM3_0196"
FT   CDS             223916..224755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="SpyM3_0196"
FT                   /product="putative purine operon repressor"
FT                   /note="best blastp hit: gb|AAK33343.1| (AE006493) putative
FT                   purine operon repressor [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78803"
FT                   /db_xref="GOA:Q7CFH0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFH0"
FT                   /protein_id="AAM78803.1"
FT                   /translation="MKLRRSERMVVISNYLINNPYKLTSLNTFATKYEAAKSSISEDIA
FT                   IIKKAFEEANIGDIDTLTGASGGVIFTPSISETEARTIVEDLCQRLSESDRILPGGYIY
FT                   LSDLLSTPKILQNIGRIIANAFKGEKIDAVMTVATKGVPLANAVANILSVPFVIVRRDL
FT                   KITEGSTVSVNYASASSDRIEKMFLSKRSLKPNSRVLIVDDFLKGGGTITGMISLLTEF
FT                   DSTLVGVAVFAENAQSEREQMTFKSLLKVSEIDVKNNNVVVEVGNIFDKWKKEREWT"
FT   gene            224746..227367
FT                   /gene="prgA"
FT                   /locus_tag="SpyM3_0197"
FT   CDS             224746..227367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prgA"
FT                   /locus_tag="SpyM3_0197"
FT                   /product="putative surface exclusion protein"
FT                   /note="best non-GAS blastp hit: pir||G41662 130K surface
FT                   exclusion protein Sec10 precursor - Enterococcus faecalis
FT                   plasmid pCF10 >gi|150554|gb|AAA65847.1| (M64978) surface
FT                   exclusion protein [Plasmid pCF10]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78804"
FT                   /db_xref="InterPro:IPR027607"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8N0"
FT                   /protein_id="AAM78804.1"
FT                   /translation="MDLEQTKPNQVKQKIALTSTIALLSASVGVSHQVKADDRASGETK
FT                   ASNTHDDSLPKPETIQEAKATIDAVEKTLSQQKAELTELATALTKTTAEINHLKEQQDN
FT                   EQKALTSAQEIYTNTLASSEETLLAQGAEHQRELTATETELHNAQVDQHSKETALSEQK
FT                   ASISAETTRAQDLVEQVKTSEQNIAKLNAMISNPDAITKAAQTANDNTKALSSELEKAK
FT                   ADLENQKAKVKKQLTEELAAQKAALAEKEAELSRLKSSAPSTQDSIVGNNTMKAPQGYP
FT                   LEELKKLEASGYIGSASYNNYYKEHADQIIAKASPGNQLNQYQDIPADRNRFVDPDNLT
FT                   PEVQNELAQFAAHMINSVRRQLGLPPVTVTAGSQEFARLLSTSYKKTHGNTRPSFVYGQ
FT                   PGVSGHYGVGPHDKTIIEDSAGASGLIRNDDNMYENIGAFNDVHTVNGIKRGIYDSIKY
FT                   MLFTDHLHGNTYGHAINFLRVDKHNPNAPVYLGFSTSNVGSLNEHFVMFPESNIANHQR
FT                   FNKTPIKAVGSTKDYAQRVGTVSDTIAAIKGKVSSLENRLSAIHQEADIMAAQAKVSQL
FT                   QGKLASTLKQSDSLNLQVRQLNDTKGSLRTELLVAKAKQAQLEATRDQSLAKLASLKAA
FT                   MHQTKALAEQAAARVTALVAKKAHLQYLRDFKLNPNRLQVIRERIDNTKQDLAKTTSSL
FT                   LNAQEALAALQAKQSSLEATIATTEHQLTLLKTLANEKEYRHLDEDIATVPDLQVAPSL
FT                   TGVKPLSYSKVETTPLVQEMVKETKQLLEASARLAAENTSLVAEALVGQTSEMVASNAI
FT                   VSKITSSITQPSSKTSYGSGSSTTSNLISDVDESTQRALKAGVVMLAAVGLTGFRFRKE
FT                   SR"
FT   gene            227575..227988
FT                   /gene="rpsL"
FT                   /locus_tag="SpyM3_0198"
FT   CDS             227575..227988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SpyM3_0198"
FT                   /product="30S ribosomal protein S12"
FT                   /note="best blastp hit: sp|P58172|RS12_STRPY 30S RIBOSOMAL
FT                   PROTEIN S12"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78805"
FT                   /db_xref="GOA:P0DE66"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE66"
FT                   /protein_id="AAM78805.1"
FT                   /translation="MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG"
FT   gene            228009..228479
FT                   /gene="rpsG"
FT                   /locus_tag="SpyM3_0199"
FT   CDS             228009..228479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SpyM3_0199"
FT                   /product="30S ribosomal protein S7"
FT                   /note="best blastp hit: gb|AAK33346.1| (AE006493) 30S
FT                   ribosomal protein S7 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78806"
FT                   /db_xref="GOA:P0DE98"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE98"
FT                   /protein_id="AAM78806.1"
FT                   /translation="MSRKNQAPKREVLPDPLYNSKIVTRLINRVMLDGKRGTAATIVYD
FT                   AFSAIKEATGNDALEVFETAMDNIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VNASRARGEHTMKDRLAKEIMDAANNTGASVKKREDTHKMAEANRAFAHFRW"
FT   gene            228964..231042
FT                   /gene="fusA"
FT                   /locus_tag="SpyM3_0200"
FT   CDS             228964..231042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="SpyM3_0200"
FT                   /product="elongation factor G"
FT                   /note="best blastp hit: sp|P82477|EFG_STRPY ELONGATION
FT                   FACTOR G (EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78807"
FT                   /db_xref="GOA:P0DA84"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA84"
FT                   /protein_id="AAM78807.1"
FT                   /translation="MAREFSLAKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWDGHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVQTLHDRLQANAHPIQ
FT                   LPIGAEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPEEYLEQAQEYREKLIEAVAETD
FT                   EDLMMKYLEGEEITNDELIAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIAYLPSP
FT                   LDIPAIKGVNPDTDAEEERPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYV
FT                   MNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKVILES
FT                   IEVPEPVIQLMVEPKSKADQDKMGVALQKLAEEDPTFRVETNVETGETVIAGMGELHLD
FT                   VLVDRMKREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLIESMANGVLAGYPMVDVKAKLYDGSYHDVDSS
FT                   ETAFKIAASLALKEAAKSAQPAILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEAH
FT                   GNSQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGE"
FT   gene            231383..232393
FT                   /gene="plr"
FT                   /locus_tag="SpyM3_0201"
FT   CDS             231383..232393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plr"
FT                   /locus_tag="SpyM3_0201"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, plasmin
FT                   receptor"
FT                   /note="best blastp hit: sp|P50467|G3P_STRPY GLYCERALDEHYDE
FT                   3-PHOSPHATE DEHYDROGENASE (GAPDH) (PLASMINOGEN-BINDING
FT                   PROTEIN) (PLASMIN RECEPTOR)"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78808"
FT                   /db_xref="GOA:P0DB18"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DB18"
FT                   /protein_id="AAM78808.1"
FT                   /translation="MVVKVGINGFGRIGRLAFRRIQNIEGVEVTRINDLTDPNMLAHLL
FT                   KYDTTQGRFDGTVEVKEGGFEVNGNFIKVSAERDPENIDWATDGVEIVLEATGFFAKKE
FT                   AAEKHLHTNGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKA
FT                   LHDAFGIQKGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVI
FT                   PELNGKLDGAAQRVPVPTGSVTELVVTLDKNVSVDEINAAMKAASNDSFGYTEDPIVSS
FT                   DIVGVSYGSLFDATQTKVMEVDGSQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK"
FT   gene            complement(232877..233617)
FT                   /locus_tag="SpyM3_0202"
FT   CDS             complement(232877..233617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0202"
FT                   /product="putative amino acid ABC transporter (ATP-binding
FT                   protein)"
FT                   /note="best non-GAS blastp hit:gb|AAK74613.1| (AE007356)
FT                   amino acid ABC transporter, ATP-binding protein
FT                   [Streptococcus pneumoniae TIGR4], and gb|AAK99212.1|
FT                   (AE008420) ABC transporter ATP-binding protein - glutamine
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78809"
FT                   /db_xref="GOA:Q8K8M8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8M8"
FT                   /protein_id="AAM78809.1"
FT                   /translation="MSNSIIEIKNLKKSYGSNEVLKDISLSVNKGEVISIIGSSGSGKS
FT                   TLLRSINLLEEPSAGQILFHGEDVLAEHYNLTHYREKLGMVFQSFNLFENLNVLENAIV
FT                   AQTTVLKRDRAQAEQIAKENLNAVGMTEQYWQAKPKQLSGGQKQRVAIARALSVNPEAM
FT                   LFDEPTSALDPEMVGEVLKTMQDLAKSGLTMIIVTHEMEFARDVSDRIIFMDKGLIAEE
FT                   GSSQQIFENPTQDRTKEFLQRFLK"
FT   gene            complement(233610..235178)
FT                   /locus_tag="SpyM3_0203"
FT   CDS             complement(233610..235178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0203"
FT                   /product="putative glutamine-binding periplasmic protein"
FT                   /note="best blastp hit: gb|AAK33350.1| (AE006494) putative
FT                   glutamine-binding periplasmic protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78810"
FT                   /db_xref="GOA:Q8K8M7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8M7"
FT                   /protein_id="AAM78810.1"
FT                   /translation="MKKLILSCLVALALLFGGMSRAQANQYLRVGMEAAYAPFNWTQDD
FT                   ASNGAVPIEGTSQYANGYDVQVAKKIAKAMNKELLVVKTSWTGLIPALTSGKIDMIAAG
FT                   MSPTKERRNEISFSNSYYTSQPVLVVTANGKYADATSLKDFSGAKVTAQQGVWHVNLLT
FT                   QLKGAKLQTPMGDFSQMRQALTSGVIDAYISERPEAMTAEAADSRLKMITLKKGFAVAE
FT                   SDAAIAVGMKKNDDRMATVNQVLEGFSQTDRMALMDDMVTKQPVEKKAEDAKASFLGQM
FT                   WAILKGNWKQFLRGTGMTLLISMVGTITGLFIGLLIGIFRTAPKAKHKVAALGQKLFGW
FT                   LLTIYIEIFRGTPMIVQSMVIYYGTAQAFGISIDRTLAAIFIVSINTGAYMSEIVRGGI
FT                   FAVDKGQFEAATALGFTHGQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLNVISVVE
FT                   LYFSGNTVATQTYQYFQTFTIIAIIYFVLTFTVTRILRYIERRFDADTYTTGANQMQIA
FT                   EVSNV"
FT   gene            235376..237301
FT                   /locus_tag="SpyM3_0204"
FT   CDS             235376..237301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74615.1| (AE007356)
FT                   hypothetical protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78811"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8M6"
FT                   /protein_id="AAM78811.1"
FT                   /translation="MKKILMTLVLCFSLLGIRIKAADVDYSITNYEGQLLLSKENTARF
FT                   EQKVTYQFDTSYNGQYISLGRTGHLPAGFAIDQKPKVEVYQNGQQVPVSQEFSDLGDGY
FT                   RLKLYNAGQAGDKVDVKVIWQLHHLLTAYQDVAELNWTPISDWDKTLEKVSLTVTTPTD
FT                   IQDSNLWAHRGYYQKKPQVLKEGNSRYQINAKNVSGQLELHAYWDKKALLGKEPVDVST
FT                   SKKNKIVALETKISRRRTLLQLLFGKVIPLVEVGFLLSQLIQFTRLKKQFNRYHLANHT
FT                   DHSYEVPEDLSPLVLTQAIYGQSFAYLSPTASESQKLLIPKGVTFEALVQATLLDLIDQ
FT                   KVLLLTKEEGKAYLEISQLDRVTDEEAVFLDMAFGNKVTLPVDQLFSQYHYDADTIKQL
FT                   KKTYKGKKLEQEIRQSSEQVIKAMKKASAAITNNVLETIKKLNLPDTYRQMTPAEKRKS
FT                   NSVQGLGCLLLILNSGLLIYLAIKESGLALIYLALMVLTMCLGFYISLKLDQYKKLGIE
FT                   TPEGGVRLHQWQSFKNMIRDIDKFEDVAIEGLVVWNRVLVYATLFGYAKKVERYLKVHR
FT                   IALPEVYQAVRPGELSMVMYATTPTFVSSLSSATTSSNFSVSSGGGISGGGGFSGGGGG
FT                   GGGGAF"
FT   gene            237367..238206
FT                   /gene="bacA"
FT                   /locus_tag="SpyM3_0205"
FT   CDS             237367..238206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="SpyM3_0205"
FT                   /product="putative undecaprenol kinase"
FT                   /note="bacitracin resistance protein; best blastp hit:
FT                   gb|AAK33352.1| (AE006494) putative undecaprenol kinase
FT                   (bacitracin resistance protein) [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78812"
FT                   /db_xref="GOA:P0DH30"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DH30"
FT                   /protein_id="AAM78812.1"
FT                   /translation="MLIIELLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLNQDKAF
FT                   IEMFNIVIQLGAIIAVMLIYFERLNPFQPGKTAREVQLTWQLWLKVVIACIPSILIAVP
FT                   LDNWFEAHFYFMVPIAIALIVYGIAFIWIEKRNAQQEPAVTELARMSYKTAFFIGCFQV
FT                   LSIVPGTSRSGATILGAIILGTSRTVAADFTFFLAIPTMFGYSGLKAVKFFLDGHHLDF
FT                   AQVLILLVASLTAFVVSLLAIRFLTDYVKKHDFTIFGKYRIVLGSLLLIYSFFKFVF"
FT   gene            238424..239113
FT                   /gene="mecA"
FT                   /locus_tag="SpyM3_0206"
FT   CDS             238424..239113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mecA"
FT                   /locus_tag="SpyM3_0206"
FT                   /product="putative negative regulator of genetic
FT                   competence"
FT                   /note="best non-GAS blastp hit: dbj|BAA82113.1| (AB022909)
FT                   negative regulator of genetic competence [Streptococcus
FT                   mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78813"
FT                   /db_xref="GOA:P0DC30"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC30"
FT                   /protein_id="AAM78813.1"
FT                   /translation="MELKDFLIPQEKTEEFFYSVMDELDLPDNFKDSGMLSFRVTPRKD
FT                   RLDVFVTKSEINKDINLEDLAEFGDMSQMTPEDFFKSLEQSMREKGDVKAHEKLEQIEE
FT                   IMEDVVEATLANQSEAADPSTNHESEPLDYVHYVLDFSTITEAVAFAKTIDFSIEASEL
FT                   YKGSNCYHMTILLDVQQQPSYFANVMYARLIEHANPGSKTRAYLQEHGLQLMLDGAVEQ
FT                   LQKIELG"
FT   gene            239171..240289
FT                   /gene="rgpG"
FT                   /locus_tag="SpyM3_0207"
FT   CDS             239171..240289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpG"
FT                   /locus_tag="SpyM3_0207"
FT                   /product="putative polysacharide biosynthesis protein"
FT                   /note="best non-GAS blastp hit: dbj|BAA82114.1| (AB022909)
FT                   RgpG [Streptococcus mutans] (rhamnose-glucose
FT                   polysaccharide biosynthesis protein), possibly involved in
FT                   regulation of genetic competence"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78814"
FT                   /db_xref="GOA:Q8K8M4"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8M4"
FT                   /protein_id="AAM78814.1"
FT                   /translation="MSLFLTPLVRFLAFRVGAVDNPNARRVNKVPMPTSGGLAIFMSFL
FT                   VASLGLIPIASKGAMFFGQTYFSYILPVVIGATVITLTGFLDDLYELSPKLKMFGILIG
FT                   AVIVWAFTDFKFDSFKIPFGGPLLVFGPFLTLFLTVLWIVSITNAINLIDGLDGLVSGV
FT                   SIISLVTMAIVSYFFLPQKDFFLTLTILVLISAIAGFFPYNYHPAMIYLGDTGALFIGF
FT                   MIGVLSLQGLKNSTAVAVVTPVIILGVPIMDTIVAIIRRSLSGQKFYEPDKMHLHHRLL
FT                   SMGFTHRGAVLVVYGITMLFSLISLLLNVSSRIGGVLLMLGLLFGLEVFIEGLEIWGEK
FT                   RTPLFNLLKFIGNSDYRQAMLLKWKEKKDLKH"
FT   gene            240411..241181
FT                   /locus_tag="SpyM3_0208"
FT   CDS             240411..241181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0208"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74994.1| (AE007392)
FT                   ABC transporter, ATP-binding protein [Streptococcus
FT                   pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78815"
FT                   /db_xref="GOA:P0CZ42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CZ42"
FT                   /protein_id="AAM78815.1"
FT                   /translation="MSILEINNLHVSIEGKEILKGVNLTLKTGEVAAIMGPNGTGKSTL
FT                   SAAIMGNPNYEVTQGQILLDGVNILDLEVDERARLGLFLAMQYPSEIPGITNAEFMRAA
FT                   MNAGKADEDKISVRDFITKLDEKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLE
FT                   PKFALLDEIDSGLDIDALKVVSKGVNEMRGKDFGAMIITHYQRLLNYITPDLVHVMMDG
FT                   RIVLSGDAALATRLEKEGYAGIAQDLGIEYKEES"
FT   gene            241276..242538
FT                   /locus_tag="SpyM3_0209"
FT   CDS             241276..242538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99576.1| (AE008453)
FT                   Conserved hypothetical protein [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78816"
FT                   /db_xref="GOA:Q8K8M3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8M3"
FT                   /protein_id="AAM78816.1"
FT                   /translation="MTKEKLVAFSQAHAEPAWLQERRLAALEAIPELELPTIERVKFHR
FT                   WNLGDGTLTENESLASVPDFIAIGDNPKLVQVGTQTVLEQLPMALIDKGVVFSDFYTAL
FT                   EEIPEVIEAHFGQALAFDEDKLAAYHTAYFNSAAVLYVPDHLEITTPIEAIFLQDSDSD
FT                   VPFNKHVLVIAGKESKFTYLERFESIGNATQKISANISVEVIAQAGSQIKFSAIDRLGP
FT                   SVTTYISRRGRLEKDVNIDWALAVMNEGNVIADFDSDLIGQGSQADLKVVAASSGRQVQ
FT                   GIDTRVTNYGQRTVGHILQHGVILERGTLTFNGIGHILKGAKGADAQQESRVLMLSDQA
FT                   RADANPILLIDENEVTAGHAASIGQVDPEDMYYLMSRGLDQETAERLVIRGFLGAVIAE
FT                   IPIPSVRQEIIKVLDEKLLNR"
FT   gene            242569..243795
FT                   /locus_tag="SpyM3_0210"
FT   CDS             242569..243795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0210"
FT                   /product="putative aminotransferase"
FT                   /note="best non-GAS blastp hit: gb|AAK74996.1| (AE007392)
FT                   aminotransferase, class-V [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78817"
FT                   /db_xref="GOA:Q8K8M2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8M2"
FT                   /protein_id="AAM78817.1"
FT                   /translation="MLDAKDIKQDFQILNQQVNDEPLVYLDNAATTQKPALVLEALQSY
FT                   YQEDNANVHRGVHTLAERATHKYEASRQQVADFIHAKSSKEVLFTRGTTTSLNWVARFA
FT                   EQVLTPEDEVLISIMEHHANIIPWQQACQKTGARLVYVYLKDGQLDMDDLANKLTTKTR
FT                   FVSLVHVSNVLGCINPIKEIAKLAHAKGAYLVVDGAQSVPHLAIDVQDLDCDFFAFSAH
FT                   KMLGPTGLGVLYGKEELLNQVEPLEFGGEMIDFVYEQEATWKELPWKFEAGTPHIAGAI
FT                   GLSAAISYLQRLGMADIHAHEAELIAYVLPKLEAIEGLTIYGPSQPSARSGLISFNLDD
FT                   LHPHDLATALDYEGVAVRAGHHCAQPLLSYLGVPATVRASFYIYNTKADCDRLVEAILK
FT                   AKEFFNGTL"
FT   gene            243782..244261
FT                   /locus_tag="SpyM3_0211"
FT   CDS             243782..244261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74997.1| (AE007392)
FT                   NifU family protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78818"
FT                   /db_xref="GOA:Q8K8M1"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8M1"
FT                   /protein_id="AAM78818.1"
FT                   /translation="MALSKLNHLYMAVVADHSKRPHHHGQLDGVEAVQLNNPTCGDVIS
FT                   LTVKFDEDKIEDIAFAGNGCTISTASSSMMTDAVIGKSKEEALALADIFSEMVQGQENP
FT                   AQKELGEAELLAGVAKFPQRIKCSTLAWNALKEAIKRSANAQHLMDQNVKEGKNV"
FT   gene            244254..245672
FT                   /locus_tag="SpyM3_0212"
FT   CDS             244254..245672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99579.1| (AE008453)
FT                   Conserved hypothetical protein [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78819"
FT                   /db_xref="GOA:F7IWH0"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="UniProtKB/TrEMBL:F7IWH0"
FT                   /protein_id="AAM78819.1"
FT                   /translation="MSDINEKVEPKPIDLGDYQFGFHDDVEPIYSTGKGLSEAVVRELS
FT                   AAKNEPEWMLEFRLKSLETFNKMPMQTWGADLSDINFDDIIYYQKASDKPARSWDDVPE
FT                   KIKETFDRIGIPEAERAYLAGASAQYESEVVYHNMKGEFEKLGIIFTDTDSALKEYPDL
FT                   FKQYFAKLVPPTDNKLAALNSAVWSGGTFIYVPKGVKVDIPLQTYFRINNENTGQFERT
FT                   LIIVDEGASVHYVEGCTAPTYSSNSLHAAIVEIFALDGAYMRYTTIQNWSDNVYNLVTK
FT                   RARALTDATVEWIDGNLGAKTTMKYPSVYLDGPGARGTMLSIAFANAGQHQDTGAKMIH
FT                   NAPHTSSSIVSKSIAKSGGKVDYRGQVTFNKQSKKSVSHIECDTILMDDISKSDTIPFN
FT                   EIHNSQVALEHEAKVSKISEEQLYYLMSRGLSESEATEMIVMGFVEPFTKELPMEYAVE
FT                   LNRLISYEMEGSVG"
FT   gene            complement(245824..247005)
FT                   /locus_tag="SpyM3_0213"
FT   CDS             complement(245824..247005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0213"
FT                   /product="putative DD-carboxypeptidase"
FT                   /note="penicillin-binding protein; best blastp hit:
FT                   emb|CAC21495.1| (AJ300704) DD-carboxypeptidase
FT                   [Enterococcus faecalis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78820"
FT                   /db_xref="GOA:Q8K8M0"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8M0"
FT                   /protein_id="AAM78820.1"
FT                   /translation="MTKRIILTIFTFICFSMMPLVHAEDVMDITRQAGYTVSEVNRPKS
FT                   SIVVDANSSDILWQDNIDIPRDPASMSKMFTLYILFEELAKGKITMDTTITATPTDQAI
FT                   ANIYEISNNNIVAGVAYPIRDLITLTAVPSSNAATVMIANYLSNNDASAFIDRINATAK
FT                   QLGMTNTHFSNASGAAAQAFQGYYNPTKYDLSASNITTARDLSKLLYAFLKKYPEIISF
FT                   TNKSVVHTMVGTPYEEEFHTYNHSLPDNQFGMKGVDGLKTGSSPSAAFNAMITAKRGKT
FT                   RLITIVMGVGDWSDQNGEFYRHPFVNALTEKGFKDSKTLSKKARQKLEKLVPQTKKETS
FT                   PKQQHFKATKKQSYLERVEDFMNHNHTFLLICLAIFIITILLLSLVVFAMGRQ"
FT   gene            complement(247173..248405)
FT                   /gene="dacA"
FT                   /locus_tag="SpyM3_0214"
FT   CDS             complement(247173..248405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="SpyM3_0214"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /note="penicillin-binding protein; best non-GAS blastp hit:
FT                   gb|AAK74999.1| (AE007392) D-alanyl-D-alanine
FT                   carboxypeptidase [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78821"
FT                   /db_xref="GOA:Q8K8L9"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8L9"
FT                   /protein_id="AAM78821.1"
FT                   /translation="MIKRLISLVVIALFFAASTVSGEEYSVTAKHAIAVDLESGKVLYE
FT                   KDAKEVVPVASVSKLLTTYLVYKEVSKGKLNWDSPVTISNYPYELTTNYTISNVPLDKR
FT                   KYTVKELLSALVVNNANSPAIALAEKIGGTEPKFVDKMKKQLRQWGISDAKVVNSTGLT
FT                   NHFLGANTYPNTEPDDENCFCATDLAIIARHLLLEFPEVLKLSSKSSTIFAGQTIYSYN
FT                   YMLKGMPCYREGVDGLFVGYSKKAGASFVATSVENQMRVITVVLNADQSHEDDLAIFKT
FT                   TNQLLQYLLINFQKVQLIENNKPVKTLSVLDSPEKTVKLVAQNSLFFIKPIHTKTKNTV
FT                   HITKKSSTMIAPLSKGQVLGRATLQDKHLIGQGYLDTPPSINLILQKNISKSFFLKVWW
FT                   NRFVRYVNTSL"
FT   gene            248736..250706
FT                   /gene="oppA"
FT                   /locus_tag="SpyM3_0215"
FT   CDS             248736..250706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="SpyM3_0215"
FT                   /product="oligopeptide permease"
FT                   /note="best blastp hit: emb|CAA61522.1| (X89237)
FT                   oligopeptide permease [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78822"
FT                   /db_xref="GOA:Q8K8L8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8L8"
FT                   /protein_id="AAM78822.1"
FT                   /translation="MKKSKWLAAVSVAILSVSALAACGNKNASGGSEATKTYKYVFVND
FT                   PKSLDYILTNGGGTTDVITQMVDGLLENDEYGNLVPSLAKDWKVSKDGLTYTYTLRDGV
FT                   SWYTADGEEYAPVTAEDFVTGLKHAVDDKSDALYVVEDSIKNLKAYQNGEVDFKEVGVK
FT                   ALDDKTVQYTLNKPESYWNSKTTYSVLFPVNAKFLKSKGKDFGTTDPSSILVNGAYFLS
FT                   AFTSKSSMEFHKNENYWDAKNVGIESVKLTYSDGSDPGSFYKNFDKGEFSVARLYPNDP
FT                   TYKSAKKNYADNITYGMLTGDIRHLTWNLNRTSFKNTKKDPAQQDAGKKALNNKDFRQA
FT                   IQFAFDRASFQAQTAGQDAKTKALRNMLVPPTFVTIGESDFGSEVEKEMAKLGDEWKDV
FT                   NLADAQDGFYNPEKAKAEFAKAKEALTAEGVTFPVQLDYPVDQANAATVQEAQSFKQSV
FT                   EASLGKENVIVNVLETETSTHEAQGFYAETPEQQDYDIISSWWGPDYQDPRTYLDIMSP
FT                   VGGGSVIQKLGIKAGQNKDVVAAAGLDTYQTLLDEAAAITDDNDARYKAYAKAQAYLTD
FT                   SAVDIPVVALGGTPRVTKAVPFSGGFSWAGSKGPLAYKGMKLQDKPVTAKQYENAKEKW
FT                   MKAKAKSNAKYAEKLADHVEK"
FT   gene            250771..252273
FT                   /gene="oppB"
FT                   /locus_tag="SpyM3_0216"
FT   CDS             250771..252273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB"
FT                   /locus_tag="SpyM3_0216"
FT                   /product="putative oligopeptide permease"
FT                   /note="best blastp hit: emb|CAA61523.1| (X89237)
FT                   oligopeptide permease [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78823"
FT                   /db_xref="GOA:Q8K8L7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8L7"
FT                   /protein_id="AAM78823.1"
FT                   /translation="MKKYILNRIMRSLVSVVLVTALTYTIVYTLVPTSLIFKQDPNYNK
FT                   MTTTPDKKVAYENLTFQRMGYVNYFSSKELKDNASKVDSSVTTEATSANKAIYEKYIDS
FT                   LGNGWQLKRFPASKQFYAIRNIPIYERVWNFFSNLVVIDHPWKIQDKDNPKLARYIRLE
FT                   KDKSVGWSLVGSGTKHKYLLYTNGKFPYLHQNFVTLNLGTSYPTYSNIPVLQVISQGQG
FT                   RTALQDVTFPSGVTKKSSVDIYSRSYKNPKSLDDITKVNYGKGDSYTKTINNYVDPSMI
FT                   HNSFVIGFFGVMFSYIVGLPLGLFMARFKNTYFDRFSTATMTFMLALPSIAVIYVVRFL
FT                   GGMAGLPDSFPMLGASDPKSYILPALILGILNIPTTVIWFRRYLVDLQASDWVRFARSK
FT                   GLSESEIYRGHLFKNAMVPIVSGVPASIILAIGGATLTETVFAFPGMGKMLIDSIKSAN
FT                   NSMIVGLTFIFTVLSIVSLLLGDIVMTLVDPRIKLSTKKGGK"
FT   gene            252273..253199
FT                   /gene="oppC"
FT                   /locus_tag="SpyM3_0217"
FT   CDS             252273..253199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC"
FT                   /locus_tag="SpyM3_0217"
FT                   /product="putative oligopeptide permease"
FT                   /note="best blastp hit: emb|CAA61524.1| (X89237)
FT                   oligopeptide permease [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78824"
FT                   /db_xref="GOA:Q8K8L6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8L6"
FT                   /protein_id="AAM78824.1"
FT                   /translation="MESIDKSKFRFVERDSEASEVIDTPAYSYWKSVFRQFFSKKSTVF
FT                   MLVILVTVLMMSFIYPMFANYDFNDVSNINDFSKRYIWPNAEYWFGTDKNGQSLFDGVW
FT                   YGARNSILISVIATLINITIGVVLGAIWGVSKVFDKVMIEIYNIISNIPSMLIIIVLTY
FT                   SLGAGFWNLILAFCITGWIGVAYSIRVQILRYRDLEYNLASQTLGTPMYKIAVKNLLPQ
FT                   LVSVIMTMLSQMLPVYVSSEAFLSFFGIGLPTTTPSLGRLIANYSSNLTTNAYLFWIPL
FT                   VTLILVSLPLYIVGQNLADASDPRSHR"
FT   gene            253208..254278
FT                   /gene="oppD"
FT                   /locus_tag="SpyM3_0218"
FT   CDS             253208..254278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="SpyM3_0218"
FT                   /product="putative oligopeptide ABC transporter,
FT                   ATP-binding protein"
FT                   /note="best blastp hit: emb|CAA61525.1| (X89237)
FT                   oligopeptide permease [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78825"
FT                   /db_xref="GOA:Q8K8L5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8L5"
FT                   /protein_id="AAM78825.1"
FT                   /translation="MTKENNVILTAKDVVVEFDVRDRVLTAIRNVSLELVEGEVLAFVG
FT                   ESGSGKSVLTKTFTGMLESNGRIANGSIVYRGQELTDLKTNKEWAKIRGSKIATIFQDP
FT                   MTSLSPIKTIGSQITEVIIKHQKVSNAKAKEMALDYMNKVGIPNAKKRFEDYPFEYSGG
FT                   MRQRIVIAIALACRPDILICDEPTTALDVTIQAQIVELLKSLQREYHFTIIFITHDLGV
FT                   VASIADKVAVMYAGEIVEFGTVEEIFYDPRHPYTWSLLSSLPQLADESGELYAIPGTPP
FT                   SLYSPIIGDAFALRSEYAMVLDFEKAPPAINVSETHWAKTWLLHPEAPKVQKPEVIQDL
FT                   HQKILRKMSQQEEGNV"
FT   gene            254271..255194
FT                   /gene="oppF"
FT                   /locus_tag="SpyM3_0219"
FT   CDS             254271..255194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="SpyM3_0219"
FT                   /product="putative oligopeptide ABC transporter,
FT                   ATP-binding protein"
FT                   /note="best blastp hit: emb|CAA61526.1| (X89237)
FT                   oligopeptide permease [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78826"
FT                   /db_xref="GOA:P0CZ32"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CZ32"
FT                   /protein_id="AAM78826.1"
FT                   /translation="MSEKLVEVKDLEISFGEGKKKFVAVKNANFFIKKGETFSLVGESG
FT                   SGKTTIGRAIIGLNDTSSGQILYDGKVINGRKSKSEANELIRKIQMIFQDPAASLNERA
FT                   TVDYIISEGLYNFNLFKTEEERKEKIKNMMAEVGLLSEHLTRYPHEFSGGQRQRIGIAR
FT                   ALVMNPEFVIADEPISALDVSVRAQVLNLLKRMQAEKGLTYLFIAHDLSVVRFISDRIA
FT                   VIHKGVIVEVAETEELFNNPIHPYTQSLLSAVPIPDPILERQKELVVYHPDQHDYTLDK
FT                   PSMVEIKPNHFVWANQAEIEKYQKEL"
FT   misc_feature    complement(255342..255587)
FT                   /note="similar to C-terminal portion of Streptococcus
FT                   agalactiae insertion sequence IS861 putative transposase"
FT   gene            256188..257742
FT                   /locus_tag="SpyM3_r07"
FT   rRNA            256291..257625
FT                   /locus_tag="SpyM3_r07"
FT                   /product="16S ribosomal RNA"
FT   gene            257787..257862
FT                   /locus_tag="SpyM3_t42"
FT   tRNA            257787..257862
FT                   /locus_tag="SpyM3_t42"
FT                   /product="tRNA-Ala"
FT   gene            258158..261063
FT                   /locus_tag="SpyM3_r08"
FT   rRNA            258159..261059
FT                   /locus_tag="SpyM3_r08"
FT                   /product="23S ribosomal RNA"
FT   gene            261145..261262
FT                   /locus_tag="SpyM3_r16"
FT   gene            261268..261341
FT                   /locus_tag="SpyM3_t43"
FT   tRNA            261268..261341
FT                   /locus_tag="SpyM3_t43"
FT                   /product="tRNA-Asn"
FT   gene            261421..261494
FT                   /locus_tag="SpyM3_t44"
FT   tRNA            261421..261494
FT                   /locus_tag="SpyM3_t44"
FT                   /product="tRNA-Arg"
FT   gene            261586..262071
FT                   /gene="comX.1"
FT                   /locus_tag="SpyM3_0220"
FT   CDS             261586..262071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comX.1"
FT                   /locus_tag="SpyM3_0220"
FT                   /product="putative transcriptional regulator ComX1"
FT                   /note="best non-GAS blastp hit: gb|AAK74207.1| (AE007319)
FT                   transcriptional regulator ComX1 [Streptococcus pneumoniae
FT                   TIGR4], and gb|AAK76073.1| (AE007490) transcriptional
FT                   regulator ComX2 [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78827"
FT                   /db_xref="GOA:Q8K5E7"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K5E7"
FT                   /protein_id="AAM78827.1"
FT                   /translation="MSIETRAVFEKVKPIILKLKRHYYIQLWDRDDWLQEGHIILLQLL
FT                   ERYPELIEEEERLYRYFKTKFSSYLKDLLRRQESQKRQFHKLAYEEIGEVAHAIPSRGL
FT                   WLDDYVAYQEVIASLENQLNSQERMQFQALIRGERFKGRRALLRKISPYFKEFAQQL"
FT   gene            262681..263097
FT                   /locus_tag="SpyM3_0221"
FT   CDS             262681..263097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0221"
FT                   /product="putative transposase-IS1548"
FT                   /note="best blastp hit: ref|NP_269815.1| (NC_002737)
FT                   putative transposase - IS1548 [Streptococcus pyogenes]
FT                   [Streptococcus pyogenes M1 GAS], emb|CAA74641.1| (Y14270)
FT                   putative transposase [Streptococcus agalactiae], and
FT                   gb|AAK34536.1| (AE006608) putative transposase - IS1548
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78828"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8L4"
FT                   /protein_id="AAM78828.1"
FT                   /translation="MIDFIISIDDCAVELDSRQSWKIRSPLSTILFLVFVCQLAGIETW
FT                   KEMEDFIEMNEPLFATYVDLSEGCPSHDTLERVISLVNSERLKELKVQFEQSLTSLDAV
FT                   HQLISVEGKTIRDNRGKNQKPVHIVTAYDGRSSS"
FT   gene            263078..263815
FT                   /locus_tag="SpyM3_0222"
FT   CDS             263078..263815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0222"
FT                   /product="putative transposase-IS1548"
FT                   /note="best blastp hit: ref|NP_269815.1| (NC_002737)
FT                   putative transposase - IS1548 [Streptococcus pyogenes]
FT                   [Streptococcus pyogenes M1 GAS], emb|CAA74641.1| (Y14270)
FT                   putative transposase [Streptococcus agalactiae], and
FT                   gb|AAK34536.1| (AE006608) putative transposase - IS1548
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78829"
FT                   /db_xref="GOA:Q8K8L3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8L3"
FT                   /protein_id="AAM78829.1"
FT                   /translation="MGGHHLSLGQVAVEEKSNEIVAIPQLLRTIDIRKSIVTIDAMGTQ
FT                   TAIVDTIIKGKADYCLAVKGNQKTLYDAIALYFSDVNLLEELQENAQYYQTVEKSRGQI
FT                   EVREYWVSSDIKWLCQNHPKWHKLRGIGMTRNMIDKDGQLSQENRYFIFSFKPDVLTFA
FT                   NCVRGHWQIESMHWLLDVVYHEDHHQTLDKRAAFNLNLIRKMCLYFLKVMVFPKKDLSY
FT                   RRKQRYISVHLEDYLVQLFGERG"
FT   gene            263921..264505
FT                   /locus_tag="SpyM3_0223"
FT   CDS             263921..264505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAL00398.1| (AE008526)
FT                   Conserved hypothetical protein [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78830"
FT                   /db_xref="GOA:Q7CFG7"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFG7"
FT                   /protein_id="AAM78830.1"
FT                   /translation="MLFQKKYDKIESTNYFGDDMSIDDYRPTYMVEAIYDLRANDLLRH
FT                   GITAVLVDLDNTLIAWNNPDGTPEVRAWLDEMTIADISVVVVSNNKHSRVERAVSRFGV
FT                   DFISRALKPFAYGIEKAIARYGFDRNEVIMVGDQLMTDIRASHRAGIKSVLVKPLVASD
FT                   AWNTKINRWRERRVMAKLEEKYGKLSYQKGI"
FT   gene            264505..265623
FT                   /locus_tag="SpyM3_0224"
FT   CDS             264505..265623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0224"
FT                   /product="putative GTP-binding protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75825.1| (AE007467)
FT                   GTP-binding protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78831"
FT                   /db_xref="GOA:Q7CFG6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFG6"
FT                   /protein_id="AAM78831.1"
FT                   /translation="MEELFCIGCGIQIQTEDKEKAGFTPAAALKKGMETGELYCQRCFR
FT                   LRHYNEITDVHITDDEFLRLLHEVGDSDALVVNVIDIFDFNGSIIPGLSRFISGNDVLL
FT                   VGNKKDILPKSVKDGKVTQWLTERAHEEGLRPLDVMLTSAQNKYAIKDLIGRINELRNG
FT                   RDVYVVGVTNVGKSTLINAIIQEITGNKDVITTSRFPGTTLDKIEIPLDDGTFIFDTPG
FT                   IIHRHQMAHYLSPKELKIVSPKKEIKPKTYQLNPEQTLFLGGLARFDFINGERQGFTAF
FT                   FDNQLELHRTKLAGADAFYDKHVGTLLTPPDKKELTAFPKLVRHEFTIDQKMDIVFSGL
FT                   GWIRVNGQKDSKAIVAAWAPEGVAVIVRKAII"
FT   gene            265648..265956
FT                   /locus_tag="SpyM3_0225"
FT   CDS             265648..265956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75824.1| (AE007467)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4], and gb|AAL00396.1| (AE008526) Conserved
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78832"
FT                   /db_xref="GOA:Q7CFG5"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFG5"
FT                   /protein_id="AAM78832.1"
FT                   /translation="MLTSKQRAFLKSEAHSLKPIVQIGKNGLNDHIKTSIRQALDAREL
FT                   IKVTLLQNTDEDIHEVAEILEEEIGCDTVLKIGRILILYKVSAKKENRKLSPKVKAI"
FT   gene            266025..266657
FT                   /locus_tag="SpyM3_0226"
FT   CDS             266025..266657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75823.1| (AE007467)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4], and gb|AAL00395.1| (AE008526) Conserved
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78833"
FT                   /db_xref="GOA:P0DC62"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC62"
FT                   /protein_id="AAM78833.1"
FT                   /translation="MALELLTPFTKVELEEEKKESNRKQIGILGGNFNPIHNAHLVVAD
FT                   QVRQQLGLDQVLLMPECKPPHVDAKETIDEKHRLRMLELAIEDVEGLAIETCELERQGI
FT                   SYTYDTMLYLTEQHPDVDFYFIIGADMVDYLPKWHRIDELVKLVQFVGVQRPKYKAGTS
FT                   YPVIWVDLPLMDISSSMIRDFIKKGRQPNYLLPKRVLDYITQEGLYQ"
FT   gene            266654..267247
FT                   /locus_tag="SpyM3_0227"
FT   CDS             266654..267247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75822.1| (AE007467)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78834"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFG4"
FT                   /protein_id="AAM78834.1"
FT                   /translation="MTYEDYLPYSRTELLAKIAEQMSPKRFKHVLGVEKAALSLAECYG
FT                   CNPDKAGLAALLHDYAKECPDQVFLDLIDKYQLSPELAKWNNNVWHGMVGIYKIQEDLG
FT                   LKDKDILRAIEIHTVGAAEMTLLDKVLYVADYIEEGRIFPLVDDARKIAKLDLNQAVAY
FT                   ETVNTVAYLASKAQPIFPQTLDTYNAFCSYLKEY"
FT   gene            267247..267624
FT                   /locus_tag="SpyM3_0228"
FT   CDS             267247..267624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAL00392.1| (AE008526)
FT                   Conserved hypothetical protein [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78835"
FT                   /db_xref="GOA:Q8K8L1"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="InterPro:IPR025656"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8L1"
FT                   /protein_id="AAM78835.1"
FT                   /translation="MDNDMRNKMKKDELLKIVVEATEEKRAKDILALDLEGLTSLTDYF
FT                   VIASATNSRQLEAIADNIREKVKEAGGDASHVEGNSQAGWVLLDLTDVVVHLFLEDKRY
FT                   HYNLEKLWHEAPAVALDAYLA"
FT   gene            267672..268415
FT                   /locus_tag="SpyM3_0229"
FT   CDS             267672..268415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75819.1| (AE007467)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4], and gb|AAL00391.1| (AE008526) Conserved
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78836"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8L0"
FT                   /protein_id="AAM78836.1"
FT                   /translation="MEHNYEKFASVYDAVMDDSLYDLWTDFSLRHLPKSKGRNRLLELA
FT                   CGTGIQSVRFAQAGFDVTGLDLSQDMLAIAKKRAQSAKKKIDFIQGNMLDLSQVGQFDF
FT                   VTCYSDSICYMQDEVDVGDVFKEVYDVLANDGIFIFDVHSTYQTDECFPGYSYHENADD
FT                   FAMVWDTYADEVPHSVVHELTFFIQEDDGRFSRFDEVHEERTYELLTYDILLEQAGFKS
FT                   FKVYADFEDKEPTETSKRWFFVAYK"
FT   gene            268637..269743
FT                   /locus_tag="SpyM3_0230"
FT   CDS             268637..269743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAL00390.1| (AE008526)
FT                   Conserved hypothetical protein [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78837"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DH16"
FT                   /protein_id="AAM78837.1"
FT                   /translation="MTVTGIIAEFNPFHNGHKYLLETAEGLKIIAMSGNFMQRGEPALI
FT                   DKWIRSEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQLGIQQLAFGTENVIDYQ
FT                   KLIKVYEKKSEQMTAYLSTLEDTLSYPQKTQKMWEIFAGVKFSGQTPNHILGLSYAKAS
FT                   AGKHIQLCPIKRQGAAYHSKDKNHLLASASAIRQHLNDWDFISHSVPNAGLLINNPHMS
FT                   WDHYFSFLKYQILNHSDLTSIFQVNDELASRIKKAIKVSQNIDHLVDTVATKRYTKARV
FT                   RRILTYILVNAKEPTLPKGIHILGFTSKGQAHLKKLKKSRPLITRIGAETWDEMTQKAD
FT                   SIYQLGHQDIPEQSFGRIPIIIKNERLN"
FT   gene            270225..270941
FT                   /locus_tag="SpyM3_0231"
FT   CDS             270225..270941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75990.1| (AE007482)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4], and gb|AAL00541.1| (AE008539) Conserved
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78838"
FT                   /db_xref="GOA:P0DF82"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026563"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF82"
FT                   /protein_id="AAM78838.1"
FT                   /translation="MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNT
FT                   ALKFVIDRAKQAQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVN
FT                   RTAANVRTAYGKNGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEA
FT                   EEGTITVYTAPTDLHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDAL
FT                   ESDDDVQKVYHNVADF"
FT   gene            271144..271986
FT                   /gene="atmA"
FT                   /locus_tag="SpyM3_0232"
FT   CDS             271144..271986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atmA"
FT                   /locus_tag="SpyM3_0232"
FT                   /product="putative amino acid ABC transport
FT                   substrate-binding protein"
FT                   /note="best non-GAS blastp hit: gb|AAL04076.1|AF397166_1
FT                   (AF397166) AtmA [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78839"
FT                   /db_xref="GOA:Q7CFG2"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFG2"
FT                   /protein_id="AAM78839.1"
FT                   /translation="MIKKQYLGRATIALASTLVLAACGSSKTAESGNQGSSKEVLFATV
FT                   GTTAPFSYEKGGQLTGYDIEVAKAVFKGSDDYKVSFKKTEWSSIFTGLDSGKYQMGGNN
FT                   ISFTKERSAKYLFSYPIGSTPSVLVVPKDSDIKSFDDIQGHTTQVVQGTTSVAQLEDFN
FT                   KKHSDNPVTLKFTNENITQMLTNLSEGKADFKIFDAPTVNAIIKNQGLDNLKTIELTST
FT                   EQPFIYFIFSQDQEKLQSFVNKRIKELTADGTLSKLAKEHLGGDYVPSDKELKLPTAN"
FT   gene            272310..273155
FT                   /gene="atmB"
FT                   /locus_tag="SpyM3_0233"
FT   CDS             272310..273155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atmB"
FT                   /locus_tag="SpyM3_0233"
FT                   /product="putative lipoprotein"
FT                   /note="best non-GAS blastp hit: gb|AAL04077.1|AF397166_2
FT                   (AF397166) AtmB [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78840"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8K9"
FT                   /protein_id="AAM78840.1"
FT                   /translation="MSFKKWIGIVGIALASTVLVACSEKQDDKNTLTIGVMTKTESDQA
FT                   RWDKVEELLKKDNITLKYKEFTDYSQPNKAVANGEVDINAFQHYNFLNNWNKENKEHLV
FT                   AIADTYISPINLFSGTSQDGKAKYKSVADLPNGAQIAVPNDATNESRALYVLQSAGLIK
FT                   LDVSGDQLATIANISENKKKLDIKELDASQTARALVSADAAVVNNSYAVPAKIDYKTSL
FT                   FKEKADDNSKQWINIIAGQKDWEKSEKADAIKKLIKAYQTDEVKKVVEKTSNGIDVSVW
FT                   "
FT   gene            273405..274469
FT                   /gene="atmD"
FT                   /locus_tag="SpyM3_0234"
FT   CDS             273405..274469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atmD"
FT                   /locus_tag="SpyM3_0234"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="best non-GAS blastp hit: gb|AAL04079.1|AF397166_4
FT                   (AF397166) AtmD [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78841"
FT                   /db_xref="GOA:P0CZ30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CZ30"
FT                   /protein_id="AAM78841.1"
FT                   /translation="MNEAIIQLDHIDITFRQKKRVIEAVKDVTVHINQGDIYGIVGYSG
FT                   AGKSTLVRVINLLQAPTNGKITVDGDVTFEQGKVQLSANALRQKRRDIGMIFQHFNLMA
FT                   QKTAKENVAFALRHSSLSKTEKEHKVIELLELVGLSERADNYPAQLSGGQKQRVAIARA
FT                   LANDPKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAV
FT                   MQNGVLIEEGSVLDIFSNPKEALTQEFITTATGIDEALEKINQQDIVKHLPANALLAQL
FT                   KYAGTSTDEPLLNSIYRQFEVTANILYGNIEILDHIPVGDMIVVLEGQAENILAAEKAL
FT                   HEAGVDVSILKRGA"
FT   gene            274470..275162
FT                   /gene="atmE"
FT                   /locus_tag="SpyM3_0235"
FT   CDS             274470..275162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atmE"
FT                   /locus_tag="SpyM3_0235"
FT                   /product="putative ABC transporter (permease protein)"
FT                   /note="best non-GAS blastp hit: gb|AAL04080.1|AF397166_5
FT                   (AF397166) AtmE [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78842"
FT                   /db_xref="GOA:Q8K8K7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8K7"
FT                   /protein_id="AAM78842.1"
FT                   /translation="MSQLIQTYLPNVYELGWSGDAGWGLAIWNTLYMTIVPFIVGGAIG
FT                   LLLGLLLVLTGPDGVIENKTICWVIDKVTSIFRAIPFVILIAILASFTYLLLRTTLGAT
FT                   AALVPLTFATFPFYARQVQVVFSELDKGVIEAAQASGATFWDIVKVYLSEGLPDLIRVS
FT                   TVTLISLVGETAMAGAIGAGGLGNVAISYGYNRFNNDVTWVATIIILLIIFAIQFIGDS
FT                   LTRRFSHK"
FT   gene            complement(275216..276586)
FT                   /gene="braB"
FT                   /locus_tag="SpyM3_0236"
FT   CDS             complement(275216..276586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="braB"
FT                   /locus_tag="SpyM3_0236"
FT                   /product="putative branched-chain amino acid transport
FT                   protein"
FT                   /note="best non-GAS blastp hit: dbj|BAB41401.1| (AP003129)
FT                   ORFID:SA0180 hypothetical protein; similar to
FT                   branched-chain amino acid transport system carrier protein
FT                   [Staphylococcus aureus subsp. aureus N315], and
FT                   dbj|BAB56348.1| (AP003358) hypothetical protein
FT                   [Staphylococcus aureus subsp.aureus Mu50]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78843"
FT                   /db_xref="GOA:Q8K8K6"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8K6"
FT                   /protein_id="AAM78843.1"
FT                   /translation="MKQKNVYIVIGFMLFALFFGAANLIYPAFLGIYSGHQILWSIIGF
FT                   CLTGVSLPLLGVIAVAKSGSGDVESLARPISKWYAIFYSSILYLSIGPFFAIPRTGATS
FT                   FSVGIAPILGDNATNKAIYAILFFGLSYFLAIKPSKLAENIGKFLTPTLLVVISILVIA
FT                   SFVHPAGNYGDTFNAGVGVNNAFKDFPFIAGLIQGYGTMDALASLVFAILVIEATKQFG
FT                   AKTDKEVTKITLISGAIAILLLALVYIFVGRIGATSQSLFPFSDGSFTLHGNPVNGGQI
FT                   LSHASRFYLGGIGQAFLAVVIFLACLTTSTGLITSSAEYFHKLVPALSHIAWATIFTLL
FT                   SAFFYFGGLSVIINWSAPVLFLLYPLTVDLIFLVLAQKCFNNDPIVYRTTIGLTFIPAI
FT                   FDALLTLSQMTGLFHLPEAVVTFFQKTVPLGQFSMGWIIFAAIGFLIGLILSKTKKS"
FT   gene            276895..278034
FT                   /locus_tag="SpyM3_0237"
FT   CDS             276895..278034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0237"
FT                   /product="putative sodium/dicarboxylate symporter"
FT                   /note="best non-GAS blastp hit: gb|AAF95950.1| (AE004347)
FT                   sodium/dicarboxylate symporter [Vibrio cholerae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78844"
FT                   /db_xref="GOA:P0DF78"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF78"
FT                   /protein_id="AAM78844.1"
FT                   /translation="MLGILAPDLTGFSILGKLFVGGLKAIAPLLVFALVSQAISHQKKG
FT                   KQTNMTLIIVLYLFGTFASALVAVLTAYLFPLTLVLNTPVNTELSPPQGVAEVFQSLLL
FT                   KLVDNPINALATANYIGVLSWAIIFGLALKAASQETKHLIKTAAEVTSQIVVWIINLAP
FT                   IGIMSLVFTTISENGVGILSDYAFLILVLVGTMVFVALVVNPLIAVLITRQNPYPLVLR
FT                   CLRESGLTAFFTRSSAANIPVNMQLCQKIGLSKDTYSVSIPLGATINMGGAAITINVLT
FT                   LAAVHTFGIPIDFLTALLLSVVAAVSACGASGVAGGSLLLIPVACSLFGISNDLAMQVV
FT                   GVGFIVGVIQDSCETALNSSTDVLFTAIAENAFWKRKKA"
FT   gene            complement(278089..278763)
FT                   /locus_tag="SpyM3_0238"
FT   CDS             complement(278089..278763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to potassium uptake protein; best non-GAS
FT                   blastp hit: gb|AAK98875.1| (AE008391) Trk transporter NAD+
FT                   binding protein - K+ transport [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78845"
FT                   /db_xref="GOA:Q7CFG1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFG1"
FT                   /protein_id="AAM78845.1"
FT                   /translation="MLKRKTVGVLGLGIFGRTVARELSNFDQDVIAIDIRESHVKEVAD
FT                   LVTKAAVGDITDKEFLLAVGIEHCDTVVIASGNNLESSVLAVMHCKKLGVPTIIAKAKN
FT                   KIFEEVLYGIGATKVITPERDSGKRVASNLLRRHIESIIYLEHGISMIEFVIPKSWEGQ
FT                   SLSELDVRRKYELNVIGMRQKEVKTLDTNVKPFEPLEPNTIIVAIANDHTFEKFDYLGY
FT                   LK"
FT   gene            complement(278773..280164)
FT                   /locus_tag="SpyM3_0239"
FT   CDS             complement(278773..280164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0239"
FT                   /product="putative potassium uptake protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74267.1| (AE007325)
FT                   potassium uptake protein, Trk family [Streptococcus
FT                   pneumoniae TIGR4], and gb|AAK98874.1| (AE008391) Trk
FT                   transporter membrane-spanning protein - K+ transport
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78846"
FT                   /db_xref="GOA:Q8K8K4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8K4"
FT                   /protein_id="AAM78846.1"
FT                   /translation="MSGGNMKRSFIKSLSVTQRLTFSFAIVILIGTLLLSMPFTHYQNG
FT                   PNTVYLDHFFNVVSMVCVTGLSVVPVAEVYNGIGQTIAMALMQIGGLGLVTLIAVSTFA
FT                   LKRKMRLSDQTLLQSALNRGDSKDLKHYLFFAYKVTFSLEAFAALVIMIDFIPRFGWKN
FT                   GIFNSIFLAVSAFCNAGFDNLGSSSLKDFMLNPTLNVIITFLIISGGLGFAVWVDLGVA
FT                   FKKYFFERPHCYGATFRKLSNQSRLVLQTTAVILFLGTFLTWFLEKDNSKTIANFSLHQ
FT                   QLMVSFFQTVTMRTAGFATISYNDTLAPTNILYMIQMVIGGAPGGTAGGIKVTTAAITF
FT                   LLFKAELSGQSEVTFRNRIIANKTIKQTMTVLIFFFAVLMIGFILLLSVEPHIAPIPLL
FT                   FESISAIATVGVSMDLTPQLSNAGRLIVIVLMFVGRVGPITVLISLIQRKEKTIQYATT
FT                   DILVG"
FT   gene            complement(280233..280946)
FT                   /gene="gidB"
FT                   /locus_tag="SpyM3_0240"
FT   CDS             complement(280233..280946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="SpyM3_0240"
FT                   /product="putative glucose inhibited division protein B"
FT                   /note="best non-GAS blastp hit: gb|AAK99967.1| (AE008489)
FT                   Glucose inhibited division protein B [Streptococcus
FT                   pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78847"
FT                   /db_xref="GOA:P0DF44"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF44"
FT                   /protein_id="AAM78847.1"
FT                   /translation="MTPQDFYRTLEEDGFSLSSKQKEQFDTYFKLLVEWNTKINLTAIT
FT                   EENEVYLKHFYDSIAPILQGFLANEPIKLLDIGAGAGFPSLPMKILFPNLEVTIIDSLN
FT                   KRISFLTLLAQELGLENVHFFHGRAEDFGQDKAFRGQFDVVTARAVARMQVLSELTIPF
FT                   LKIGGKLIALKAQAADQELEEAKNALCLLFGKVIKNHSYQLPNGDSRFITIVEKKKETP
FT                   NKYPRKAGLPNKKPL"
FT   gene            281096..281653
FT                   /gene="lemA"
FT                   /locus_tag="SpyM3_0241"
FT   CDS             281096..281653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /locus_tag="SpyM3_0241"
FT                   /product="putative cytoplasmic membrane protein"
FT                   /note="best non-GAS blastp hit: gb|AAL04087.1|AF397166_12
FT                   (AF397166) LemA-like protein [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78848"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFG0"
FT                   /protein_id="AAM78848.1"
FT                   /translation="MPTVLIILVVLGVLALWLMISYNSLVKSRMHTKEAWSQIDVQLKR
FT                   RNDLIPNLIETVKGYASYEQKTFEKITDLRARVANASTPQETMAASNELSKQVTSLFAV
FT                   AENYPDLKANENFLKLQEELTNTENKISYSRQLYNSTTSNYNLQLESFPSNIAGKLFGF
FT                   KPSEFLQTPEAEKEVPKVEFNF"
FT   gene            281700..282596
FT                   /gene="htpX"
FT                   /locus_tag="SpyM3_0242"
FT   CDS             281700..282596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="SpyM3_0242"
FT                   /product="putative heat shock protein"
FT                   /note="best non-GAS blastp hit: gb|AAL04088.1|AF397166_13
FT                   (AF397166) protease HtpX-like protein [Streptococcus
FT                   mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78849"
FT                   /db_xref="GOA:P0DD30"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD30"
FT                   /protein_id="AAM78849.1"
FT                   /translation="MLYQQISQNKQRTVVLLVVFFALLALIGASAGYLLLDNYAMGLVL
FT                   ALVIGVIYATSMIFQSTSLVMSMNSAREVTEKEAPGFFHIVEDMAMVAQIPMPRVFIIE
FT                   DPSLNAFATGSSPQNAAVAATTGLLEVMNREELEGVIGHEISHIRNYDIRISTIAVALA
FT                   SAVTVISSIGGRMLWYGGGSRRQRDDGDDDVLRIITLLLSLLSLLLAPLVASLIQLAIS
FT                   RQREYLADASSVELTRNPQGMIKALEKLQLSQPMKHPVDDASAALYINEPRKKRSFSSL
FT                   FSTHPPIEERIERLKNM"
FT   gene            282830..283363
FT                   /locus_tag="SpyM3_0243"
FT   CDS             282830..283363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAG32547.1| (U12643)
FT                   YlbN-like hypothetical protein [Streptococcus gordonii]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78850"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8K1"
FT                   /protein_id="AAM78850.1"
FT                   /translation="MLAISEIRKHPDGLSFDRLCDVKSMLLERDQQIIDIKAVKAVGNV
FT                   RYDKGLYLLDYQLSYEVILPSSRSMVPVCLSEVQHIQELFIEATDLADKKELVEDNLVL
FT                   VLDKDAINLEESIVDNILLAIPLQVLTEEEKKSKELPAGQNWAVLTEEDYQCLKEEKQK
FT                   ENNPFASLQGLFDE"
FT   gene            283631..284317
FT                   /gene="csrR"
FT                   /locus_tag="SpyM3_0244"
FT   CDS             283631..284317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrR"
FT                   /locus_tag="SpyM3_0244"
FT                   /product="two-component response regulator"
FT                   /note="best blastp hit: gb|AAC64935.1| (AF082668) CsrR
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78851"
FT                   /db_xref="GOA:Q7CFF9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFF9"
FT                   /protein_id="AAM78851.1"
FT                   /translation="MTKKILIIEDEKNLARFVSLELQHEGYEVIVEVNGREGLETALEK
FT                   EFDLILLDLMLPEMDGFEVTRRLQTEKTTYIMMMTARDSIMDVVAGLDRGADDYIVKPF
FT                   AIEELLARIRAIFRRQDIESEKKVPSQGIYRDLVLNPQNRSVNRGDDEISLTKREYDLL
FT                   NILMTNMNRVMTREELLSNVWKYDEAVETNVVDVYIRYLRGKIDIPGKESYIQTVRGMG
FT                   YVIREK"
FT   gene            284323..285825
FT                   /gene="csrS"
FT                   /locus_tag="SpyM3_0245"
FT   CDS             284323..285825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrS"
FT                   /locus_tag="SpyM3_0245"
FT                   /product="two-component sensory transduction histidine
FT                   kinase"
FT                   /note="best blastp hit: gb|AAC64936.1| (AF082668) CsrS
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78852"
FT                   /db_xref="GOA:Q8K8K0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8K0"
FT                   /protein_id="AAM78852.1"
FT                   /translation="MENQKQKQKKYKNSLPKRLSNIFFVLFFCIFSAFTLIAYSSTNYF
FT                   LLKKEKQSVFQAVNIVRVRLSEVDSNFTLENLAEVLYKNDKTHLRIDDRKGSRVIRSER
FT                   DITNTLDANQDIYVYNIDKQMIFTTDNEESSPGLHGPIGRVYHDHIEDQYRGFSMTQKV
FT                   YSNRTGKFVGYVQVFHDLGNYYVIRARLLFWLLVVELFGTSLAYLIILITTRRFLKPLH
FT                   NLHEVMRNISENPNNLNLRSDISSGDEIEELSVIFDNMLDKLETHTKLQSRFISDVSHE
FT                   LRTPVAIIKGHIGLLQRWGKDDSDILEESLTATAHEADRMAIMINDMLDMIRVQGSFEG
FT                   HQNDMTVLEDSIETVVGNFRVLREDFIFTWQSENPKTIARIYKNHFEQALMILIDNAVK
FT                   YSRKEKKIAINLSVTGKQEAIVRVQDKGEGISKEDIEHIFERFYRTDKSRNRTSTQAVL
FT                   GIGLSILKQIVDGYHLQMKVESELNEGSVFILHIPLAQSKES"
FT   gene            286040..286534
FT                   /locus_tag="SpyM3_0246"
FT   CDS             286040..286534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75791.1| (AE007464)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78853"
FT                   /db_xref="GOA:P0DC74"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC74"
FT                   /protein_id="AAM78853.1"
FT                   /translation="MRCPKCNYHKSSVVDSRQAEDGNTIRRRRECEQCHTRFTTFERVE
FT                   ELPLLVIKKDGTREQFSRDKILNGVVQSAQKRPVSSTDIENVISRIEQEVRTTYENEVS
FT                   STAIGNLVMDELAELDEITYVRFASVYKSFKDVDEIEELLQQITNRVRGKKKRLNNDET
FT                   N"
FT   gene            286518..287693
FT                   /gene="dnaB"
FT                   /locus_tag="SpyM3_0247"
FT   CDS             286518..287693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="SpyM3_0247"
FT                   /product="putative chromosome replication initiation
FT                   protein/membrane attachment protein"
FT                   /note="best non-GAS blastp hit: gb|AAL00360.1| (AE008523)
FT                   Chromosome replication initiation protein/membrane
FT                   attachment protein, Putative [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78854"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8J9"
FT                   /protein_id="AAM78854.1"
FT                   /translation="MMKPIDTFTYLKRNKVTLDSVTLIQLYFPIIGSDAASIYQYFIHF
FT                   FDDGLQRHKFSDILNHLQFGMKRFEDALAILTAMELVSVYQLSDTYLITLHQPLSRDLF
FT                   FQHPAYSRLLEQKIGEVAVSELQVTVPSQARNISKRFSDIFGVQGNLTNVPQKPQKNFD
FT                   LSSFQQLMVRDGLQFEDNQKDIISLYSIAEQYDMTWFDTYQIAKATAVNGKIRPERLLA
FT                   KKNQSMTKPSKENFSQAEQIILREAKQDSALVFLEKIKKARRATITKDERILLQTLAKM
FT                   NFLDDVINVMVLYTFNKTKSANLQKSYVLKMANDFAYQKVSTAEEAIVVLRAFTDRQSR
FT                   RQSKVKISQSNVPKWSNPDYQETTSQEEQAKLDQFKQAALKRLENLGKGGD"
FT   gene            287694..288596
FT                   /gene="dnaI"
FT                   /locus_tag="SpyM3_0248"
FT   CDS             287694..288596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaI"
FT                   /locus_tag="SpyM3_0248"
FT                   /product="putative primosome component"
FT                   /note="helicase loader; best blastp hit: gb|AAK33392.1|
FT                   (AE006498) putative primosome component (helicase loader)
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78855"
FT                   /db_xref="GOA:Q7CFF8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR009928"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:2QGZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFF8"
FT                   /protein_id="AAM78855.1"
FT                   /translation="MEKIGETMAKLGQNTRVNSDQLIQTILADPEVASFISQHHLSQEQ
FT                   INLSLSKFNQFLVERQKYQLKDPSYIAKGYQPILAMNEGYADVSYLETKELVEAQKQAA
FT                   ISERIQLVSLPKSYRHIHLSDIDVNNASRMEAFSAILDFVEQYPSAEQKGLYLYGDMGI
FT                   GKSYLLAAMAHELSEKKGVSTTLLHFPSFAIDVKNAISNGSVKEEIDAVKNVPVLILDD
FT                   IGAEQATSWVRDEVLQVILQYRMLEELPTFFTSNYSFADLERKWATIKGSDETWQAKRV
FT                   MERVRYLAREFHLEGANRR"
FT   gene            288659..289969
FT                   /gene="pgdA"
FT                   /locus_tag="SpyM3_0249"
FT   CDS             288659..289969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgdA"
FT                   /locus_tag="SpyM3_0249"
FT                   /product="putative phosphoglycerate dehydrogenase"
FT                   /note="best non-GAS blastp hit: gb|AAK75787.1| (AE007464)
FT                   phosphoglycerate dehydrogenase-related protein
FT                   [Streptococcus pneumoniae TIGR4], and gb|AAL00357.1|
FT                   (AE008523) Phosphoglycerate dehydrogenase [Streptococcus
FT                   pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78856"
FT                   /db_xref="GOA:P0DA90"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA90"
FT                   /protein_id="AAM78856.1"
FT                   /translation="MVLPTVAIVGRPNVGKSTLFNRIAGERISIVEDVEGVTRDRIYAT
FT                   GEWLNRQFSLIDTGGIDDVDAPFMEQIKHQAQIAMEEADVIVFVVSGKEGVTDADEYVS
FT                   KILYRTNTPVILAVNKVDNPEMRNDIYDFYSLGLGDPYPVSSVHGIGTGDVLDAIVENL
FT                   PVEEAEENDDIIRFSLIGRPNVGKSSLINAILGEDRVIASPVAGTTRDAIDTHFTDADG
FT                   QEFTMIDTAGMRKSGKIYENTEKYSVMRAMRAIDRSDVVLMVINAEEGIREYDKRIAGF
FT                   AHEAGKGMIIVVNKWDAIDKDNHTVAKWEADIRDQFQFLTYAPIIFVSALTKQRLNKLP
FT                   DLIKRISESQNKRIPSAVLNDVIMDAIAINPTPTDKGKRLKIFYATQVSVKPPTFVVFV
FT                   NEEELMHFSYLRFLENQIRAAFTFEGTPIHLIARKRK"
FT   gene            290176..293274
FT                   /gene="snf"
FT                   /locus_tag="SpyM3_0250"
FT   CDS             290176..293274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snf"
FT                   /locus_tag="SpyM3_0250"
FT                   /product="putative SNF helicase"
FT                   /note="best blastp hit: gb|AAK33394.1| (AE006498) putative
FT                   SNF helicase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78857"
FT                   /db_xref="GOA:Q8K8J7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013663"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8J7"
FT                   /protein_id="AAM78857.1"
FT                   /translation="MMARLIPGRVRNEGIKLYEQGLVSFQDDNKGILQIEVETYQVQYG
FT                   ADDEDITCQCDTFHMKHYCKHIAAVEYFLKNDQKGKLFLKQLTNQTKIKETTKKMTSFG
FT                   SLFLDSLAMNEDDSVKYRLSALGSRSPFSSDYWWSLKINRLPDDRSYVIRDIKGFLQLI
FT                   KKEGFYQIGKNYFEQLSWLQFDPSSQDLIEFLWRLASDTDKGDNENIFPNHARHLRLPS
FT                   GFFEEGVHYLTSLYDFTFEGPSQTYHHLFVRSLEAEAGLYEFKVEVHRKSIELQIAEKN
FT                   VQYLFDNDYLLYQDTFYHLTLKQRKMVQAIRSLPIEADLAKHIHFDLDDHAKLAASLSD
FT                   FKQIGLVEAPKSFAIRDFEVTFQFDLLNRDEISCQLMFDYGNYQVSDKASLEALPFASH
FT                   LKKEEKINRSLLAFGFSPQFYSKKRLTSAKELYTFFEETVPCFERLGNVALSTAIQALQ
FT                   VKEMPKIAIKRNQGLLDISFDFSTIIENDIDQAVTALFQNNPYFVSQTGQLVVFDDETQ
FT                   KVSKSLQELRARQLKNGHLQLDGIRALQVSKLFEGMTSVHFSKELEELAYHLQHPETFS
FT                   IKPLPVKAQMRDYQRNGVQWLSMLNHYGFGGILADDMGLGKTLQTLAFLASHLKSDSKV
FT                   LILSPSSLIYNWFDECQKFTPQLDVVVSYGLKQTRDQIIEEGHQITITSYSSFRQDFET
FT                   YQAFHYDYLILDEAQVIKNAQTKISHCLRAFNTANCFALSGTPIENKMLEIWSIFQIVL
FT                   PGLLPTKKEFLKLTAEQVSRYIKPFVMRRKKEDVLPELPDLIETNYSNEMTDEQKAIYL
FT                   AQLRQMQDQIRNSSDVDISRQKIEILSGITRLRQICDTPSLFMDYQGESGKLDSLRILL
FT                   TQIKENGHRALIFSQFRGMLDLAKQEMTALGLTSYQMTGSTPANERQEMTRAFNNGSKD
FT                   AFLISLKAGGVGINLTGADTVILIDLWWNPAVEMQAISRAYRIGQKENVEVYRLITRGT
FT                   IEEKILELQESKRNLVTTVLDGNESRASMSIEEIKEILGLNTH"
FT   gene            293518..294120
FT                   /locus_tag="SpyM3_0251"
FT   CDS             293518..294120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAL00178.1| (AE008507)
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78858"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8J6"
FT                   /protein_id="AAM78858.1"
FT                   /translation="MVKNQFPLVADGIAISDPAKQMALYENEDLITNIRGYYQDKEYDD
FT                   IARNEEFTAKATSRQAPSSKRFCSNDEKHHYVKEARQKAKQDLKEKRQAYLAKEMAYVP
FT                   KQVSKKQQPADSSPSQKQATTEMSRFTKKLHQDNYILAELPKEYKEPKNLPQQGTTKKN
FT                   NYDFLKSSQIYNNKEMRQQREKTIAQELNLSRFEDLP"
FT   gene            294160..295488
FT                   /gene="murC.1"
FT                   /locus_tag="SpyM3_0252"
FT   CDS             294160..295488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC.1"
FT                   /locus_tag="SpyM3_0252"
FT                   /product="putative UDP-N-acetyl muramate-alanine ligase"
FT                   /note="best blastp hit: gb|AAK33396.1| (AE006499) putative
FT                   UDP-N-acetyl muramate-alanine ligase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78859"
FT                   /db_xref="GOA:P0DC50"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC50"
FT                   /protein_id="AAM78859.1"
FT                   /translation="MSKTYHFIGIKGSGMSALALMLHQMGHKVQGSDVEKYYFTQRGLE
FT                   QAGITILPFSEDNITPDMELIVGNAFRENNKEVAYALRHQIPFKRYHDFLGDFMKSFIS
FT                   FAVAGAHGKTSTTGLLSHVLKNITDTSYLIGDGTGRGSANAQYFVFESDEYERHFMPYH
FT                   PEYSIITNIDFDHPDYFTGIADVRNAFNDYAKQVKKALFVYGEDDELKKIEAPAPIYYY
FT                   GFEEGNDFIAYDITRTTNGSDFKVKHQGEVIGQFHVPAYGKHNILNATAVIANLFVAGI
FT                   DMALVADHLKTFSGVKRRFTEKIINDTIIIDDFAHHPTEIVATIDAARQKYPSKEIVAI
FT                   FQPHTFTRTIALLEDFACALNEADSVYLAQIYGSAREVDKGEVRVEDLAAKIIKPSQVV
FT                   TVENVSPLLDHDNAVYVFMGAGDIQLYEHSFEELLANLTKNNQ"
FT   gene            295534..296016
FT                   /locus_tag="SpyM3_0253"
FT   CDS             295534..296016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0253"
FT                   /product="putative arylalkylamine n-acetyltransferase"
FT                   /note="best blastp hit: gb|AAK33397.1| (AE006499) putative
FT                   arylalkylamine n-acetyltransferase [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78860"
FT                   /db_xref="GOA:F7ITM7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:F7ITM7"
FT                   /protein_id="AAM78860.1"
FT                   /translation="MLIRQVQGSDLEVIATIESDNFSPQEATTRAVLEERIRLIPDTFL
FT                   VALIDQEIVGYIEGPVVTTPILEDSLFHGVTKNPKTGGYIAITSLSIAKHFQQQGVGTA
FT                   LLAALKDLVVAQQRTGLILTCHDYLISYYEMNGFINQGISESQHGGTLWYQMIWKL"
FT   gene            296134..297702
FT                   /locus_tag="SpyM3_0254"
FT   CDS             296134..297702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0254"
FT                   /product="putative aminodeoxychorismate lyase"
FT                   /note="best blastp hit: gb|AAK33398.1| (AE006499) putative
FT                   aminodeoxychorismate lyase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78861"
FT                   /db_xref="GOA:Q8K8J4"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8J4"
FT                   /protein_id="AAM78861.1"
FT                   /translation="MTDFKDKDQQDQQRSFKEQILAELEKANQIRKEKEEELFQKELEA
FT                   KEAARRTAQLYAEYKRQDAFQKESIAHNNKTAKHFQAIKDAVMTSEALKPTLLSEKENS
FT                   SLKTTNKRVVQANELQETASKESQVPLTIEKGHSVRRKLSKRQQTERAAKKISTVLISS
FT                   IMITLLAVTLAGAGYVYSALNPVDKNSDAFVQVEIPSGSGNKLIGQILQKKGLIKNSTV
FT                   FSFYTKFKNFTNFQSGYYNLQKSMSLEEIASALQEGGTAEPTKPSLGKILIPEGYTIKQ
FT                   IAKAVEHNSKGKTKKAKTPFNEKDFLDLVTDEAFIQDMVKRYPKLLATIPTKEKAIYRL
FT                   EGYLFPATYNYYKETTMRELVEDMLAAMDATLVPYYDKIAASGKTVNEVLTLASLVEKE
FT                   GSTDDDRRQIASVFYNRLNSGMALQSNIAILYAMGKLGEKTTLAEDATIDTTINSPYNI
FT                   YTNTGLMPGPVASSGVSAIEATLNPASTDYLYFVANVHTGEVYYAKTFEEHSANVEKYV
FT                   NSQIQ"
FT   gene            297775..298257
FT                   /gene="greA"
FT                   /locus_tag="SpyM3_0255"
FT   CDS             297775..298257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="SpyM3_0255"
FT                   /product="putative transcription elongation factor"
FT                   /note="best non-GAS blastp hit: gb|AAL00173.1| (AE008506)
FT                   Transcription elongation factor GreA [Streptococcus
FT                   pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78862"
FT                   /db_xref="GOA:P0DB46"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DB46"
FT                   /protein_id="AAM78862.1"
FT                   /translation="MAEKTYPMTLTEKEQLEKELEELKLVRRPEIVERIKIARSYGDLS
FT                   ENSEYDAAKDEQAFVEGQISTLETKIRYAEIIDSDAVAKDEVAIGKTVIVQEVGTTDKD
FT                   TYHIVGAAGADIFSGKISNESPIAQALIGKKTGDKVRIESPAATYDVEIISVEKTN"
FT   gene            complement(298881..299804)
FT                   /locus_tag="SpyM3_0256"
FT   CDS             complement(298881..299804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0256"
FT                   /product="putative SpoIIIJ family protein"
FT                   /note="best non-GAS blastp hit: gb|AAK76042.1| (AE007487)
FT                   SpoIIIJ family protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78863"
FT                   /db_xref="GOA:P0DC88"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC88"
FT                   /protein_id="AAM78863.1"
FT                   /translation="MKLTLNRILFSGLALSILFTLTGCVGRDAHGNPKGMIWEFLGKPM
FT                   SYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQSWKASYQSEKMAFLKPVFEPIN
FT                   KRIKQANSQEEKMAAQTELMAAQRAHGINPLGGIGCLPLLIQMPFFSAMYFAAQYTKGV
FT                   STSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQREQMKTMMYTMPIMMIFMS
FT                   FSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEYAKNPPKAYQSTSSRKDVT
FT                   PSQNMEQANLPKKIKSNRNAGKQRKR"
FT   gene            complement(299886..300164)
FT                   /locus_tag="SpyM3_0257"
FT   CDS             complement(299886..300164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0257"
FT                   /product="putative acylphosphate phosphohydrolase"
FT                   /note="best non-GAS blastp hit: gb|AAL00592.1| (AE008543)
FT                   Acylphosphate phosphohydrolase [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78864"
FT                   /db_xref="GOA:F7IUT0"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="UniProtKB/TrEMBL:F7IUT0"
FT                   /protein_id="AAM78864.1"
FT                   /translation="MQKVRLIVSGRVQGVGFRYATHTLALDIGDIYGRVWNNNDGTVEI
FT                   LAQSKDSDKIATFIQEVRKGPSKWAKVTYVDVTMANFEDFQDFQIGN"
FT   gene            300424..301161
FT                   /locus_tag="SpyM3_0258"
FT   CDS             300424..301161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0258"
FT                   /product="putative spoU rRNA Methylase family protein"
FT                   /note="best non-GAS blastp hit: gb|AAK76040.1| (AE007487)
FT                   spoU rRNA Methylase family protein [Streptococcus
FT                   pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78865"
FT                   /db_xref="GOA:Q8K8J1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8J1"
FT                   /protein_id="AAM78865.1"
FT                   /translation="MVITSKANQLIKQTKKLLQKKHRKQSYLIEGWHLFEEAQKSGQVF
FT                   RHIFVLEEMAERLAGEQELVIVSPQVLKELTDSPSPQGIVAEVEIPKLAFPSDYKGKYL
FT                   VLEDVQDPGNLGTIIRTADAARFDGVFLSEKSADIYNQKTLRSMQGSHFHLPIWRTDVY
FT                   QLCRELQEYKTPILATTLSKKSVDYKSLTHHERLALVLGNEGQGISAEMAALADQLVHI
FT                   TMPGQAESLNVAVAAGILIFSLI"
FT   gene            301227..301700
FT                   /locus_tag="SpyM3_0259"
FT   CDS             301227..301700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK05836.1|AE006404_3
FT                   (AE006404) hypothetical protein [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78866"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8J0"
FT                   /protein_id="AAM78866.1"
FT                   /translation="MEHVGHLIAHPRFQKLSHIVQHQHSTRLEHSINVSYSSYKLAKRF
FT                   GWDAKSTARGGLLHDFFYYDWRVTKFNKGHAWVHPRIAVRNAKKLTELNKKEEDIILKH
FT                   MWGATIAFPRYKESYIVTMVDKYWAVKEAVTPLRQKWSNRRFLRRKTLQSHNR"
FT   gene            301715..302404
FT                   /locus_tag="SpyM3_0260"
FT   CDS             301715..302404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane spanning protein; best non-GAS
FT                   blastp hit: gb|AAK76039.1| (AE007487) membrane protein
FT                   [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78867"
FT                   /db_xref="GOA:P0DA10"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA10"
FT                   /protein_id="AAM78867.1"
FT                   /translation="MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLYPFRE
FT                   NLISILVNQPMIYYGAAIIELILVFVASGAARKNTPAALPIFLIYAALNGFTLSFIIVA
FT                   YAQTTVFQAFLSSAAVFFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGM
FT                   MSYVISVISVLIFSGLIASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLL
FT                   RIFGRND"
FT   gene            302582..302824
FT                   /locus_tag="SpyM3_0261"
FT   CDS             302582..302824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAL00500.1| (AE008535)
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78868"
FT                   /db_xref="GOA:P0DG86"
FT                   /db_xref="InterPro:IPR005359"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG86"
FT                   /protein_id="AAM78868.1"
FT                   /translation="MSTAIWILLLIVALGVGVFGGIFIARKQIEKEIGEHPRLTPEAIR
FT                   EMMSQMGQKPSEAKIQQTYRNIIKQSKAAVSKGKK"
FT   gene            303002..303796
FT                   /gene="glr"
FT                   /locus_tag="SpyM3_0262"
FT   CDS             303002..303796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr"
FT                   /locus_tag="SpyM3_0262"
FT                   /product="putative glutamate racemase"
FT                   /note="best non-GAS blastp hit: gb|AAK75953.1| (AE007479)
FT                   glutamate racemase [Streptococcus pneumoniae TIGR4], and
FT                   gb|AAL00499.1| (AE008534) Glutamate racemase [Streptococcus
FT                   pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78869"
FT                   /db_xref="GOA:P0CZ88"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CZ88"
FT                   /protein_id="AAM78869.1"
FT                   /translation="MDTRPIGFLDSGVGGLTVVCELIRQLPHEKIVYIGDSARAPYGPR
FT                   PKKQIKEYTWELVNFLLTQNVKMIVFACNTATAVAWEEVKAALDIPVLGVVLPGASAAI
FT                   KSTTKGQVGVIGTPMTVASDIYRKKIQLLAPSVQVRSLACPKFVPIVESNEMCSSIAKK
FT                   IVYDSLAPLVGKIDTLVLGCTHYPLLRPIIQNVMGPSVKLIDSGAECVRDISVLLNYFD
FT                   INGNYHQKAVKHRFFTTANPEIFQEIASIWLKQKINVEHVTL"
FT   gene            303793..304779
FT                   /locus_tag="SpyM3_0263"
FT   CDS             303793..304779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAL00498.1| (AE008534)
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78870"
FT                   /db_xref="GOA:P0DB58"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DB58"
FT                   /protein_id="AAM78870.1"
FT                   /translation="MSEKIYEYKDENNWFIGKMTGHNLISGWGVKHTTIKKIDDLLDGI
FT                   AATLDWENPKGYDVSVVRYQSPLSLITFIIDMINQETQREIKVTPHAGTILLIENAKLL
FT                   AVYLPEGGVSTATFFATSEQGFGDIILIATRNEGKTKEFRNLFGQLGYRVENLNDYPEL
FT                   PEVAETGTTFEENARLKAETISRLTGKMVLADDSGLKVDALGGLPGVWSARFSGPDATD
FT                   AKNNTKLLHELAMVFDQKKRSAQFHTTLVVAAPNKDSLVMEAEWPGYIATQPKGENGFG
FT                   YDPVFIVGETGRHAAELEADQKNQLSHRGQAVRKLMEVFPAWQAKQS"
FT   gene            304758..305279
FT                   /locus_tag="SpyM3_0264"
FT   CDS             304758..305279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAL00497.1| (AE008534)
FT                   Conserved hypothetical protein [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78871"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:F7ITH3"
FT                   /protein_id="AAM78871.1"
FT                   /translation="MASKTIIVMSDSHGDRDIVQAIKDKYLGQVDAIFHNGDSELNSSD
FT                   PIWAGIYVVGGNCDYDTGYPDRLVTQLGTVTIAQTHGHLYHINFTWDKLDYFAQEVAAD
FT                   ICLYGHLHRPAAWQVGQTLFMNPGSVTQPRGEINEKLYARVELTDTQIKVDYFTRDHKL
FT                   YPSLSKEFKR"
FT   gene            305276..305737
FT                   /locus_tag="SpyM3_0265"
FT   CDS             305276..305737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75950.1| (AE007478)
FT                   CBS domain protein [Streptococcus pneumoniae TIGR4], and
FT                   gb|AAL00496.1| (AE008534) Conserved hypothetical protein
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78872"
FT                   /db_xref="GOA:Q7CFF4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFF4"
FT                   /protein_id="AAM78872.1"
FT                   /translation="MIAKEFETFLMSHLDNYLIPEQDLAIFIDTHNADHVMLLLVSNGF
FT                   SRVPVITREKKYVGTISISDIMMYQSKRQLTDWEMSQTDIGEMVNTKIETISITSSLTE
FT                   IMHKLIDFPFLPVVDRANRFVGIITRKSILKAVNSLLHDFTDDYTIIKK"
FT   gene            305734..306480
FT                   /locus_tag="SpyM3_0266"
FT   CDS             305734..306480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0266"
FT                   /product="putative integrase/recombinase"
FT                   /note="phage integrase; best non-GAS blastp hit:
FT                   gb|AAK75949.1| (AE007478) integrase/recombinase, phage
FT                   integrase family [Streptococcus pneumoniae TIGR4, and
FT                   gb|AAL00495.1| (AE008534) Recombinase, site specific
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78873"
FT                   /db_xref="GOA:P0DH46"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR020876"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DH46"
FT                   /protein_id="AAM78873.1"
FT                   /translation="MKSYIEPFIASKALSQNSQKAYRYDLQQFCQLVGERVNQDKLLLY
FT                   QNSIANLSLSAKKRKLSTANQFLYYLYQIKYLNSYFRLTDTMKVMRTEKQQAAIINTDI
FT                   FYQKTPFVWGQLISLLILELGLTPSEVAGIEVANLDLSFQMLTLKTKKGVRVLPLSQIL
FT                   IPFLEQQLIGKEVYLFEHRGIPFSRQWFFNHLKTFVRSIGYEGLTAQKLREQFILKEKL
FT                   AGKSIIELSDILGLKSPVTLEKYYKS"
FT   gene            306480..307184
FT                   /locus_tag="SpyM3_0267"
FT   CDS             306480..307184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: emb|CAC19444.1| (AJ277490)
FT                   hypothetical protein [Streptococcus mitis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78874"
FT                   /db_xref="GOA:P0DF62"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF62"
FT                   /protein_id="AAM78874.1"
FT                   /translation="MDIKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETL
FT                   QVMKLEVAGDYMLMASQLMLIKSRRLLPKVVEHIEEEDLEQDLLEKIEEYSRFKAVSQA
FT                   LAKQHDQRAKWYSKPKQELIFEDAILQEDKTVMDLFLAFSNIMAAKRAVLKNNHTVIER
FT                   DDYKIEDMMASIKQRLEKENVISLSAIFEECQTLNEVISIFLASLELIKLHVVFVEQLS
FT                   NFGAIILRKEKK"
FT   gene            307181..307732
FT                   /locus_tag="SpyM3_0268"
FT   CDS             307181..307732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75947.1| (AE007478)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4], and gb|AAL00493.1| (AE008534) Conserved
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78875"
FT                   /db_xref="GOA:P0DF64"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF64"
FT                   /protein_id="AAM78875.1"
FT                   /translation="MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQK
FT                   YEKDQHSSLCLIETANTYRLVTKEGFAELLRAYAKTPMNQSLSRASLEVLSIVAYKQPI
FT                   TRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVGRPHLYATTDYFLDYMGINHLDEL
FT                   IEVSAVEPADEEIALFRTQD"
FT   gene            307852..308574
FT                   /locus_tag="SpyM3_0269"
FT   CDS             307852..308574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0269"
FT                   /product="putative ribosomal large subunit pseudouridine
FT                   synthase"
FT                   /note="best non-GAS blastp hit: gb|AAK75946.1| (AE007478)
FT                   ribosomal large subunit pseudouridine synthase B
FT                   [Streptococcus pneumoniae TIGR4], and gb|AAL00492.1|
FT                   (AE008534) Ribosomal large subunit pseudouridine synthase B
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78876"
FT                   /db_xref="GOA:Q8K8I4"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8I4"
FT                   /protein_id="AAM78876.1"
FT                   /translation="MRINKYIAHAGIASRRKAEELIKQGLVTLNGQVITDLATTVKSGD
FT                   VVEIEGSPIYNEEKVYYLLNKPRGAISSVSDDKGRKTVLDLLPQVKERIYPVGRLDWDT
FT                   SGVLILTNDGDFTDTMIHPRNEIDKVYLARVKGIATKENLRPLTRGIVIDGKKTKPARY
FT                   NIVRVEADKNRSIVELTIHEGRNHQVKKMFESVGLLVDKLSRTRFGTVDLKGLRPGEAR
FT                   RLNKKEISQLHNLANTKK"
FT   gene            308571..308834
FT                   /locus_tag="SpyM3_0270"
FT   CDS             308571..308834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75945.1| (AE007478)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78877"
FT                   /db_xref="GOA:P0DG88"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG88"
FT                   /protein_id="AAM78877.1"
FT                   /translation="MMKKLLIVSVKAYQKYISPLSPPSCRYKPTCSAYMLTAIEKHGTK
FT                   GILMGIARILRCHPFVAGGVDPVPEDFSLMRNKNTSKNAEKA"
FT   gene            309012..309560
FT                   /locus_tag="SpyM3_0271"
FT   CDS             309012..309560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0271"
FT                   /product="putative RNA methyltransferase"
FT                   /note="best non-GAS blastp hit: gb|AAK74644.1| (AE007360)
FT                   RNA methyltransferase, TrmH family [Streptococcus
FT                   pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78878"
FT                   /db_xref="GOA:Q8K8I3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8I3"
FT                   /protein_id="AAM78878.1"
FT                   /translation="MTTKELINKNDKVKKARNHIVLFQPQIPQNTGNIARTCAATNAPL
FT                   HIIKPMGFPIDDRKMKRAGLDYWDKLELHFYDHLEQFINQCHGQLHLISKFAVNNYSQA
FT                   TYADGDSHYFLFGREDTGLPEDFMREHAEKALRIPMNDEHVRSLNVSNTVCMVIYEALR
FT                   QQGFQGLELKHTYEYDKLK"
FT   gene            309870..310433
FT                   /locus_tag="SpyM3_0272"
FT   CDS             309870..310433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99237.1| (AE008423)
FT                   Conserved hypothetical protein [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78879"
FT                   /db_xref="GOA:Q7CFF3"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFF3"
FT                   /protein_id="AAM78879.1"
FT                   /translation="MSKTHKMIMIGILSAISFLLMLVSFAIIPGAAFLKIEFSIIPVLF
FT                   GLMIMDLKSAYLILLLRSLLKLFLNNRGVNDFIGLPMNIIAIALFVTAFALVWNRQKTL
FT                   SQYVFASLLGTGLLTFGMVVLNYTFAIPLYAIFANIDIRAYIGVTKYMMTMVIPFNLVE
FT                   GLIFAITFYFVYIASKPILERYLH"
FT   gene            310435..311088
FT                   /locus_tag="SpyM3_0273"
FT   CDS             310435..311088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0273"
FT                   /product="putative phosphatase"
FT                   /note="best non-GAS blastp hit: gb|AAK25787.1|AF336821_1
FT                   (AF336821) putative phosphatase [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78880"
FT                   /db_xref="GOA:Q7CFF2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFF2"
FT                   /protein_id="AAM78880.1"
FT                   /translation="MMTNKQTHFLIASFALLIFVIIGYTVKFFPERLALLDNTIQAEIR
FT                   GNLPIVLTQFFRGVTVFGNVMTQVLLVIVSVLVLFFMKWKIEALFILSNGAIAAFLITT
FT                   LKLFYQRPRPAIEHLVYAGGYSFPSGHAMGSMLIFGSLLIICYQRLHSKLLQFVTSMIF
FT                   IILILLIGLSRIYLGVHYPSDILAGFVLGFGILHFIYPFYKQKRFEWRFLLKQD"
FT   gene            311381..312301
FT                   /locus_tag="SpyM3_0274"
FT   CDS             311381..312301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK06364.1|AE006455_10
FT                   (AE006455) hypothetical protein [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78881"
FT                   /db_xref="GOA:Q7CFF1"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFF1"
FT                   /protein_id="AAM78881.1"
FT                   /translation="MKKRYQTLNEHYRQLFGAKMFKVPIDAGFDCPNRDGTVAHGGCTF
FT                   CTVSGSGDAIVAPDAPIKEQFYKEIDFMHRKWPDVNRYLVYFQNFTNTHDTVDVIRDRY
FT                   EQAINEPGVVGINIGTRPDCLPDDTIAYLAELSERMHVTVELGLQTTYEETSRLINRAH
FT                   SYDLYKETVRRLRHYPNINIVSHLINGLPKETHDMMLENVRRCVTDNDIQGIKLHLLHL
FT                   MTNTRMQRDYHEGRLKLLSQKDYVSIICDQLEIIPKHIVIHRITGDAPRDMLIGPMWSL
FT                   NKWEVLNAIDKEMERRGSFQGCKVD"
FT   gene            312340..312894
FT                   /locus_tag="SpyM3_0275"
FT   CDS             312340..312894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99375.1| (AE008436)
FT                   Conserved hypothetical protein [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78882"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVY7"
FT                   /protein_id="AAM78882.1"
FT                   /translation="MLKRPIHLSHDFLAEVVDKSSVVVDATMGNGNDTAFLAQLAKKVY
FT                   AFDVQEQAIRKTSERLAQLGLSNAELILAGHEAVDQYVTEPVRAAIFNLGYLPSADKSI
FT                   ITLPNTTLQALSKLLTLLMVGGRIAIMVYYGHDGGSLEKDALLDFVKQLDQRKVSAMLY
FT                   QPLNQVNTPPFLIMLEKLADV"
FT   gene            313027..314361
FT                   /gene="hlyX"
FT                   /locus_tag="SpyM3_0276"
FT   CDS             313027..314361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyX"
FT                   /locus_tag="SpyM3_0276"
FT                   /product="putative hemolysin"
FT                   /note="best non-GAS blastp hit: gb|AAC05772.1| (AF051356)
FT                   putative hemolysin [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78883"
FT                   /db_xref="GOA:F7IUK8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:F7IUK8"
FT                   /protein_id="AAM78883.1"
FT                   /translation="MEDPVSQPLVIQFLLLVVLTLLNAFFSASEMALVSLNRSRVEQKA
FT                   ADGDKKYARLLRVLEEPNHFLSTIQVGITFISLLSGASLSASLGKVISGWLGNSATART
FT                   AGTIISLVFLTYVSIVLGELYPKRIAMNLKDKLAIVSAPIIIGLGRLVSPFVWLLSAST
FT                   NLLSRLTPMTFDDADEQMTRDEIEYMLSKSEATLDAEEIEMLQGVFSLDEMMAREVMVP
FT                   RTDAFMIDINDDPLENIQEILKQSFSRIPVYDVDKDKIIGLIHTKRLLESGFRQGFDQI
FT                   NMRKMLQEPLFVPETIFVDDLLRQLRNTQNQMAILLDEYGGVAGLVTLEDLLEEIVGEI
FT                   DDETDKAEQFVHEIGDNTYIVVGTMTLNEFNDYFDTELESDDVDTIAGFYLTGIGTIPS
FT                   QEQKEAYEIDNKDKHLVLINDKVKDGRITKLKLILSNIEQIIEED"
FT   gene            314439..315230
FT                   /gene="pflC"
FT                   /locus_tag="SpyM3_0277"
FT   CDS             314439..315230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflC"
FT                   /locus_tag="SpyM3_0277"
FT                   /product="putative pyruvate formate-lyase activating
FT                   enzyme"
FT                   /note="best non-GAS blastp hit: dbj|BAB55635.1| (AB061728)
FT                   pyruvate formate-lyase activating enzyme [Streptococcus
FT                   bovis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78884"
FT                   /db_xref="GOA:Q7CFE8"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFE8"
FT                   /protein_id="AAM78884.1"
FT                   /translation="MTEKDYGQVTGMVHSTESFGSVDGPGIRFIIFLQGCKLRCQYCHN
FT                   PDTWEMETNNSKIRTVNDVLKEALQYKHFWGKKGGITVSGGEAMLQIDFITALFIEAKK
FT                   LGIHTTLDTCGFTYRPTPEYHQVLDNLLAVTDLILLDLKEIDEKQHKIVTRQPNKNILQ
FT                   FARYLSDKQIPVWIRHVLVPGLTDIDDHLTRLGEFVKTLKNVDKFEVLPYHTMGEFKWR
FT                   ELGIPYQLEGVKPPTKERVQNAKNLMQTESYTEYMNRIHQS"
FT   gene            315355..316296
FT                   /locus_tag="SpyM3_0278"
FT   CDS             315355..316296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0278"
FT                   /product="putative manganese-dependent inorganic
FT                   pyrophosphatase"
FT                   /note="intrageneric coaggregation-relevant adhesin; best
FT                   blastp hit: gb|AAK33422.1| (AE006501) putative
FT                   manganese-dependent inorganic pyrophosphatase (intrageneric
FT                   coaggregation-relevant adhesin) [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78885"
FT                   /db_xref="GOA:P0DD14"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR022934"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD14"
FT                   /protein_id="AAM78885.1"
FT                   /translation="MIMSKILVFGHQNPDTDAIASSYAFDYLSQKAFGLDTEVVALGTP
FT                   NEETAFALDYFGVEAPRVVESAKAQGSEQVILTDHNEFQQSIADIREVEVYGVVDHHRV
FT                   ANFETANPLYMRVEPVGSASSIVYRMFKENGIEVPKAIAGMLLSGLISDTLLLKSPTTH
FT                   VSDHLVAEELAELAEVNLEDYGMALLKAGTNLASKSEVELIGIDAKTFELNGNAVRVAQ
FT                   VNTVDIAEVLERQEAIEAAIKDAMAAEGYSDFVLMITDIVNSNSEILAIGANMDKVEAA
FT                   FNFTLDNNHAFLAGAVSRKKQVVPQLTESFGA"
FT   gene            316372..317025
FT                   /locus_tag="SpyM3_0279"
FT   CDS             316372..317025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK05909.1|AE006411_4
FT                   (AE006411) unknown protein [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78886"
FT                   /db_xref="InterPro:IPR014924"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8I1"
FT                   /protein_id="AAM78886.1"
FT                   /translation="MITVFHSDKLTRQPFFQDLINYLDQHDHVILREIKKAFPNVTGID
FT                   KAIESYVQAGYIRRENKRYGINLPLVSSDQQLALDTMLFVDTCSAMYENILAVVFETQL
FT                   TNQTNHVMIKEKTNITRDDLTLANYFYRLKRGEKPSAEQMDLYDLLGDVNQEYALKYMT
FT                   TFLLKFTRKDLVMQKRPDIFVEALVTLGYLKQVEPTTYQLLMSLDKESLTFIAP"
FT   gene            complement(317070..318071)
FT                   /gene="fhuG.1"
FT                   /locus_tag="SpyM3_0280"
FT   CDS             complement(317070..318071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuG.1"
FT                   /locus_tag="SpyM3_0280"
FT                   /product="putative ferrichrome ABC transporter (permease)"
FT                   /note="best non-GAS blastp hit: gb|AAK78764.1|AE007594_1
FT                   (AE007594) Ferrichrome transport permease [Clostridium
FT                   acetobutylicum]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78887"
FT                   /db_xref="GOA:Q8K8I0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8I0"
FT                   /protein_id="AAM78887.1"
FT                   /translation="MKSHRHLLGLYTSLILLLVSLMGLALSLGESHLSFLDLIHVFLGK
FT                   SSHAISFIVINIRLPRILAACLGGGSLALSGLLLQRLTRNPLADSGVLGITIGAGISLA
FT                   IVVSFSFFEQAHISHYLPLFAMLGAVVTTFSVYWLSLTKQGQIDPTRLILTGVAVTTML
FT                   SSLMVALVGHINRYKVDLVINWLSGQLIGDDWPTLSVIAPLLLCFWLLTYSQAHFLNIM
FT                   GLADNTAIGLGLPLNRKRRLILVLAAGLGALSVLLVGNISFIGLIAGHFSTYLVGSNHK
FT                   LTIPISILIGMILLLVADTVGRVYLVGSNIQTGILVSLIGAPYFLYLMAKTK"
FT   gene            complement(318068..319120)
FT                   /gene="fhuB"
FT                   /locus_tag="SpyM3_0281"
FT   CDS             complement(318068..319120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="SpyM3_0281"
FT                   /product="putative ferrichrome ABC transporter (permease)"
FT                   /note="best non-GAS blastp hit: gb|AAL40846.1|AF452237_3
FT                   (AF452237) FhuB [Streptococcus agalactiae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78888"
FT                   /db_xref="GOA:Q8K8H9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8H9"
FT                   /protein_id="AAM78888.1"
FT                   /translation="MKTKHPFLCLERFCLKKTQIITKSHIFWLVFVLLSFSLCVAIYCH
FT                   LRFGAVALSHQDLNSILFGKQNGHKANVLLAIRLPRLFGATLTGSALAVSGTIMQAITR
FT                   NPIAEPGLLGINAGAGLALVLAYAFVPHLHYSLIILLSLLGSSLAATLVFGLSYQSGKG
FT                   YHQLRLVLAGAMVSILLSALGQGITNYYHLANAVIGWQAGGLVGVNWQMIGYIAPLIIL
FT                   SLCLAQLLSYHLTVLSLSESQAKALGQKTNLISAVFMILVLILSSAAVAIAGSISFIGL
FT                   VIPHLMKHFTPHHYRYLLPLCAVSGASFMVWVDIACRNLNPPYETPLGALVSLIGFPCF
FT                   LWLIRRGGRY"
FT   gene            complement(319110..320042)
FT                   /gene="fhuD.1"
FT                   /locus_tag="SpyM3_0282"
FT   CDS             complement(319110..320042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD.1"
FT                   /locus_tag="SpyM3_0282"
FT                   /product="putative ferrichrome ABC transporter
FT                   (ferrichrome-binding protein)"
FT                   /note="best non-GAS blastp hit: gb|AAL40845.2|AF452237_2
FT                   (AF452237) FhuD [Streptococcus agalactiae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78889"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8H8"
FT                   /protein_id="AAM78889.1"
FT                   /translation="MKKLTLLLTLCLTTITLIACGNQATNHSNTASKSLSPMPQIAGVT
FT                   YYGDIPKQPKRVVSLASTYTGYLKKLDMNLVGVTSYDKKNPILAKTVKKAKQVAATDLE
FT                   AITTLKPDLIVVGSTEENIKQLAEIAPVISIEYRKRDYLQVLSDFGRIFNKEGKAKKWL
FT                   KDWKTKTAAYEKEVKAVTGDKATFTIMGLYEKDVYLFGKDWGRGGEIIHQAFHYDAPEK
FT                   VKTEVFKQGYLSLSQEVLPDYIGDYVVIAAEDDKTGSALYESKLWQSIPAVKKHHVIKV
FT                   NANVFYFTDPLSLEYQLETLREAILSSEN"
FT   gene            complement(320068..320850)
FT                   /gene="fhuC.1"
FT                   /locus_tag="SpyM3_0283"
FT   CDS             complement(320068..320850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC.1"
FT                   /locus_tag="SpyM3_0283"
FT                   /product="putative ferrichrome ABC transporter (ATP-binding
FT                   protein)"
FT                   /note="best non-GAS blastp hit: gb|AAL40844.1|AF452237_1
FT                   (AF452237) FhuC [Streptococcus agalactiae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78890"
FT                   /db_xref="GOA:Q8K8H7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8H7"
FT                   /protein_id="AAM78890.1"
FT                   /translation="MTTISAEDLTIAYEQRTIIDKLSFYIPEGKITTIIGANGCGKSSL
FT                   LKALTRLLPPKQGVVYLNGQNIATLETKEVAKKLALLPQVQEATNGITVYELVSYGRFP
FT                   HQSYFGNLSPADKKAIHWAMQATNVMAYADQPVDALSGGQRQRVWLAMALAQGTDTIFL
FT                   DEPTTYLDLNHQLEILELVKSLNKDAGKTIIMVLHDLNLSARYSDHLIAMKHGKIHYTG
FT                   TIADVMTSPIIQDIFQIKPVLVDDPIHNCPIVLTYQLQ"
FT   gene            complement(321096..322541)
FT                   /gene="murE"
FT                   /locus_tag="SpyM3_0284"
FT   CDS             complement(321096..322541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="SpyM3_0284"
FT                   /product="putative
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /note="best non-GAS blastp hit: gb|AAK75619.1| (AE007448)
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78891"
FT                   /db_xref="GOA:P0DC54"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC54"
FT                   /protein_id="AAM78891.1"
FT                   /translation="MITIEQLLDILKKDHNFREVLDADEYHYHYQGFSFERLSYDSRQV
FT                   DGKTLFFAKGATFKADYLKEAITNGLQLYISEVDYELGIPVVLVTDIKKAMSLIAMAFY
FT                   GNPQEKLKLLAFTGTKGKTTAAYFAYHMLKESYKPAMFSTMNTTLDGKTFFKSQLTTPE
FT                   SLDLFAMMAECVTNGMTHLIMEVSSQAYLVDRVYGLTFDVGVFLNISPDHIGPIEHPTF
FT                   EDYFYHKRLLMENSRAVVINSVMDHFSFLADQVADQEHVFYGPLSDNQITTSQAFSFEA
FT                   KGQLAGHYDIQLIGHFNQENAMAAGLACLRLGASLADIQKGIAKTRVPGRMEVLTMTNH
FT                   AKVFVDYAHNGDSLEKLLSVVEEHQTGKLMLILGAPGNKGESRRADFGRVIHQHPNLTV
FT                   ILTADDPNFEDPEDISKEIASHIARPVEIISDREQAIQKAMSLCQGAKDAVIIAGKGAD
FT                   AYQIVKGQQVAYAGDLAIAKHYL"
FT   gene            322629..324263
FT                   /locus_tag="SpyM3_0285"
FT   CDS             322629..324263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0285"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75618.1| (AE007448)
FT                   polysaccharide biosynthesis protein, putative
FT                   [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78892"
FT                   /db_xref="GOA:Q8K8H5"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8H5"
FT                   /protein_id="AAM78892.1"
FT                   /translation="MSTEKKQLTQEELMVQGAAWSTAGNFISRLLGVLYIIPWYIWMGQ
FT                   YAIQANALFNMGYNVYAYFLLISTTGLNVAIAKQVAKYNSMGQTEHSYQLIRSTLKLML
FT                   GLGLIFSAIMYLGSPLFASLSGGDDTLVPIMHSLSLAVFIFPVMSVIRGIFQGHNNIKP
FT                   YAISQIAEQLIRVIWMLLTTFLIMKLGSGDYASAVTQSTFAAFIGMVASMGVLGYYLWK
FT                   QGLLAAIFSKPDHTVSIDIKGLLLETLKESIPFIVTGSAIQAFQLIDQWTFVNTMTLFT
FT                   DYSRSQLLVLFGYFNANPAKITMVLIAVAASIGGVGIALLTENYVKKDMKAAARLIINN
FT                   IEMLVMFLLPALTGAIILARPLYSVFYGASEDRAIHLFVAVLFQTLLMALYTLFSPMLQ
FT                   ALFENRKAIYYFAYGILIKLVLQIPLIYLLHAYGPLLATTIALVVPIYLMYRRLYQVTH
FT                   FNRKLLQKRLLLTLIETLLMGLVVFVANWLLGYAFKPTGRLTSLLYLLIIGGLGMTVYT
FT                   ALTLLTHQLDKLIGSKASRLRQKLGWH"
FT   gene            324431..325060
FT                   /gene="upp"
FT                   /locus_tag="SpyM3_0286"
FT   CDS             324431..325060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="SpyM3_0286"
FT                   /product="putative uracil phosphoribosyltransferase"
FT                   /note="best non-GAS blastp hit: gb|AAA26890.1| (L07793)
FT                   uracil phosphoribosyltransferase [Streptococcus
FT                   salivarius]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78893"
FT                   /db_xref="GOA:P0DH34"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DH34"
FT                   /protein_id="AAM78893.1"
FT                   /translation="MGKCQVISHPLIQHKLSILRRQTTSTKDFRELVNEIAMLMGYEVS
FT                   RDLPLEDVDIQTPVSKTVQKQLAGKKLAIVPILRAGIGMVDGLLSLVPAAKVGHIGMYR
FT                   NEETLEPVEYLVKLPEDINQRQIFLVDPMLATGGSAILAVDSLKKRGAANIKFVCLVAA
FT                   PEGVKKLQEAHPDIDIFTAALDDHLNEHGYIVPGLGDAGDRLFGTK"
FT   gene            325283..325873
FT                   /gene="clpP.1"
FT                   /locus_tag="SpyM3_0287"
FT   CDS             325283..325873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP.1"
FT                   /locus_tag="SpyM3_0287"
FT                   /product="putative ATP-dependent Clp protease proteolytic
FT                   subunit"
FT                   /note="best non-GAS blastp hit: gb|AAA26891.1| (L07793)
FT                   ATP-dependent protease proteolytic subunit [Streptococcus
FT                   salivarius]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78894"
FT                   /db_xref="GOA:P0DA34"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA34"
FT                   /protein_id="AAM78894.1"
FT                   /translation="MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQ
FT                   LLFLDAQDNTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASS
FT                   GTKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRHRLEKILAQNAGKTIK
FT                   QIHKDAERDYWMSAEETLAYGFIDEIMENNELK"
FT   gene            326365..326640
FT                   /locus_tag="SpyM3_0288"
FT   CDS             326365..326640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74887.1| (AE007382)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4], and gb|AAK99461.1| (AE008443) Conserved
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78895"
FT                   /db_xref="GOA:P0DH02"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DH02"
FT                   /protein_id="AAM78895.1"
FT                   /translation="MFQKQERIGLVVYLYYNRDARKLSKFGDLYYHSKRSRYLIIYINK
FT                   NDLDTKLEEMRRLKCVKDIRPSAFDDIDRQFVGNLHRDETNNHQKG"
FT   gene            326889..327524
FT                   /gene="tmk"
FT                   /locus_tag="SpyM3_0289"
FT   CDS             326889..327524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="SpyM3_0289"
FT                   /product="putative thymidylate kinase"
FT                   /note="best non-GAS blastp hit: gb|AAK99639.1| (AE008459)
FT                   Thymidylate kinase [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78896"
FT                   /db_xref="GOA:P0DC02"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC02"
FT                   /protein_id="AAM78896.1"
FT                   /translation="MITGKLITVEGPDGAGKTTVLEQLIPLLKQKVAQEILTTREPGGV
FT                   AISEYIRELILDINHTTMDPKTELLLYIAARRQHLVEKVLPALEAGQLVFIDRFIDSSV
FT                   AYQGAGRGLIKADIQWLNEFATDGLEPDLTLYFDVPSEIGLARINANQQREVNRLDLET
FT                   IEIHQRVRKGYLALAKEHPKRIVTIDATKPLKEVVSVALEHVLTLLLA"
FT   gene            327542..328417
FT                   /locus_tag="SpyM3_0290"
FT   CDS             327542..328417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0290"
FT                   /product="putative DNA polymerase III delta prime subunit"
FT                   /note="best blastp hit: gb|AAF98347.2| (AF280763) DNA
FT                   polymerase III delta prime subunit [Streptococcus
FT                   pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78897"
FT                   /db_xref="GOA:Q8K8H3"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8H3"
FT                   /protein_id="AAM78897.1"
FT                   /translation="MDLAQKAPNVYQAFQTILKKDRLNHAYLFSGDFANEEMALFLAKV
FT                   IFCEQKKDQTPCGHCRSCQLIEQGDFADVTVLEPTGQVIKTDVVKEMMANFSQTGYENK
FT                   RQVFIIKDCDKMHVNAANSLLKYIEEPQGEAYMFLLTNDDNKVLPTIKSRTQVFQFPKN
FT                   EAYLYQLAQEKGLLNHQAKLVAKLATNTSHLERLLQTSKLLELITQAERFVSIWLKDQL
FT                   QAYLALNRLVQLATEKEEQDLVLTLLTLLLARERAQTPLTQLEAVYQARLMWQSNVNFQ
FT                   NILEYMVMSE"
FT   misc_feature    328436..329054
FT                   /note="region of degenerate sequence; contains several
FT                   small potential CDSs from both strands, none with good
FT                   blast hits"
FT   gene            329081..329404
FT                   /locus_tag="SpyM3_0291"
FT   CDS             329081..329404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99641.1| (AE008459)
FT                   Conserved hypothetical protein [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78898"
FT                   /db_xref="GOA:P0DH54"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DH54"
FT                   /protein_id="AAM78898.1"
FT                   /translation="MNKKELFDAFDGFSQNLMVTLAEIEAMKKQVQSLVEENTILRLEN
FT                   TKLRERLSHLEHETAAKNPSKQRKDHLEGIYDEGFHICNFFYGQRRENDEECMFCRELL
FT                   DRK"
FT   gene            329409..330272
FT                   /locus_tag="SpyM3_0292"
FT   CDS             329409..330272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0292"
FT                   /product="putative tetrapyrrole methylase family protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75062.1| (AE007398)
FT                   tetrapyrrole methylase family protein [Streptococcus
FT                   pneumoniae TIGR4], and gb|AAK99642.1| (AE008459) Conserved
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78899"
FT                   /db_xref="GOA:P0DF46"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF46"
FT                   /protein_id="AAM78899.1"
FT                   /translation="MQVQKSFKDKKTSGTLYLVPTPIGNLQDMTFRAVATLKEVDFICA
FT                   EDTRNTGLLLKHFDIATKQISFHEHNAYEKIPDLIDLLISGRSLAQVSDAGMPSISDPG
FT                   HDLVKAAIDSDITVVALPGASAGITALIASGLAPQPHVFYGFLPRKAGQQKAFFEDKHH
FT                   YPETQMFYESPYRIKDTLTNMLACYGDRQVVLVRELTKLFEEYQRGSISEILSYLEETS
FT                   LKGECLLIVAGAQVDSEVELTADVDLVSLVQKEIQAGAKPNQAIKTIAKAYQVNRQELY
FT                   QQFHDL"
FT   gene            330299..330691
FT                   /locus_tag="SpyM3_0293"
FT   CDS             330299..330691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0293"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33439.1| (AE006502)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78900"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFE7"
FT                   /protein_id="AAM78900.1"
FT                   /translation="MTEDQATILILGVYGIILAVFLLSALLCLIANWRLFKRAGYKGWY
FT                   SLIPFYAGFVKHKITFGEDNKWFYFIGWVIAIYYYYVHFCYVRAFGGSKGLAVFGLFFP
FT                   GIASLIVAFGKTYTTQECHPVPHLLN"
FT   gene            complement(330738..331367)
FT                   /locus_tag="SpyM3_0294"
FT   CDS             complement(330738..331367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0294"
FT                   /product="putative copper homeostasis protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75364.1| (AE007425)
FT                   copper homeostasis protein CutC [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78901"
FT                   /db_xref="GOA:Q8K8H0"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8H0"
FT                   /protein_id="AAM78901.1"
FT                   /translation="MIKEFCAENLTLLPTLDAGQVSRVELCNNLAVGGTTPSYGVIKEA
FT                   CQLLHDKKISVATMIRPRGGDFVYNDLELKAMEEDILKAVEAGSDALVLGLLTTENQLD
FT                   TDAIEQLLPATQGLPLVFHMAFDHIPTDHQHQALDQLIDYGFVRVLTHGSPEATPITDN
FT                   VEQLKSLVTYANKRIEIMIGGGVTAENCQSLSQLTGTAIVHGTKII"
FT   gene            331665..332021
FT                   /locus_tag="SpyM3_0295"
FT   CDS             331665..332021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0295"
FT                   /product="putative arsenate reductase"
FT                   /note="best blastp hit: gb|AAK33441.1| (AE006502) putative
FT                   arsenate reductase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78902"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8G9"
FT                   /protein_id="AAM78902.1"
FT                   /translation="MITIYQYPKCSTCQRAMAELKQLVSDFEAIDIKANPPKAQDLKHW
FT                   METSGYTIKNFFNTSGNSYRELGLKDKIDQLSLDKAAELLATDGMLIKRPILIKDGKVL
FT                   QVGYRKPYQELDLG"
FT   gene            complement(332095..332922)
FT                   /gene="exoA"
FT                   /locus_tag="SpyM3_0296"
FT   CDS             complement(332095..332922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /locus_tag="SpyM3_0296"
FT                   /product="putative 3'-exo-deoxyribonuclease"
FT                   /note="best blastp hit: gb|AAK33442.1| (AE006502) putative
FT                   3'-exo-deoxyribonuclease [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78903"
FT                   /db_xref="GOA:Q8K8G8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8G8"
FT                   /protein_id="AAM78903.1"
FT                   /translation="MKLISWNIDSLNAALTGESPRALLSRAVLDTLVAQDADIIAIQET
FT                   KLSAKGPTKKHIEALLSYFPNYLHVWRSSVEPARKGYAGTMFLYKNTLNPVITFPEIGA
FT                   PTTMDAEGRIITLEFEDFFVTQVYTPNAGDGLRRLDDRQIWDHKYADYLTELDAQKPVL
FT                   ATGDYNVAHKEIDLANPSSNRRSPGFTDEERQGFTNLLARGFTDTFRHVHGDIPHVYTW
FT                   WAQRSKTSKINNTGWRIDYWLASNRIVDKVKRSEMISSGERQDHTPILLDIDL"
FT   gene            333160..334341
FT                   /gene="lctO"
FT                   /locus_tag="SpyM3_0297"
FT   CDS             333160..334341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctO"
FT                   /locus_tag="SpyM3_0297"
FT                   /product="putative lactate oxidase"
FT                   /note="best non-GAS blastp hit: emb|CAA68903.1| (Y07622)
FT                   lactate oxidase [Streptococcus iniae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78904"
FT                   /db_xref="GOA:Q8K8G7"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014080"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8G7"
FT                   /protein_id="AAM78904.1"
FT                   /translation="MAQKTVITEETTDFVMDFKTSSAEGNVDFINVFDLEKMAQQVIPK
FT                   GAFGYIASGAGDTFTLHENIRSFNHKLIVPHSLKGVENPSTEITFDGDYLTSPLILAPV
FT                   AAHKLANEQGEVASAKGLKEFGSIYTTSSYSTTDLPEISAALGGTPHWFQFYYSKDDGI
FT                   NRNIMDRVKAQGCKAIVLTADATVGGNREVDRRNGFVFPVGMPIVQEYLPDGAGKTMDY
FT                   VYKSAKQALTSKDIEYIATYSGLPVYVKGPQCAEDTLRALDAGASGIWVTNHGGRQLDG
FT                   GPAAFDSLQEVAEAVDHKVPIVFDSGIRWGQHIFKALASGADLVALGRPAIYGLAMGGS
FT                   IGTRQVFEKLNDELKMVMQLAGTQTIQDVKAFNLRHNPYDSSIPFDQNALRLD"
FT   gene            334685..339553
FT                   /gene="prtS"
FT                   /locus_tag="SpyM3_0298"
FT   CDS             334685..339553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prtS"
FT                   /locus_tag="SpyM3_0298"
FT                   /product="putative cell envelope proteinase"
FT                   /note="best non-GAS blastp hit: gb|AAG09771.1|AF243528_1
FT                   (AF243528) cell envelope proteinase [Streptococcus
FT                   thermophilus]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78905"
FT                   /db_xref="GOA:Q8K8G6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8G6"
FT                   /protein_id="AAM78905.1"
FT                   /translation="MMMTTTVAADELTTTSEPTITNHTQQQAQHLTNTELSSAESKPQD
FT                   TSQITLKTNREKEQPQGLVSEPTTTELADTDAAPMANTGPDATQKSASLPPVNTDVHDW
FT                   VKTKGAWDKGYKGQGKVVAVIDTGIDPAHQSMRISDVSTAKVKSKEDMLARQKAAGINY
FT                   GSWINDKVVFAHNYVENSDNIKENQFEDFDEDWENFEFDAEAEPKAIKKHKIYRPQSTQ
FT                   APKETVIKTEETDGSHDIDWTQTDDDTKYESHGMHVTGIVAGNSKEAAATGERFLGIAP
FT                   EAQVMFMRVFANDVMGSAESLFIKAIEDAVALGADVINLSLGTANGAQLSGSKPLMEAI
FT                   EKAKKAGVSVVVAAGNERVYGSDHDDPLATNPDYGLVGSPSTGRTPTSVAAINSKWVIQ
FT                   RLMTVKELENRADLNHGKAIYSESVDFKNIKDSLGYDKSHQFAYVKESTDAGYNAQDVK
FT                   GKIALIERDPNKTYDEMIALAKKHGALGVLIFNNKPGQSNRSMRLTANGMGIPSAFISH
FT                   EFGKVMSQLNGNGTGSLEFDSVVSKAPSQKGNEMNHFSNWGLTSDGYLKPDITAPGGDI
FT                   YSTYNDNHYGSQTGTSMASPQIAGASLLVKQYLEKTQPNLPKEKIADIVKNLLMSNAQI
FT                   HVNPETKTTTSPRQQGAGLLNIDGAVTSGLYVTGKDNYGSISLGNITDTMTFDVTVHNL
FT                   SNKAKTLRYDTELLTDHVDPQKGRFTLTSRSLKTYQGGEVTVPANGKVTVRVTMDVSQF
FT                   TKELTKQMPNGYYLEGFVRFRDSQDDQLNRVNIPFVGFKGQFENLAVAEESIYRLKSQG
FT                   KTGFYFDESGPKDDIYVGKHFTGLVTLGSETNVSTKMISDNGLHTLGTFKNADGKFILE
FT                   KNAQGNPVLAISPNGDNNQDFAAFKGVFLRKYQGLKASVYHASDKEHKNPLWVSPESFK
FT                   GDKNFNSDIRFAKSTTLLGTAFSGKSLTGAELPDGYYHYVVSYYPDVVGAKRQEMTFDM
FT                   ILDRQKPVLSQATFDPETNRFKPEPLKDRGLAGVRKDSVFYLERKDNKPYTVTINDSYK
FT                   YVSVEDSKTFVERQADGSFILPLDKAKLGDFYYMVEDFAGNVAIAKLGDHLPQTLGKTP
FT                   IKLKLTDGNYQTKETLKDNLEMTQSDTGLVTNQAQLAVVHRNQPQSQLTKMNQDFFISP
FT                   NEDGNKDFVAFKGLKNNVYNDLTVNVYAKDDHQKQTPIWSSQAGASASAIESTAWYGIT
FT                   ARGSKVMPGDYQYVVTYRDEHGKEHQKQYTISVNDKKPMITQGRFDTINGVDHFTPDKT
FT                   KALGSSGIVREEVFYLAKKNGRKFDVTEGKDGITVSDNKVYIPKNPDGSYTISKRDGVT
FT                   LSDYYYLVEDRAGNVSFATLRDLKVVGKDKAVVNFGLDLPVPEDKQIVNFTYLVRDADG
FT                   KPIENLEYYNNSGNSLILPYGKYTVELLTYDTNAAKLESDKIVSFTLSADNNFQQVTFK
FT                   MTMLATSQITAHFDHLLPEGSRVSLKTAQGQLIPLEQSLYVPKAYGKTVQEGTYEVVVS
FT                   LPKGYRIEGDTKVNALPNEVHELSLRLVKVGDASDSTGDHKVMSKNNSQALTASATPTK
FT                   TTTSATAKALPSAGEKMGLKLRIVGLVLLGLTCVFSRKKSTKD"
FT   gene            340301..341032
FT                   /locus_tag="SpyM3_0299"
FT   CDS             340301..341032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK06161.1|AE006436_10
FT                   (AE006436) unknown protein [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78906"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8G5"
FT                   /protein_id="AAM78906.1"
FT                   /translation="MNEVKKATMSKKKRKHYQVYEGLRCAMTLCFISGYVNAFTYMTQG
FT                   KRFAGVQTGNLLSFAIRLSEQQLKEALQFLLPMIVFMLGQSFTYFMHRWATKKGLHWYL
FT                   LSSVMLTGLAFGTALFTPFLPSNVTVAALAFFASIQVDTFKTLRGASYANVMMTGNIKN
FT                   AAYLLTKGLYEKNHELTHIGRNTLIVILAFAVGVVCSTLLCIAYGEYALMPILMPLLYV
FT                   NYLLAQEFYHIQTKIKPIKRT"
FT   gene            341275..343272
FT                   /gene="metS"
FT                   /locus_tag="SpyM3_0300"
FT   CDS             341275..343272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="SpyM3_0300"
FT                   /product="putative methionyl-tRNA synthetase"
FT                   /note="best blastp hit: gb|AAK33446.1| (AE006503) putative
FT                   methionyl-tRNA synthetase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78907"
FT                   /db_xref="GOA:P0DG48"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG48"
FT                   /protein_id="AAM78907.1"
FT                   /translation="MKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFY
FT                   LTGLDEHGQKIQTKAKEAGITPQTYVDNMAKDVKALWQLLDISYDKFIRTTDDYHEEVV
FT                   AAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEW
FT                   VSEESYFLRLSKYADRLVAFFKERPDFIQPDGRMNEMVKNFIEPGLEDLAVSRTTFTWG
FT                   VPVPSDPKHVVYVWIDALLNYATALGYGQANHANFDKFWNGTVFHMVGKDILRFHSIYW
FT                   PILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLP
FT                   VGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQ
FT                   VIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMA
FT                   HLAASLRVVAHVIQPFMMETSAAIMAQLGLAPVSDLSTLALADFPANTKVVAKGTPIFP
FT                   RLDMEAEIDYIKAQMGDSSAISQEKEWVPEEVALKSEKDVITFETFDAVEIRVAEVKEV
FT                   SKVEGSEKLLRFRVDAGDGQDRQILSGIAKCYPNEQELVGKKLQIVANLKPRKMMKKYI
FT                   SQGMILSAEHGDQLTVLTVDSSVPNGSIIG"
FT   gene            343766..344779
FT                   /gene="nrdF.2"
FT                   /locus_tag="SpyM3_0301"
FT   CDS             343766..344779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF.2"
FT                   /locus_tag="SpyM3_0301"
FT                   /product="putative ribonucleotide reductase 2"
FT                   /note="best blastp hit: gb|AAK33447.1| (AE006503) putative
FT                   ribonucleotide reductase 2 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78908"
FT                   /db_xref="GOA:Q8K8G4"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8G4"
FT                   /protein_id="AAM78908.1"
FT                   /translation="MTQHYYERSQSPIEYALSETQKQLRSINWNYLNDDKDLEVWNRVT
FT                   QNFWLPEKVPVSNDLNSWRSLGEDWQQLITRTYTGLTLLDTVQATVGDVAQIQHSQTDH
FT                   EQVIYTNFAFMVGIHARSYGTIFSTLCSSEQIEEAHEWVVSTQSLQDRARVLIPYYTGD
FT                   DPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKMPNTSDIIRLILRDKVIHNYYSGYKYQ
FT                   QKVARLSPEKQAEMKAFVFDLLYELIDLEKAYLRELYAGFDLAEDAIRFSLYNAGKFLQ
FT                   NLGYDSPFTDEETRVSPEVFAQLSARADENHDFFSGNGSSYVMGITEETTDDDWEF"
FT   gene            344783..345271
FT                   /gene="nrdI.2"
FT                   /locus_tag="SpyM3_0302"
FT   CDS             344783..345271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI.2"
FT                   /locus_tag="SpyM3_0302"
FT                   /product="putative ribonucleotide reductase"
FT                   /note="best blastp hit: gb|AAK33448.1| (AE006503) putative
FT                   ribonucleotide reductase (NrdI protein) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78909"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC70"
FT                   /protein_id="AAM78909.1"
FT                   /translation="MAELIIVYFSSKSNNTHRFVQKLGLPAQRIPVDNRPLEVSTHYLL
FT                   IVPTYAAGGSDAKGAVPKQVIRFLNNPNNRKHCKGVISSGNTNFGDTFALAGPIISQKL
FT                   QVPLLHQFELLGTATDVKKVQAIFARLKHHTHDKQKQTNNLITERTHPCHKPMRHTSH"
FT   gene            345238..347418
FT                   /gene="nrdE.2"
FT                   /locus_tag="SpyM3_0303"
FT   CDS             345238..347418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdE.2"
FT                   /locus_tag="SpyM3_0303"
FT                   /product="putative ribonucleoside-diphosphate reductase
FT                   large chain"
FT                   /note="best blastp hit: gb|AAK33449.1| (AE006503)
FT                   ribonucleoside-diphosphate reductase, large chain
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78910"
FT                   /db_xref="GOA:Q8K8G3"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8G3"
FT                   /protein_id="AAM78910.1"
FT                   /translation="MSQTNASYLSLNALTRFKKPDGSYHFDSDKEAVRRYLEEHVSPNQ
FT                   MAFNSLEDKLAYLINEGYYEQAIFDAYPNDLIKEAFHYAYQQGYRFLNLMGAMKFYQSY
FT                   ALKTLDGKQYLETFEDRAVMNALFLADGDQTFVFDVIDAILHRRFQPATPTFLNAGKKR
FT                   RGEYISCYLLRVEDNMESISRAISTSLQLSKRGGGVALCLTNLREIGAPIKGIENQATG
FT                   IVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLALG
FT                   LVIPDITFQLAKENKDMALFSPYDIKRAYGKDMSDISITEEYDKLLANPAIKKTYISAR
FT                   KFFQLIAELHFESGYPYLLFDDTVNKRNPHAKKGRIVMSNLCSEIAQVSTPSTFKEDLS
FT                   FETIGEDICCNLGSINIAQAMADAPHFEQLITTSIRALDRVSRVSDLNCAPSVETGNAA
FT                   NHAVGLGAMNLHGFLATNHIYYDTKEAVDFTDLFFHAMAYYAFKASCQLAKEKGAFAGF
FT                   SLSTYADGTYFAKYLQEDAKPQTAKVATLLQDYGFTLPTVADWQALVADIKQFGLANAH
FT                   LLAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGSLGRIYVPAYQIDQANYAYYERGAYE
FT                   VGPKAIIDVVAAAQKHVDQAISLTLFMTDQATTRDLNRSYIQAFKQNCASIYYVRVRQD
FT                   VLAGSEQYDEDSLVTAPGASDETTTECQSCMI"
FT   gene            complement(347580..348332)
FT                   /locus_tag="SpyM3_0304"
FT   CDS             complement(347580..348332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: dbj|BAB78400.1| (AP003088)
FT                   ORF2 epidermal cell differentiation inhibitor C of
FT                   Staphylococcus aureus"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78911"
FT                   /db_xref="GOA:Q8K8G2"
FT                   /db_xref="InterPro:IPR003540"
FT                   /db_xref="InterPro:IPR016678"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8G2"
FT                   /protein_id="AAM78911.1"
FT                   /translation="MLKKRYQLAIVLLLSCFSLVWQTEGLVELFVCEHYERAICEGTPA
FT                   YFTFSDQKGAETLIKKRWGKGIVYPRAEQEAMAAYTCQQAGPINTSLDKAKGKLSQLTP
FT                   ELRDQVAQLDAATHRLVIPWNIVVYRYVYETFLRDIGVSHADLTSYYRNHQFDPHILCK
FT                   IKLGTRYTKHSFMSTTALKNGAMTHRPVEVRICVKKGAKAAFVEPYSAVPSEVELLFPR
FT                   GCQLEVVGAYVSQDHKKLHIEAYFKGSL"
FT   gene            348790..349215
FT                   /locus_tag="SpyM3_0305"
FT   CDS             348790..349215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0305"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33451.1| (AE006504)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78912"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8G1"
FT                   /protein_id="AAM78912.1"
FT                   /translation="MKTKSKRFLNLATLCLALLGTALLMAHPVKADAMTTDVSTISGNG
FT                   EGEGSEKEWWYRGYNDGYKAGEKSENREELDRDNFNNFPEDLPSDDTENQGEYMDGYGG
FT                   GYEAGWRNGHRLEALLEDVLAFFTNIFYGWFGDGAKS"
FT   gene            349406..349657
FT                   /locus_tag="SpyM3_0306"
FT   CDS             349406..349657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0306"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33453.1| (AE006504)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78913"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8G0"
FT                   /protein_id="AAM78913.1"
FT                   /translation="MPEKKVLPVLSMVVSFVCLLDHIFFFATYSYLYLPLVASSLALIS
FT                   LVQNKDRQKVWSLAGLVLAAIAVAVVAYAYYDPTVIPY"
FT   gene            complement(349822..350352)
FT                   /locus_tag="SpyM3_0307"
FT   CDS             complement(349822..350352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0307"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33454.1| (AE006504)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78914"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8F9"
FT                   /protein_id="AAM78914.1"
FT                   /translation="MKKTLTLLLALFAIGVTSSVRAEDAFEFVRVNRNYPNIQINGMKI
FT                   GQKTFKVIIQPNGYTIPYINGVKQSYPGEKEIKIINPSTQEVTRCYRISGWRADSQGSY
FT                   TVTLDSPLQETDVVSLQIADDSHFYLGTAVYRCKSELKKEKEAEEALQKKGRGKATKTT
FT                   RRKHAKADKRRRS"
FT   gene            350711..350947
FT                   /locus_tag="SpyM3_0308"
FT   CDS             350711..350947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK04891.1|AE006312_11
FT                   (AE006312) unknown protein [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78915"
FT                   /db_xref="InterPro:IPR021361"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFE6"
FT                   /protein_id="AAM78915.1"
FT                   /translation="MTFEEILPGLKAKKKYVRTGWGGAENYVQLFDTLEVDGKVLQATP
FT                   YFLIHVTGAGEGFSMWAPTPCDVLAEDWIEVND"
FT   gene            350940..351638
FT                   /locus_tag="SpyM3_0309"
FT   CDS             350940..351638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0309"
FT                   /product="putative dehydrogenease / oxidoreductase"
FT                   /note="best blastp hit: gb|AAK33459.1| (AE006504) putative
FT                   dehydrogenease / oxidoreductase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78916"
FT                   /db_xref="GOA:Q8K8F8"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8F8"
FT                   /protein_id="AAM78916.1"
FT                   /translation="MTKVVLVTGCASGIGYAQARYFLRQGHHVYGVDKSDKPDLNGNFH
FT                   FIKLDLSSELSPLFKVVPSVDILCNTAGILDAYKPLLDVSDEEVEHLFDINFFATVKLT
FT                   RHYLRRMVEKQSGVIINMCSIASFIAGGGGVAYTSSKHALAGFTRQLALDYAKDQIHIF
FT                   GIAPGAVKTAMTASDFEPGGLADWVARETPIGRWTEPDEVAELTGFLASGKARSMQGEI
FT                   VKIDGGWTLK"
FT   gene            351714..352673
FT                   /locus_tag="SpyM3_0310"
FT   CDS             351714..352673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: dbj|BAB06422.1| (AP001516)
FT                   BH2703 unknown conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78917"
FT                   /db_xref="GOA:Q8K8F7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8F7"
FT                   /protein_id="AAM78917.1"
FT                   /translation="MKLAVLGTGMIVKEALPVLQKIDGIDLVAILSTVRSLTTAKDLAK
FT                   AYKMPLATSKYETVLGNEEIDTVYIGLPNHLHFAYAKEALLAGKHVICEKPFTLTAGEL
FT                   DELVVIAKKRKLILLEAITNQYLSNMTFIKEHLDQLGDIKIVECNYSQYSSRYDAFKQG
FT                   DIAPAFDPQKGGGALRDLNIYNIHFVVGLFGRPKTVQYLANVEKGIDTSGMLVMDYEQF
FT                   KVVCIGAKDCTAEIKSTIQGNKGSLAVLGATNTLPQVELSLHGHEAQVVNHNKHDHRMY
FT                   EEFVAFRDMIDQRDFEKVNQALEHSRAVMSVLERAVHS"
FT   gene            353006..354343
FT                   /gene="glpT"
FT                   /locus_tag="SpyM3_0311"
FT   CDS             353006..354343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="SpyM3_0311"
FT                   /product="putative glycerol-3-phosphate transporter"
FT                   /note="best non-GAS blastp hit: dbj|BAB79938.1| (AP003186)
FT                   glycerol-3-phosphate transporter [Clostridium perfringens]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78918"
FT                   /db_xref="GOA:Q8K8F6"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8F6"
FT                   /protein_id="AAM78918.1"
FT                   /translation="MEEDYNKREPEKFTQFLRRQKVVFFVAFFGYVCAYLVRNNFKLMS
FT                   NTIMVQNGWDKAQIATLLSCLTVSYGLAKFYMGALGDRVSLRKLFSISLGASALICILI
FT                   GFFNSSMVVLGILLVLCGVVQGALAPASQAMIANYFPNKTRGGAIAGWNISQNMGSALL
FT                   PLTIALLTSMGLVVPANGNILLAFLIPGVLVFLFALCCWKLGGDNPESEGLDSLRTMYG
FT                   DAGESAVASEEEKHNLSYWQLIWKYVFCNPSLLLVAAVNVALYFVRFGIEDWMPIYLSQ
FT                   VANMSEAHIHFAISMLEWVAIPGSLVFAWLAVRYPNKMAKIGAIGLFVLAAIVFVYERL
FT                   TATGAPNYFLLLVIAGILGSLIYGPQLIVNILTINFVPLNVAGTAIGFVGVTAYLIGNM
FT                   GANWLMPILADGFGWFWSYIVVAALSAFSAVGYLILAKREEEIIKD"
FT   gene            354516..355898
FT                   /gene="glmU"
FT                   /locus_tag="SpyM3_0312"
FT   CDS             354516..355898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="SpyM3_0312"
FT                   /product="putative UDP-N-acetylglucosamine
FT                   pyrophosphorylase"
FT                   /note="best non-GAS blastp hit: gb|AAK99695.1| (AE008463)
FT                   UDP-N-acetylglucosamine pyrophosphorylase [Streptococcus
FT                   pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78919"
FT                   /db_xref="GOA:P0DB62"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DB62"
FT                   /protein_id="AAM78919.1"
FT                   /translation="MTNYAIILAAGKGTRMTSDLPKVLHKVSGLTMLEHVFRSVKAINP
FT                   EKAVTVIGHKSEMVRAVLADQSAFVHQTEQLGTGHAVMMAETQLEGLEGHTLVIAGDTP
FT                   LITGESLKSLIDFHVNHKNVATILTATAPDPFGYGRIVRNKDGEVIKIVEQKDANEYEQ
FT                   QLKEINTGTYVFDNKRLFEALKCITTNNAQGEYYLTDVVAIFRANKEKVGAYILRDFNE
FT                   SLGVNDRVALATAETVMRQRITQKHMVNGVTFHNPETVYIESDVTIAPDVLIEGNVTLK
FT                   GRTHIGSGTVLTNGTYIVDSEIGDNCVVTNSMIESSVLAAGVTVGPYAHLRPGTTLDRE
FT                   VHIGNFVEVKGSHIGEKTKAGHLTYIGNAQVGSSVNVGAGTITVNYDGQNKYETVVGDH
FT                   AFIGSNSTLIAPLEIGDNALTAAGSTISKTVPADSIVIGRSRQVTKEGYAKRLAHHPSR
FT                   SK"
FT   gene            355929..356483
FT                   /locus_tag="SpyM3_0313"
FT   CDS             355929..356483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75108.1| (AE007402)
FT                   MutT/nudix family protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78920"
FT                   /db_xref="GOA:Q8K8F4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8F4"
FT                   /protein_id="AAM78920.1"
FT                   /translation="MKFEEKTLKRQTVFDGHIFKVVVDDVELPNNLGQSKRELIFHRGA
FT                   VAVLAITPECKIVLVKQYRKAIESVSYEIPAGKLEIGEEGSKLKAAARELEEETAYTGT
FT                   LTFLYEFYTAIGFCNEKITLFLATDLTQVANPKPQDDDEVIEVLELTYQECMDLVAQGK
FT                   LADAKTLIALQYYALHFGGEQ"
FT   gene            356483..356734
FT                   /locus_tag="SpyM3_0314"
FT   CDS             356483..356734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75109.1| (AE007402)
FT                   hypothetical protein [Streptococcus pneumoniae TIGR4], and
FT                   gb|AAK99697.1| (AE008463) hypothetical protein
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8F3"
FT                   /protein_id="AAM78921.1"
FT                   /translation="MGRPLLTDDIIEKARRMETFESDDAVDFDTKVMTLPEKDEKARIY
FT                   KSRRIENAKRSQLQSKLNVILIAVMLLIAILVYAIFYL"
FT   gene            356754..357449
FT                   /gene="pfs"
FT                   /locus_tag="SpyM3_0315"
FT   CDS             356754..357449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="SpyM3_0315"
FT                   /product="putative 5'-methylthioadenosine /
FT                   S-adenosylhomocysteine nucleosidase"
FT                   /note="best non-GAS blastp hit: gb|AAK99698.1| (AE008463)
FT                   5'-methylthioadenosine / S-adenosylhomocysteine
FT                   nucleosidase [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78922"
FT                   /db_xref="GOA:Q7CFE5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFE5"
FT                   /protein_id="AAM78922.1"
FT                   /translation="MKIGIIAAMEEELSLLLANLLDAQEHQVLSKTYYTGRFGKHELIL
FT                   VQSGVGKVMSAMTVAILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATA
FT                   FGYAYGQMAGQPLYYDCDPQFVAIFKQVLKHEKTNGQVGLIATGDSFVAGQDKIDQIKT
FT                   AFSDVLAVEMEGAAIAQAAHTAGKPFIVVRAMSDTAAHDANITFDQFIIEAGKRSAQTL
FT                   MTFLENLPV"
FT   gene            357600..357941
FT                   /locus_tag="SpyM3_0316"
FT   CDS             357600..357941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0316"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33466.1| (AE006505)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78923"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8F2"
FT                   /protein_id="AAM78923.1"
FT                   /translation="MTLKKHYYLLSLLALVTVGAAFNTSQSVSAQVYSDKGYRQDLTDQ
FT                   KSHLQYSKDNAKLQLRNILNGYQDDLGRNYSSYYYYNLRTVMGLSSEQDIEKHYKKLKD
FT                   ELYRMYNHY"
FT   gene            complement(358040..358687)
FT                   /locus_tag="SpyM3_0317"
FT   CDS             complement(358040..358687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0317"
FT                   /product="putative metal-dependent transcriptional
FT                   regulator"
FT                   /note="best blastp hit: gb|AAK33467.1| (AE006505) putative
FT                   metal-dependent transcriptional regulator [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78924"
FT                   /db_xref="GOA:Q8K8F1"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8F1"
FT                   /protein_id="AAM78924.1"
FT                   /translation="MTPNKEDYLKCIYEIGEQEPKITNKMVAEKMHVSAPAVSEMIKKM
FT                   ISQGWIVKDKAKGYLLKDKGYALVANLYRKHRLIEVFLIHQLGYNTQEVHQEAEVLEHT
FT                   VSDTFIDRLDKILDFPDFCPHGGTIPRYGQPLVEMNTTTLNTITELGRFRLSRIHDHFD
FT                   LIQYLETHHLNINTELTLTQIDTFAKTYTICYGDKELVIPENIAKQLYVTAL"
FT   gene            358857..359765
FT                   /gene="mtsA"
FT                   /locus_tag="SpyM3_0318"
FT   CDS             358857..359765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsA"
FT                   /locus_tag="SpyM3_0318"
FT                   /product="putative metal binding protein of ABC
FT                   transporter"
FT                   /note="lipoprotein; best blastp hit:
FT                   gb|AAD56936.1|AF180520_1 (AF180520) lipoprotein MtsA
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78925"
FT                   /db_xref="GOA:P0DF60"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF60"
FT                   /protein_id="AAM78925.1"
FT                   /translation="MGAFLSVFLLVACSSTGTKTAKSDKLKVVATNSIIADMTKAIAGD
FT                   KIDLHSIVPIGQDPHEYEPLPEDVEKTSNADVIFYNGINLEDGGQAWFTKLVKNAQKTK
FT                   NKDYFAVSDGIDVIYLEGASEKGKEDPHAWLNLENGIIYSKNIAKQLIAKDPKNKETYE
FT                   KNLKAYVAKLEKLDKEAKSKFDAIAENKKLIVTSEGCFKYFSKAYGVPSAYIWEINTEE
FT                   EGTPDQISSLIEKLKVIKPSALFVESSVDRRPMETVSKDSGIPIYSEIFTDSIAKKGKP
FT                   GDSYYAMMKWNLDKISEGLAK"
FT   gene            359829..360554
FT                   /gene="mtsB"
FT                   /locus_tag="SpyM3_0319"
FT   CDS             359829..360554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsB"
FT                   /locus_tag="SpyM3_0319"
FT                   /product="ATP-binding protein MtsB, ABC transporter
FT                   (ATP-binding protein)"
FT                   /note="best blastp hit: gb|AAD56937.1|AF180520_2 (AF180520)
FT                   ATP-binding protein MtsB [Streptococcus pyogenes], and
FT                   gb|AAK33469.1| (AE006505) ABC transporter (ATP-binding
FT                   protein) [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78926"
FT                   /db_xref="GOA:Q7CFE4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFE4"
FT                   /protein_id="AAM78926.1"
FT                   /translation="MITTNNLCVTYDGNSNALEAINVTIEGPSIVGIIGPNGAGKSTFM
FT                   KAILNLIDYQGHVTVDGKDGRKLGHTVAYVEQRSMIDYNFPITVKECVALGTYSKLGLF
FT                   RRVGKKQFEQVDKVLKQVGLEDFGHRPIKSLSGGQFQRMLVARCLIQESDYIFLDEPFV
FT                   GIDSVSEKIIVDLLKELKMAGKTILIVHHDLSKVEHYFDKLMILNKHLVAYGNVCEVFT
FT                   VDTLSKAYGNHLILGKEMV"
FT   gene            360555..361409
FT                   /gene="mtsC"
FT                   /locus_tag="SpyM3_0320"
FT   CDS             360555..361409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsC"
FT                   /locus_tag="SpyM3_0320"
FT                   /product="integral membrane protein MtsC, ABC transporter
FT                   (permease protein)"
FT                   /note="best blastp hit: gb|AAD56938.1|AF180520_3 (AF180520)
FT                   integral membrane protein MtsC [Streptococcus pyogenes, and
FT                   gb|AAK33470.1| (AE006505) ABC transporter (permease
FT                   protein) [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78927"
FT                   /db_xref="GOA:Q8K8F0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8F0"
FT                   /protein_id="AAM78927.1"
FT                   /translation="MSMKFFEGLMSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMG
FT                   DAISHAVLPGVALSFILGVNFFIGAIIFGLLASVIITYIKENSVIKGDTAIGITFSSFL
FT                   ALGVILIGVANSSTDLFHILFGNILAVQDSDKWITIGVSIFVLVVISLFFKELLLTSFD
FT                   PILAKSMGVKVIAYHYLLMVLLTLVAVTAMQSVGTILIVALLITPAATAYLYANSLKVM
FT                   LVMSSLLGALASVLGLYLGYTFNVAAGSSIVLTSAMMFLISFFVSPKQGYLKRWMQKKE
FT                   KTP"
FT   gene            complement(361557..362363)
FT                   /gene="cypB"
FT                   /locus_tag="SpyM3_0321"
FT   CDS             complement(361557..362363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cypB"
FT                   /locus_tag="SpyM3_0321"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase"
FT                   /note="cyclophilin-type; best non-GAS blastp hit:
FT                   gb|AAK74909.1| (AE007384) peptidyl-prolyl cis-trans
FT                   isomerase, cyclophilin-type [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78928"
FT                   /db_xref="GOA:Q8K8E9"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8E9"
FT                   /protein_id="AAM78928.1"
FT                   /translation="MKKLLSLSLVAISLLSLSACESVDRAIKGDKYIDEKTAKEESEAA
FT                   SKAYEESIQKALKADASQFPQLTKEVGKEEAKVVMRTSQGDITLKLFPKYAPLAVENFL
FT                   THAKKGYYDNLTFHRVINDFMIQSGDPKGDGTGGESIWKGKDPKKDAGNGFVNEISPFL
FT                   YHIRGALAMANAGANTNGSQFYINQNKKNQSKGLSSTNYPKPIISAYEHGGNPSLDGGY
FT                   TVFGQVIDGMDVVDKIAATSINQNDKPKQDITITSIDIVKDYRFKN"
FT   gene            362667..364985
FT                   /locus_tag="SpyM3_0322"
FT   CDS             362667..364985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0322"
FT                   /product="putative cell division protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75005.1| (AE007393)
FT                   SpoE family protein [Streptococcus pneumoniae TIGR4],
FT                   gb|AAK99585.1| (AE008454) Cell division protein
FT                   [Streptococcus pneumoniae R6], and gb|AAK05754.1|AE006396_5
FT                   (AE006396) cell division protein FtsK [Lactococcus lactis
FT                   subsp.lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78929"
FT                   /db_xref="GOA:P0DB16"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DB16"
FT                   /protein_id="AAM78929.1"
FT                   /translation="MILSVLMALLLIFAMLRLGVFGVTTYNMIRFLVGSLAYPFMFAWL
FT                   IYLFCFKWLRQKDGMIAGVVIAFLGLLVEWHAFLFAMPRMLDQDIFLGTARLITRDLLA
FT                   LRVTEFVGGGMLGALLYKPIAFLFSNIGSYFIGFLFILLGLFLMTPWDIYDVSHFVKEA
FT                   VDKLAVAYQENKEKRFIKREEHRLQAEKEALEKQAQEEEKRLAELTVDPETGEIVEDSQ
FT                   SQVSYDLAEDMPKEPEILAYDSHLKDDEASLFDQEDLAYAHEEIGAYDSLSALASSEDE
FT                   MDMDEPVEVDFTPKTHLLYKLPTIDLFVPDKPKNQSKEKNLVRKNIKVLEDTFQSFGID
FT                   VKVERAEIGPSVTKYEIKPAVGVRVNRISNLADDLALALAAKDVRIEAPIPGKSLIGIE
FT                   VPNSEIATVSFRELWEQSDANPENLLEVPLGKAVNGNARSFNLARMPHLLVAGSTGSGK
FT                   SVAVNGIISSILMKARPDQVKFMMIDPKMVELSVYNDIPHLLIPVVTNPRKASKALQKV
FT                   VDEMENRYELFSKIGVRNIAGYNTKVEEFNASSEQKQIPLPLIVVIVDELADLMMVASK
FT                   EVEDAIIRLGQKARAAGIHMILATQRPSVDVISGLIKANVPSRMAFAVSSGTDSRTILD
FT                   ENGAEKLLGRGDMLFKPIDENHPVRLQGSFISDDDVERIVNFIKDQAEADYDDAFDPGE
FT                   VSDNDPGFSGNGGAAEGDPLFEEAKALVLETQKASASMIQRRLSVGFNRATRLMDELEE
FT                   AGVIGPAEGTKPRKVLQTN"
FT   gene            complement(365056..365406)
FT                   /locus_tag="SpyM3_0323"
FT   CDS             complement(365056..365406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99372.1| (AE008436)
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78930"
FT                   /db_xref="InterPro:IPR024515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8E7"
FT                   /protein_id="AAM78930.1"
FT                   /translation="MIYKLTALAFLIVTPLFAMIVTSLFKLNKKGFKFPDVALLLFAIE
FT                   IVLVSGKFFTHNLLPYYLIIMSLLAIVISLLLVIRTQSFSYHRFMKLFWRVGFLVTVIF
FT                   YLILVIFIFTLA"
FT   gene            365653..366078
FT                   /gene="rplK"
FT                   /locus_tag="SpyM3_0324"
FT   CDS             365653..366078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="SpyM3_0324"
FT                   /product="50S ribosomal protein L11"
FT                   /note="best blastp hit: gb|AAK33474.1| (AE006506) 50S
FT                   ribosomal protein L11 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78931"
FT                   /db_xref="GOA:P0DE00"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE00"
FT                   /protein_id="AAM78931.1"
FT                   /translation="MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNAR
FT                   TADQAGMIIPVVISVYEDKSFDFITKTPPAAVLLKKAAGVEKGSGTPNTTKVATVTRAQ
FT                   VQEIAETKMPDLNAANIEAAMRMIEGTARSMGFTVTD"
FT   gene            366184..366873
FT                   /gene="rplA"
FT                   /locus_tag="SpyM3_0325"
FT   CDS             366184..366873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="SpyM3_0325"
FT                   /product="50S ribosomal protein L1"
FT                   /note="best blastp hit: gb|AAK33475.1| (AE006506) 50S
FT                   ribosomal protein L1 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78932"
FT                   /db_xref="GOA:P0DE16"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE16"
FT                   /protein_id="AAM78932.1"
FT                   /translation="MAKKSKQMLAALEKVDSTKAYSVEEAVALVKETNFAKFDASVEVA
FT                   YNLNIDVRKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   NGGWLDFDVVIATPDMMAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADKAGNVQALIGKVSFDADKLVENFKAFHDVMAKAKPATAKGTYMANVSITSTQGVGI
FT                   KVDPNSL"
FT   gene            367196..367924
FT                   /gene="pyrH"
FT                   /locus_tag="SpyM3_0326"
FT   CDS             367196..367924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="SpyM3_0326"
FT                   /product="putative uridylate kinase"
FT                   /note="UMP-kinase; best non-GAS blastp hit: gb|AAK99649.1|
FT                   (AE008460) UMP kinase [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78933"
FT                   /db_xref="GOA:P0DD72"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD72"
FT                   /protein_id="AAM78933.1"
FT                   /translation="MEPKYQRILIKLSGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGV
FT                   QIALVIGGGNLWRGEPAADAGMDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAI
FT                   PMQNVAEPYIRGRALRHLEKNRIVVFGAGIGSPYFSTDTTAALRAAEIEADAILMAKNG
FT                   VDGVYNADPKKDANAVKFDELTHGEVIKRGLKIMDATASTLSMDNDIDLVVFNMNEAGN
FT                   IQRVVFGEHIGTTVSNKVCD"
FT   gene            367954..368511
FT                   /gene="rrf"
FT                   /locus_tag="SpyM3_0327"
FT   CDS             367954..368511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrf"
FT                   /locus_tag="SpyM3_0327"
FT                   /product="putative ribosome recycling factor"
FT                   /note="best non-GAS blastp hit: gb|AAK75068.1| (AE007399)
FT                   ribosome recycling factor [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78934"
FT                   /db_xref="GOA:P0DF38"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF38"
FT                   /protein_id="AAM78934.1"
FT                   /translation="MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYY
FT                   GAPTPLNQLASITVPEARVLLISPFDKSSIKDIERALNASDLGITPANDGSVIRLVIPA
FT                   LTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAKKQEKAKEITEDELKTLEKDIQKA
FT                   TDDAIKEIDRMTAEKEKELLSV"
FT   gene            368749..369477
FT                   /locus_tag="SpyM3_0328"
FT   CDS             368749..369477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75069.1| (AE007399)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78935"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8E5"
FT                   /protein_id="AAM78935.1"
FT                   /translation="MVTGFAYIDIKQKARLTTKEIRSTRTSYGWGEVTEVRRDLGVFVD
FT                   TGIPNKEIVVSLDVLPEMKELWPKKGDKLYIRLDVDKKDRIWGLPAEPEVFQKMASPAY
FT                   NNMQNQHWPAIVYRLKLTGTFVYLPENNMLGFIHPSERYAEPRLGQVLDARVIGFREVD
FT                   RTLNLSLKPRSFEMLENDAQMIVTYLEANGGFMTLNDKSSPEEIKATFGISKGQFKKAL
FT                   GGLMKAKRIKQDATGTELIG"
FT   gene            369550..370059
FT                   /gene="msrA.2"
FT                   /locus_tag="SpyM3_0329"
FT   CDS             369550..370059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA.2"
FT                   /locus_tag="SpyM3_0329"
FT                   /product="putative peptide methionine sulfoxide reductase"
FT                   /note="best non-GAS blastp hit: gb|AAK06104.1|AE006430_9
FT                   (AE006430) peptide methionine sulfoxide reductase
FT                   [Lactococcus lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78936"
FT                   /db_xref="GOA:P0DC38"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC38"
FT                   /protein_id="AAM78936.1"
FT                   /translation="MERAIFAGGCFWCMVQPFEEQAGILSVRSGYTGGHLPNPSYEQVC
FT                   AKTTGHTEAVEIIFDPEEISYKELVELYWVQTDPTDAFGQFEDRGDNYRPVIYYTTERQ
FT                   KEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNPKRYAQSSAIRHQF
FT                   LEENWS"
FT   gene            370056..370271
FT                   /locus_tag="SpyM3_0330"
FT   CDS             370056..370271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75070.1| (AE007399)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78937"
FT                   /db_xref="InterPro:IPR010673"
FT                   /db_xref="InterPro:IPR023089"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DH14"
FT                   /protein_id="AAM78937.1"
FT                   /translation="MRKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELIS
FT                   RYLEDQASFSFNLGQFDEIWEDYLAH"
FT   gene            370427..371596
FT                   /locus_tag="SpyM3_0331"
FT   CDS             370427..371596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAG18474.1| (AF151357)
FT                   group B streptococcal surface immunogenic protein
FT                   [Streptococcus agalactiae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78938"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8E3"
FT                   /protein_id="AAM78938.1"
FT                   /translation="MIITKKSLFVTSVALSLAPLATAQAQEWTPRSVTEIKSELVLVDN
FT                   VFTYTVKYGDTLSTIAEAMGIDVHVLGDINHIANIDLIFPDTILTANYNQHGQATTLTV
FT                   QAPASSPASVSHVPSSEPLPQASATSQSTVPMAPSATPSDVPTTPFASAKPDSSVTASS
FT                   ELTSSTNDVSTELSSESQKQPEVPQEAVPTPKAAETTEVEPKTDISEDSTSANRPVPNE
FT                   SASEEVSSAAPAQAPAEKEETSAPAAQKAVADTTSVATSNGLSYAPNHAYNPMNAGLQP
FT                   QTAAFKEEVASAFGITSFSGYRPGDPGDHGKGLAIDFMVPENSALGDQVAQYAIDHMAE
FT                   RGISYVIWKQRFYAPFASIYGPAYTWNPMPDRGSITENHYDHVHVSFNA"
FT   gene            371911..373683
FT                   /locus_tag="SpyM3_0332"
FT   CDS             371911..373683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0332"
FT                   /product="67 kDa Myosin-crossreactive streptococcal
FT                   antigen"
FT                   /note="best blastp hit: gb|AAA51870.1| (U09352) 67 kDa
FT                   Myosin-crossreactive streptococcal antigen [Streptococcus
FT                   pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78939"
FT                   /db_xref="GOA:Q8K8E2"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8E2"
FT                   /protein_id="AAM78939.1"
FT                   /translation="MYYTSGNYEAFATPRKPEGVDQKSAYIVGTGLAGLAAAVFLIRDG
FT                   HMAGERIHLFEELPLAGGSLDGIEKPHLGFVTRGGREMENHFECMWDMYRSIPSLEIPG
FT                   ASYLDEFYWLDKDDPNSSNCRLIHKRGNRVDDDGQYTLGKQSKELIHLIMKTEESLGDQ
FT                   TIEEFFSEDFFKSNFWIYWATMFAFEKWHSAVEMRRYAMRFIHHIDGLPDFTSLKFNKY
FT                   NQYDSMVKPIIAYLESHDVDIQFDTKVTDIQVEQTAGKKAAKTIHMTVSGEAKAIELTP
FT                   DDLVFVTNGSITESSTYGSHHEVAKPTKALGGSWNLWENLAAQSDDFGHPKVFYQDLPA
FT                   ESWFVSATATIKHPAIEPYIERLTHRDLHDGKVNTGGIITITDSNWMMSFAIHRQPHFK
FT                   EQKDNETTVWIYGLYSNSEGNYVHKKIEECTGQEITEEWLYHLGVPVDKIKDLASQDYI
FT                   NTVPVYMPYITSYFMPRVKGDRPKVIPDGSVNLAFIGNFAESPSRDTVFTTEYSIRTAM
FT                   EAVYSFLNVERGIPEVFNSAYDIRELLKAFYYLNDKKAIKDMDLPIPALIEKIGHKKIK
FT                   DTFIEELLKDANLM"
FT   gene            373980..374894
FT                   /gene="phoH"
FT                   /locus_tag="SpyM3_0333"
FT   CDS             373980..374894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="SpyM3_0333"
FT                   /product="putative phosphate starvation-induced protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75071.1| (AE007399)
FT                   PhoH family protein [Streptococcus pneumoniae TIGR4], and
FT                   gb|AAK99653.1| (AE008460) PhoH-like protein [Streptococcus
FT                   pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78940"
FT                   /db_xref="GOA:Q8K8E1"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8E1"
FT                   /protein_id="AAM78940.1"
FT                   /translation="MIGDDEEAVELARLTIKALLVLVGRGMVVNTSDVVTALSMAESHQ
FT                   IDQFMALYEEEIIKDNYGKAIRVKTLGQKTYVDSVKRHDVVFGVGPAGTGKTFLAVTLA
FT                   VTALKRGQVKRIILTRPAVEAGESLGFLPGDLKEKVDPYLRPVYDALYHILGKEQTTRL
FT                   MERDVIEIAPLAYMRGRTLDDAFVILDEAQNTTIMQMKMFLTRLGFNSKMIINGDTSQI
FT                   DLPRNVKSGLIDATQKLQGIKQIDFVYFSAKDVVRHPVVADIIKAYETSSEEMKDLLKP
FT                   KASDVEADYQPGLTKYPVIGQEH"
FT   gene            374940..375515
FT                   /locus_tag="SpyM3_0334"
FT   CDS             374940..375515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74776.1| (AE007371)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78941"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8E0"
FT                   /protein_id="AAM78941.1"
FT                   /translation="MDDLTKAIMADEANLSYTERGIFPLYDAPQTARIIIVGQAPGIVA
FT                   QETKLYWNDRSGIRLRDWLGVDNDTFYHSGLFGIIPMDFYYPGKGKSGDLPPREGFAAK
FT                   WHPPLRALMPEVELTILVGRYAQDFYLGNKAYKTLTETVRHFEDYLPDYFPLVHPSPRN
FT                   QLWLAKNPWFEQDLLPILQKRVEAILTK"
FT   gene            375644..376171
FT                   /locus_tag="SpyM3_0335"
FT   CDS             375644..376171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99673.1| (AE008461)
FT                   Conserved hypothetical protein [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78942"
FT                   /db_xref="GOA:P0DF40"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF40"
FT                   /protein_id="AAM78942.1"
FT                   /translation="MGSPSLTINLMYIEMIDETGQVSQEIMEQTLDLLNFAAQKTGKEE
FT                   KEMSVTFVTNERSHELNLEYRDTDRPTDVISLEYKPETPILFSQEDLAADPSLAEMMAE
FT                   FDAYIGELFISIDKAREQSQEYGHSFEREMGFLAVHGFLHINGYDHYTLEEEKEMFTLQ
FT                   EEILTAYGLTRQ"
FT   gene            376152..376559
FT                   /gene="dgk"
FT                   /locus_tag="SpyM3_0336"
FT   CDS             376152..376559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="SpyM3_0336"
FT                   /product="putative diacylglycerol kinase"
FT                   /note="best non-GAS blastp hit: pir||A36933 diacylglycerol
FT                   kinase homolog - Streptococcus mutans"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78943"
FT                   /db_xref="GOA:Q7CFE2"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFE2"
FT                   /protein_id="AAM78943.1"
FT                   /translation="MALHDNNTTKRKWKNRTITSSLEFALTGVFTAFKEERNLRSHLLS
FT                   ACLACVAGLFFSISAIEWLFLLLAIFLVITLEIVNSAIENVVDLASDYHFSMLAKNAKD
FT                   MAAGAVLMISGYAVLTGLIIFIPKIWNIFVH"
FT   gene            376679..377575
FT                   /gene="era"
FT                   /locus_tag="SpyM3_0337"
FT   CDS             376679..377575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="SpyM3_0337"
FT                   /product="putative GTP-binding protein"
FT                   /note="GTPase; best blastp hit: sp|Q9RIK5|ERA_STRPY
FT                   GTP-binding protein era homolog, and gb|AAK33487.1|
FT                   (AE006507) GTP-binding protein (GTPase) [Streptococcus
FT                   pyogenes M1GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78944"
FT                   /db_xref="GOA:P0DA96"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA96"
FT                   /protein_id="AAM78944.1"
FT                   /translation="MFKSGFVAILGRPNVGKSTFLNHVMGQKIAIMSDKAQTTRNKIMG
FT                   IYTTETEQIVFIDTPGIHKPKTALGDFMVESAYSTLREVETVLFMVPADEKRGKGDDMI
FT                   IERLKAAKIPVILVINKIDKVHPDQLLEQIDDFRSQMDFKEVVPISALEGNNVPTLIKL
FT                   LTDNLEEGFQYFPEDQITDHPERFLVSEMVREKVLHLTQQEVPHSVAVVVESMKRDEET
FT                   DKVHIRATIMVERDSQKGIIIGKQGAMLKKIGKMARRDIELMLGDKVYLETWVKVKKNW
FT                   RDKKLDLADFGYNEKEY"
FT   gene            377550..378071
FT                   /locus_tag="SpyM3_0338"
FT   CDS             377550..378071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK05719.1|AE006392_5
FT                   (AE006392) conserved hypothetical protein [Lactococcus
FT                   lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78945"
FT                   /db_xref="GOA:Q8K8D8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8D8"
FT                   /protein_id="AAM78945.1"
FT                   /translation="MAIMRKNTNIVKRDHMPQDYISYIRSKVGHDKIILNFAGGILTND
FT                   DGKVLMQLRGDKKTWAIPGGTMELGESSLETCKREFLEETGIEVEAVRLLNVYTHFEEV
FT                   YPNGDAVQTIVFIYELTAVSDMAIDNFHNEETLKLQFFSHEEIAELESVSAKHRLMLEE
FT                   YFSDSFAMGH"
FT   misc_feature    complement(378700..378849)
FT                   /note="similar to Lactococcus lactis IS905 transposase"
FT   misc_feature    complement(378846..379268)
FT                   /note="similar to Lactococcus lactis IS905 transposase"
FT   gene            379537..379809
FT                   /locus_tag="SpyM3_0339"
FT   CDS             379537..379809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0339"
FT                   /product="putative bacteriocin"
FT                   /note="best blastp hit: emb|CAC03524.1| (AJ276410) BlpM
FT                   protein [Streptococcus pneumoniae], emb|CAC18597.1|
FT                   (AJ278419) putative bacteriocin [Streptococcus pneumoniae],
FT                   and gb|AAK74696.1| (AE007365) bacteriocin BlpM
FT                   [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78946"
FT                   /db_xref="GOA:Q8K8D7"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8D7"
FT                   /protein_id="AAM78946.1"
FT                   /translation="MQQDKFKNYEKKLFDMEIKKLETFHQMTIEKLAKVEGGKNNWQAN
FT                   VSGVIAAGSAGAAIGFPVCGVACGYIGAKTAITLWAGVTGATGGF"
FT   gene            379822..380022
FT                   /locus_tag="SpyM3_0340"
FT   CDS             379822..380022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33492.1| (AE006507) conserved
FT                   hypothetical protein - bacteriocin-like peptide associated
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78947"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8D6"
FT                   /protein_id="AAM78947.1"
FT                   /translation="MTTMKELTINDMASISGGNAPGDAVIGGLGGLASGLKFCKLPHPV
FT                   LTGGCVVGFTVGGAYLGYTAN"
FT   gene            380383..380511
FT                   /locus_tag="SpyM3_0341"
FT   CDS             380383..380511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33493.1| (AE006507) conserved
FT                   hypothetical protein - bacteriocin-like peptide associated
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78948"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8D5"
FT                   /protein_id="AAM78948.1"
FT                   /translation="MTGMAGAAQGVTVCAQIGVFIPWQGYILCGAAGAATNIIWPH"
FT   gene            380561..380842
FT                   /locus_tag="SpyM3_0342"
FT   CDS             380561..380842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0342"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: No hit found"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78949"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8D4"
FT                   /protein_id="AAM78949.1"
FT                   /translation="MKILDIIFNLSDRKMIFLENVEKLGGYIVPFTLIILSVAYNFRHP
FT                   YPIWAAVLGGISLIVIFIYFILIVYLYLRYRYLVWKKIPEIKINSTEL"
FT   gene            381691..382755
FT                   /locus_tag="SpyM3_0343"
FT   CDS             381691..382755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0343"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33494.1| (AE006507)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78950"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8D3"
FT                   /protein_id="AAM78950.1"
FT                   /translation="MLRDVKVKTSSLLVGCAATLLVSLSGTVAADSVHSSDRRFGVGYK
FT                   EETTSQFSSDQPSQVVLYRGEANTVRFTYTNQMSLMKDIRIALDGSDKSLTAQIVPGMG
FT                   HVYEGFQTSARGIFTMSGVPESTVPVANPNVQTKYTRYFKVIDDMHNTMYKGTVFLVQP
FT                   QAWKYTMKSVDQLPVDDLNHIGVAGIERMTTLIKNAGALLTTGGSGALPDNIKVSINPK
FT                   GGLATITYGAGSTDIIPPAVLWKKGSVKEPTEADQSVGTPTPGIPGKFKRDQSLNEHEA
FT                   MVNVEPLSHVVKDNIKVIDEKSTGRFEPFRPNEDEKEKPASDVKVRPAEVGSWLEPATA
FT                   LPSVEMSAEDRLKS"
FT   gene            382848..383246
FT                   /locus_tag="SpyM3_0344"
FT   CDS             382848..383246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0344"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33495.1| (AE006507)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78951"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8D2"
FT                   /protein_id="AAM78951.1"
FT                   /translation="MHRLPNRLIPEEDNNKLSRVAKEVVTEPRLNNPFLLPKKVLSLED
FT                   DAAILNHLEEDRNVNKLFLEPVAAEAKREINFHPSDQQVTAKVKESSDFHQKQHQTGIT
FT                   YGDDTLADLTHHLLHSDGVIPSLNDKSA"
FT   gene            complement(383595..383864)
FT                   /locus_tag="SpyM3_0345"
FT   CDS             complement(383595..383864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0345"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33496.1| (AE006507)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78952"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8D1"
FT                   /protein_id="AAM78952.1"
FT                   /translation="MTKKQFYLILAISILCFILAVSPKPPILKHTIERKRTAMTIGHSK
FT                   QNLHKKEALKHKKNKNKALFLPSGDSAIKSVISMTVRLLLDDQS"
FT   gene            384935..385801
FT                   /gene="mutR"
FT                   /locus_tag="SpyM3_0346"
FT   CDS             384935..385801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutR"
FT                   /locus_tag="SpyM3_0346"
FT                   /product="putative positive transcriptional regulator"
FT                   /note="best non-GAS blastp hit: gb|AAK99764.1| (AE008468)
FT                   Similar to positive transcriptional regulator MutR.
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78953"
FT                   /db_xref="GOA:Q7CFE1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFE1"
FT                   /protein_id="AAM78953.1"
FT                   /translation="MEKELGKTLRRLRKGKQVSISFLADEYLSKSQISRFERGESEITC
FT                   SRLLNLLDKLNITIDEFVSAHSKTHTHFFTLLSQARKCYAEKNVVKLTKLLKDYAHKDY
FT                   ERTMIKAILFSIDSSIAPSQEELTRLTDYLFKVEQWGYYEIILLGNCSRFMNYNTLFLL
FT                   TKEMVASFAYSEQNKTNKMLVTQLSINCLIISIDHSCFEHSRYLINKIDLLLRDELNFY
FT                   EKTVFLYVHGYYKLKQEEMSGEEDMRQALQIFKYLGEDSLYYSYKEHYRQIVLGGKGDE
FT                   DWSEADL"
FT   gene            385973..386800
FT                   /gene="fpg"
FT                   /locus_tag="SpyM3_0347"
FT   CDS             385973..386800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpg"
FT                   /locus_tag="SpyM3_0347"
FT                   /product="putative formamidopyrimidine-DNA glycosylase"
FT                   /note="best non-GAS blastp hit: dbj|BAA05066.1| (D26071)
FT                   formamidopyrimidine-DNA glycosylase [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78954"
FT                   /db_xref="GOA:P0DB14"
FT                   /db_xref="InterPro:IPR000191"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DB14"
FT                   /protein_id="AAM78954.1"
FT                   /translation="MPELPEVETVRRGLETLVLGQEIVAVTLKVPKMVKTDLETFALTL
FT                   PGQIIQSVGRRGKYLLIDLGQLVLVSHLRMEGKYLLFPDEVPDNKHFHVFFELKNGSTL
FT                   VYQDVRKFGTFDLIAKSQLSAFFAKRKLGPEPKKETFKLKTFEAALLSSQKPIKPHLLD
FT                   QTLVAGLGNIYVDEVLWAAKVHPETASSRLNKAEIKRLHDETIRILALGIEKGGSTVRT
FT                   YRNALGADGTMQDYLQVYGQTGKSCPRCGQAIVKLKVGGRGTHICPKCQKKRP"
FT   gene            386797..387390
FT                   /locus_tag="SpyM3_0348"
FT   CDS             386797..387390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0348"
FT                   /product="putative kinase"
FT                   /note="best blastp hit: sp|P58102|COAE_STRPY Dephospho-CoA
FT                   kinase (Dephosphocoenzyme A kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78955"
FT                   /db_xref="GOA:P0DA44"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA44"
FT                   /protein_id="AAM78955.1"
FT                   /translation="MIIGITGGIASGKSTVVKVIRKAGYQVIDADQVVHDLQEKGGRLY
FT                   EALREAFGNQILKADGELDRTKLSEMLFSNPDNMATSSAIQNQIIKEELAAKRDHLAQS
FT                   QAIFFMDIPLLMELGYQDWFDAIWLVYVDAQTQLQRLMARNRLDKGKARQRIASQLPIE
FT                   EKKPYASLVIDNNGDMETLIKQVQSALLSLANPR"
FT   gene            387580..389082
FT                   /locus_tag="SpyM3_0349"
FT   CDS             387580..389082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAL52551.1| (AE009575)
FT                   ATPase [Brucella melitensis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78956"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8C9"
FT                   /protein_id="AAM78956.1"
FT                   /translation="MTTMTIAKGNQPIALQLGMLNRHGLIAGATGTGKTVTLKVLAEQL
FT                   SLAGVPVFLADIKGDLSNLTKAGEVTDKLAARLATIGVSDYQPQAFPVRMWDVFGQNGQ
FT                   PLRTTISELGPMMLSRLLNLNDTQTGVLNIVFKIADEKGWLLIDLKDLQAILKEVGDHA
FT                   SDYSSHYGNMTKQSIGAIQRSLLTLEQEGAHQFFGEPALDVADLMQLDVASGYGAINIL
FT                   SATKLFQSPTLYTTFLLWLLSELYELLPEVGDVDKPKMVFFFDEAHLLFKDAPKVFLEK
FT                   VEQIVRLIRSKGVGIFFVTQNPLDLPETVLAQLGNRIQHALRAYTLKEQKAVRVAADTF
FT                   RQNPDLDVARVITELEVGEALISVLNDKGQPSIVERAYIMPPKSSFAVLSEIESQQLVQ
FT                   SSPFASKYSQSIDRDSAYEKLAAKVLEDNRLAQEAIATAQREKEAKEAIKAQAATKKAS
FT                   RRSVGRPRKTVVEKATDAFISTTVRTIGRELVRGLLGSLRKR"
FT   gene            389204..390397
FT                   /locus_tag="SpyM3_0350"
FT   CDS             389204..390397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0350"
FT                   /product="putative multi-drug resistance efflux pump"
FT                   /note="best non-GAS blastp hit: gb|AAK75093.1| (AE007401)
FT                   multi-drug resistance efflux pump [Streptococcus pneumoniae
FT                   TIGR4], and gb|AAK99679.1| (AE008461) Major facilitator
FT                   superfamily multi-drug resistance efflux pump
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78957"
FT                   /db_xref="GOA:Q8K8C8"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8C8"
FT                   /protein_id="AAM78957.1"
FT                   /translation="MNWRQNLKVAWLGNFFTGASFSLVMPFMALYVENLGTPTELVEYY
FT                   AGLAVAVTALASALFAPVWGKLADCYGRKPMMLRASFVMTFTMGGLAIIPNVFWLLILR
FT                   LLTGVFAGYVPNATALIASQAPKEESGYALGTLATGVTAGALIGPLLGGILAELLGIRQ
FT                   VFLLVGVILFLCSLMTAVYVKEEFKPIRRFEMIPTKVILKQVKSPQIMLGLFVTSMIIQ
FT                   ISAQSVTPILSLYIRHLGQIHNLMFTSGLVVSAMGFSSLFSSSYLGKLGDRFGNHRLLL
FT                   AALCYSFIMYFSSALAQTSFQLGVLRFAYGFGVGALMPSINSLLTKLTPKEGISRVFAY
FT                   NQMFSNLGQVIGPFIGSNVAVVLGYRSVFYVTSLIVFVNLIWSLIIFRKYIKVKDIV"
FT   gene            390586..390822
FT                   /locus_tag="SpyM3_0351"
FT   CDS             390586..390822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0351"
FT                   /product="putative preprotein translocase, SecG subunit"
FT                   /note="best non-GAS blastp hit: gb|AAK75095.1| (AE007401)
FT                   preprotein translocase, SecG subunit, putative
FT                   [Streptococcus pneumoniae TIGR4], and gb|AAK99681.1|
FT                   (AE008461) Protein-export membrane protein secG
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78958"
FT                   /db_xref="GOA:F7IVB7"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVB7"
FT                   /protein_id="AAM78958.1"
FT                   /translation="MYNLLLTILLVLSVLLVIAIFMQPQKNPSSNVFDSSGSEALFERT
FT                   KARGFEAFMQRFTAVLVFFWLAIALVLAILSSK"
FT   gene            390994..393249
FT                   /gene="vacB"
FT                   /locus_tag="SpyM3_0352"
FT   CDS             390994..393249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacB"
FT                   /locus_tag="SpyM3_0352"
FT                   /product="putative exoribonuclease R"
FT                   /note="best non-GAS blastp hit: gb|AAK99682.1| (AE008462)
FT                   Exoribonuclease R [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78959"
FT                   /db_xref="GOA:Q8K8C7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8C7"
FT                   /protein_id="AAM78959.1"
FT                   /translation="MAGAKRFPSLIKTISKMESQSLLRFSDDGSLALRKEREKKKEPTV
FT                   QGVFRANKAGFGFLHVDENEDDMFIGRNDVGYAIDGDTVEVVVKKPADRLKGTAAEAKV
FT                   VAIVDRSLKTAVGTFILDDDKPKYAGYIRSKNQKIQQKIYIKKEPVVLKGTEIIKVDID
FT                   KYPTRGHDYFVASVRDIVGHQGDVGIDVLEVLESMDIVSEFPAEVLVEANAISEAPTAK
FT                   DLIGRVDLRQETTITIDGADAKDLDDAIHIKLLDNGNYELGVHIADVSYYVTEGSALDK
FT                   EAIARGTSVYVTDRVVPMLPERLSNGICSLNPNVDRLTQSALMEINSQGHVVNYQICQS
FT                   VIKTTYRMTYSTVNDMIAGDEEALQEFASIADDVTLMVALHRILEAMRSKRGALNFDTQ
FT                   EAKVIVNDKGMPVDVVLRQRGIAERMIESFMLAANECVAEHFAKAKLPFIYRIHEEPKA
FT                   EKLQQFIDYASTFGIHIQGTANKISQEALQAFMAKVEGQPGAEVLNMMLLRSMQQARYS
FT                   EHNHGHYGLAAEYYTHFTSPIRRYPDLLVHRMVREYSQPSQEKRDHFTQIIPELATSSS
FT                   QLERRAIDAERVVEAMKKAEYMAEYVGEEFDGIVASVVKFGFFVELPNTIEGLVHITSL
FT                   PEYYHFNERTLSLQGEKSGKVFKVGQPIRVKLVKADKETGDIDFEYLPSDFDVVEKIKM
FT                   SDKASRRDRRKSSKSSKGIKKKEPKEVAKAKTKGKTKKGSKKPFYKEQAKKKSRKRS"
FT   gene            393252..393719
FT                   /gene="smpB"
FT                   /locus_tag="SpyM3_0353"
FT   CDS             393252..393719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="SpyM3_0353"
FT                   /product="putative tmRNA-binding protein"
FT                   /note="best non-GAS blastp hit: sp|Q9CEW2|SSRP_LACLA
FT                   SsrA-binding protein, and gb|AAK05820.1|AE006402_8
FT                   (AE006402) tmRNA-binding protein SmpB [Lactococcus lactis
FT                   subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78960"
FT                   /db_xref="GOA:P0DF80"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF80"
FT                   /protein_id="AAM78960.1"
FT                   /translation="MAKGEGHILAQNKKARHDYHIVETVEAGIVLTGTEIKSVRAARIQ
FT                   LKDGFAQIKNGEAWLVNVHIAPFEQGNIWNADPERTRKLLLKKREITHLENELKGSGMT
FT                   LVPLKVYLKDGFAKVLIGLAKGKHEYDKRETIKRRDQERDIKKQMKHYNAR"
FT   gene            393734..394444
FT                   /locus_tag="SpyM3_0354"
FT   CDS             393734..394444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0354"
FT                   /product="putative glutamine cyclotransferase"
FT                   /note="best non-GAS blastp hit: pir||E75557 glutamine
FT                   cyclotransferase - Deinococcus radiodurans (strain R1), and
FT                   gb|AAF09704.1|AE001874_1 (AE001874) glutamine
FT                   cyclotransferase [Deinococcus radiodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78961"
FT                   /db_xref="GOA:Q8K8C5"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8C5"
FT                   /protein_id="AAM78961.1"
FT                   /translation="MITKGQVRLLRTYSYDSNLYTQGLEQLNNNHILLSAGRYGFSKVG
FT                   MYDLTQEIFSEKIAFPDTVFAEGLTVVEDYFWLLTYKEGVAYKFDKATCNCLGAYPFEG
FT                   DGWGLAYDKENQCLWMTSGNAFLQKRDPKDFALLDTVLVAIESVPISMLNELEYVDGYL
FT                   YANIWQTNTIVKLQPDSGKVVATYDISPLLKALNLDKSHYPDLNVLNGIAHLDQQRFLI
FT                   TGKLYPLMLEVVLD"
FT   gene            complement(394561..395208)
FT                   /gene="pcp"
FT                   /locus_tag="SpyM3_0355"
FT   CDS             complement(394561..395208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="SpyM3_0355"
FT                   /product="putative pyrrolidone-carboxylate peptidase"
FT                   /note="best non-GAS blastp hit: gb|AAK74988.1| (AE007391)
FT                   pyrrolidone-carboxylate peptidase [Streptococcus pneumoniae
FT                   TIGR4], and gb|AAK99566.1| (AE008452)
FT                   Pyrrolidone-carboxylate peptidase (5-oxoprolyl-peptidase)
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78962"
FT                   /db_xref="GOA:P0DC94"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC94"
FT                   /protein_id="AAM78962.1"
FT                   /translation="MKILVTGFDPFGGEAINPALEAIKKLPATIHGAEIKCIEVPTVFQ
FT                   KSADVLQQHIESFQPDAVLCIGQAGGRTGLTPERVAINQDDARIPDNEGNQPIDTPIRV
FT                   DGKAAYFSTLPIKAMVAAIHQAGLPASVSNTAGTFVCNHLMYQALYLVDKYCPNAKAGF
FT                   MHIPFMMEQVVDKPNTAAMNLDDITRGIEAAIFAIVDFKDRSDLKRVGGATH"
FT   gene            complement(395258..396184)
FT                   /locus_tag="SpyM3_0356"
FT   CDS             complement(395258..396184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74987.1| (AE007391)
FT                   membrane protein [Streptococcus pneumoniae TIGR4], and
FT                   gb|AAK99565.1| (AE008452) Conserved hypothetical protein
FT                   [Streptococcus pneumoniae R6"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78963"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFD9"
FT                   /protein_id="AAM78963.1"
FT                   /translation="MANIANLVLETIYILIGLQLFHTAYCTFKDKTNPVYFGTALFWGL
FT                   LGVTFVGGAFLPNKVIGFIVIVLALLTLFKQVRIGTLPAFNEQKAEESAHRIGNWIFLP
FT                   VMLMAMISLLLALILPDFSKSAIGIAGILATIAILIITKQKPSALLAENNRMNQQVSTS
FT                   GILPQLLGALGAIFAAAGVGDVIASLIREIVPADSRFFGVLAYVLGMVIFTMIMGNAFA
FT                   AFTVITTGIGVPFVFALGADPIIAGALAMTAGFCGTLLTPMAANFNALPVALMEIKDRN
FT                   AVIKKQAPIALVLIISHIALMYLLAYY"
FT   gene            complement(396184..396867)
FT                   /locus_tag="SpyM3_0357"
FT   CDS             complement(396184..396867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74986.1| (AE007391)
FT                   membrane protein, putative [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78964"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:F7IV58"
FT                   /protein_id="AAM78964.1"
FT                   /translation="MEWIKLIGIVIIVLGFILKFDAIATVVVAGLVTALVSGISFIDFL
FT                   DILGKEFTNQRLLTIFFITLPLIGLSETYGLKHRATQLIQRVQALTVGRLLTLYLIIRE
FT                   LAGLFSIRLGGHPQFVRPLIQPMGEAAAKANIGEELTDAEKDDIKAMAAANENFGNFFA
FT                   QNTFVGAGGVLLIAGTLEQLGYDGNQAKIAFSSILIAIISIIIVAIYNYLFEKKMERQH
FT                   QKGDN"
FT   gene            complement(397078..398064)
FT                   /locus_tag="SpyM3_0358"
FT   CDS             complement(397078..398064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0358"
FT                   /product="putative sugar transferase"
FT                   /note="best non-GAS blastp hit: gb|AAK04205.1|AE006249_2
FT                   (AE006249) glycosil transferase [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78965"
FT                   /db_xref="GOA:Q8K8C3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8C3"
FT                   /protein_id="AAM78965.1"
FT                   /translation="MKYLSFCVTIALKFHLKEKSMTLLSIIVPCFNEEANILPYFEEMH
FT                   QLETSMTNQLAFEYIFIDDGSKDNTLGILRELAARFPNVHYLSFSRHFGKEAGLLAGLK
FT                   EAKGNYITVMDVDLQDPPELLPIMYAKLKEGYDIVGTRRQNRQGEPLMRSMCSNLFYGL
FT                   IKHLSDTEMVNGVRDYRLMTRQVVDSILELGEVNRFSKGIFSWVGYRITYLSFENQKRK
FT                   YGKSRWHFWELLRYSLDGFINFSEMPLTIATWTGTFSFLISIFAILFIIIRKILFGDPV
FT                   SGWASTVSIILFMGGIQLFCMGIIGKYISKIFLETKKRPLYIIKEKH"
FT   gene            complement(398149..398526)
FT                   /gene="gloA"
FT                   /locus_tag="SpyM3_0359"
FT   CDS             complement(398149..398526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="SpyM3_0359"
FT                   /product="putative lactoylglutathione lyase"
FT                   /note="best non-GAS blastp hit: gb|AAK75083.1| (AE007400)
FT                   lactoylglutathione lyase [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78966"
FT                   /db_xref="GOA:Q7CFD7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFD7"
FT                   /protein_id="AAM78966.1"
FT                   /translation="MKALHTCIRVKDLDQSVAFYTSAFPFKENYRKDFPDSQFTLVYLA
FT                   LEGESYELELTYNYGHGDYDLGNGYGHIALGSEHFEADHKKHRQAGFPVTDIKELADKS
FT                   ARYYFIQDPDGYKIEVIDLNN"
FT   gene            complement(398537..399202)
FT                   /locus_tag="SpyM3_0360"
FT   CDS             complement(398537..399202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0360"
FT                   /product="putative NAD(P)H-flavin oxidoreductase"
FT                   /note="best non-GAS blastp hit: gb|AAC22926.1| (U32807)
FT                   NAD(P)H-flavin oxidoreductase [Haemophilus influenzae Rd]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78967"
FT                   /db_xref="GOA:F7IUI0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:F7IUI0"
FT                   /protein_id="AAM78967.1"
FT                   /translation="MDQTIHHQIQQALHFRTAVRVYKEEKISDEDLALILDAAWLSPSS
FT                   VGLEGWRFVVLDNKPIKEEIKPFAWGAQYQLETASHFILLIAEKHARYDSPAIKNSLLR
FT                   RGIKEGDGLNSRLKLYESFQKEDMDMADNPRALFDWTAKQTYIALGNMMMTAALLGIDT
FT                   CPIEGFHYDKVNHILAKHNVIDLEKEGIASMLSLGYRLRDPKHAQVRKPKEEVISVVK"
FT   gene            complement(399251..400336)
FT                   /gene="pepQ"
FT                   /locus_tag="SpyM3_0361"
FT   CDS             complement(399251..400336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="SpyM3_0361"
FT                   /product="putative Xaa-Pro dipeptidase"
FT                   /note="best non-GAS blastp hit: gb|AAC46293.1| (AF014460)
FT                   PepQ [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78968"
FT                   /db_xref="GOA:Q8K8C2"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8C2"
FT                   /protein_id="AAM78968.1"
FT                   /translation="MTKLDQIRLYLDQKGAELAIFSDPVTINYLTGFFCDPHERQLFLF
FT                   VYHDLAPVLFVPALEVARASQAISFPVFGYVDSENPWEKIKAVLPNTAAKTIYAEFDHL
FT                   NVNKFHGLQTIFSGQFNNLTPYVQGMRLVKSADEINKMMIAGQFADKAVQVGFDNISLD
FT                   ATETDVIAQIEFEMKKQGIHKMSFDTMVLTGNNAANPHGIPGTNNIENNALLLFDLGVE
FT                   TLGYTSDMTRTVAVGQPDQFKIDIYNLCLEAQLAAIDFIKPGVTAAQVDAAARQVIEKA
FT                   GYGQYFNHRLGHGIGMDVHEFPSIMAGNDLVLEEGMCFSVEPGIYIPGKVGVRIEDCGH
FT                   VTKNGFEVFTHTPKELLYFEG"
FT   gene            400510..401511
FT                   /gene="ccpA"
FT                   /locus_tag="SpyM3_0362"
FT   CDS             400510..401511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /locus_tag="SpyM3_0362"
FT                   /product="putative catabolite control protein"
FT                   /note="best non-GAS blastp hit: dbj|BAA88121.3| (AB028599)
FT                   catabolite control protein A [Streptococcus bovis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78969"
FT                   /db_xref="GOA:F7IUC6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR006377"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:F7IUC6"
FT                   /protein_id="AAM78969.1"
FT                   /translation="MNTDDTITIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVI
FT                   DRLDYRPNAVARGLASKKTTTVGVVIPNIANSYFSILAKGIDDIAAMYKYNIVLASSDE
FT                   DDDKEVNVVNTLFAKQVDGIIFMGHHLTEKIRAEFSRSRTPVVLAGTVDLDHQLPSVNI
FT                   DYRAAVSNVVDILAENHKCIAFVSGPLIDDINGKVRLAGYKEGLKHNKLDFKEGLVFEA
FT                   NYSYKEGFELAQRVINSGATAAYVAEDELAAGLLNGLFEAGKRVPEDFEIITSNDSPVV
FT                   QYTRPNLSSISQPVYDLGAVSMRMLTKIMNKEELEEKEILLNHGIKKRGTTK"
FT   gene            401642..402640
FT                   /locus_tag="SpyM3_0363"
FT   CDS             401642..402640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0363"
FT                   /product="putative sugar transferase"
FT                   /note="best non-GAS blastp hit: gb|AAK06235.1|AE006442_2
FT                   (AE006442) glycosyltransferase [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78970"
FT                   /db_xref="GOA:Q7CFD4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFD4"
FT                   /protein_id="AAM78970.1"
FT                   /translation="MKVLLYLEAENYLRKSGIGRAIKHQAKALSLVGQHFTTNPRETYD
FT                   LVHLNTYGLKSWLLMIKAQKAGKKVIMHGHSTEEDFRNSFIFSNLLSPWFKKYLCHFYN
FT                   KADAIITPTLYSKSLIESYGVKSPIFAVSNGIDLEQYGADPKKEAAFRRYFDIKEGEKV
FT                   VMGAGLFFLRKGIDDFVKVAQAMPDVRFIWFGETNKWVIPAQVRQMVNGNHPKNLIFPG
FT                   YIKGDVYEGAMTGADAFFFPSREETEGIVVLEALASRQHLVLRDIPVYYGWVDQSSAEL
FT                   ATDIPGFIEALKKVFSGASNKVEAGYKVAQSRRLETVGHALVDVYKKVMEL"
FT   gene            402642..403976
FT                   /locus_tag="SpyM3_0364"
FT   CDS             402642..403976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0364"
FT                   /product="putative sugar transferase"
FT                   /note="best non-GAS blastp hit: gb|AAK75189.1| (AE007409)
FT                   glycosyl transferase, group 1 [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78971"
FT                   /db_xref="GOA:Q8K8C1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8C1"
FT                   /protein_id="AAM78971.1"
FT                   /translation="MRIGLFTDTYFPQVSGVATSIRTLKEELEKEGHEVYIFTTTDRDV
FT                   KRFEDPTIIRLPSVPFVSFTDRRVVYRGLISSYKIAKHYNLDIIHTQTEFSLGLLGKMI
FT                   GKALRIPVVHTYHTQYEDYVSYIANGKIIRPSMVKPLLRGYLKDLDGVICPSRIVLNLL
FT                   EGYEVTIPKRVIPTGIPLEKYIRDDITAEEVTNLKAELGIAGDETMLLSLSRISYEKNI
FT                   QAIINQMPAILAENAKIKLIIVGDGPYLQDLKHLAMQLEVDKHVTFTGMVPHDKVALYY
FT                   KACDFFISASTSETQGLTYIESLASGTPIIAHGNPYLDDVVTDKMFGTLYYAETDLTDA
FT                   IIDAILKTPVMDKRLLAKKRYEISAQHFGKSIYTFYLDTLIARNSKEAQKLSLYLNHSG
FT                   KSSSLKLVQGAIHLPKRAAKVTAITSVKVVKAPIKLVHAIKDFLD"
FT   gene            404398..406341
FT                   /gene="thrS"
FT                   /locus_tag="SpyM3_0365"
FT   CDS             404398..406341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="SpyM3_0365"
FT                   /product="putative threonyl-tRNA synthetase"
FT                   /note="best blastp hit: gb|AAK33516.1| (AE006509) putative
FT                   threonyl-tRNA synthetase 1 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78972"
FT                   /db_xref="GOA:P0DG58"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG58"
FT                   /protein_id="AAM78972.1"
FT                   /translation="MIKITFPDGAVREFESGVTTFDIAESISKSLAKKALAGKFNDQLI
FT                   DTTRAIEEDGSIEIVTPDHKDAYEVLRHSAAHLFAQAAKRLFPNLHLGVGPAIAEGFYY
FT                   DTDNTEGQISNEDLPRIEAEMQKIVTENYPCIREEVTKEEALELFKDDPYKVELINEHA
FT                   GAGLTVYRQGEFVDLCRGPHVPSTGRIQVFHLLNVAGAYWRGNSDNNMMQRIYGTAWFD
FT                   KKDLKAYLTRLEEAKERDHRKLGKELDLFMISQEVGQGLPFWLPDGATIRRTLERYITD
FT                   KELASGYQHVYTPPLASVELYKTSGHWDHYQEDMFPVMDMGDGEEFVLRPMNCPHHIQV
FT                   YKNHVRSYRELPIRIAELGMMHRYEKSGALSGLQRVREMTLNDGHIFVTPEQIQEEFQR
FT                   ALQLIIDVYADFNLTDYRFRLSYRDPNDTHKYYDNDEMWENAQSMLKAALDEMGVDYFE
FT                   AEGEAAFYGPKLDIQVKTALGNEETLSTIQLDFLLPERFDLKYIGADGEEHRPVMIHRG
FT                   VISTMERFTAILIETYKGAFPTWLAPHQVTVIPISNEAHIDYAWEVAKTLRDRGVRADV
FT                   DDRNEKMQYKIRASQTSKIPYQLIVGDKEMEEKSVNVRRYGSKATHTESVEEFVENILA
FT                   DIARKSRPDAQA"
FT   gene            406482..407474
FT                   /locus_tag="SpyM3_0366"
FT   CDS             406482..407474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0366"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74786.1| (AE007372)
FT                   ABC transporter, ATP-binding protein [Streptococcus
FT                   pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78973"
FT                   /db_xref="GOA:Q8K8B9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8B9"
FT                   /protein_id="AAM78973.1"
FT                   /translation="MVMIEVSHLQKNFSKTIKEPGLKGALKSFVHPQREIFEAVKDLSF
FT                   EVPKGQILGFIGANGAGKSTTIKMLTGILKPTSGYCRINGKIPQDNRQDYVRDIGAVFG
FT                   QRTQLWWDLALQETYVVLKEIYDVPEKAFRKRMDFLNEVLDLNEFIKDPVRTLSLGQRM
FT                   RADIAASLLHNPKVLFLDEPTIGLDVSVKDNIRRAITQINQEEKTTILLTTHDLSDIEQ
FT                   LCDRIIMIDKGQEIFDGTVTQLKQSFGKMKSLSFELKPGQEQVVSQFMGLPDITVERHE
FT                   LSLDIQYDSSRYQTADIIQKTMADFAVRDLKMTDVDIEDIVRRFYRKEL"
FT   gene            407476..408294
FT                   /locus_tag="SpyM3_0367"
FT   CDS             407476..408294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99362.1| (AE008434)
FT                   Conserved hypothetical protein [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78974"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8B8"
FT                   /protein_id="AAM78974.1"
FT                   /translation="MWSFWKRYRPFLSAGIQELITYRVNFFLYRIGDVMGAFVAYYLWK
FT                   AVFDSSKQSLINGFTLSDMTFYIIMSFVTTLLTKSDSSFMIGEEVKDGSIIMRLLRPVH
FT                   FAASYLFMEIGFRWIVLMSVGFPFLVVLSGIKVMAGLSILQVLASSCLYLVSLLLAFLI
FT                   NFYFNICFGFSAFVFKNLWGSNLLKNALVAFMSGSLIPLAFFPKMVSIVLSFLPFSSLV
FT                   YTPVMIVIGKYSLSQIMVALSLQIFWLLVMVVLSQVIWKKVQYHLTIQGG"
FT   gene            408296..409081
FT                   /locus_tag="SpyM3_0368"
FT   CDS             408296..409081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74788.1| (AE007372)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78975"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8B7"
FT                   /protein_id="AAM78975.1"
FT                   /translation="MAKLRRMHAIFIKQYLKQIMEYKVDFVVGVLGVFLTQGLNLLFLS
FT                   VLFQHIPSLEGWTFEQIAFIYGFSLIPKGIDHLFFDNLWALGQRLVRKGEFDKYLTRPI
FT                   SPLFHVLVETFQVDALGELLVGVILLVTTAGSIVWTLPKVLLFILVIPFATLIYTSLKI
FT                   ATASISFWTKQSGAVIYIFYMFNDFSKYPMSIYHSFLRWLISFVIPFAFTAYYPASYFL
FT                   TGQHLLFNIGGLVVVSLLVLALSLKLWKWGLDAYESAGS"
FT   gene            409827..410975
FT                   /locus_tag="SpyM3_0369"
FT   CDS             409827..410975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0369"
FT                   /product="putative acetyl coenzyme A acetyltransferase"
FT                   /note="best non-GAS blastp hit: gb|AAK05881.1|AE006408_5
FT                   (AE006408) acetyl coenzyme A acetyltransferase (EC 2.3.1.9)
FT                   [Lactococcus lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78976"
FT                   /db_xref="GOA:Q8K8B6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8B6"
FT                   /protein_id="AAM78976.1"
FT                   /translation="MTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPAPI
FT                   DQVICGNTVGTGGNIGRLMTLYSHLGESVSALTVDMQCASAGAALSVGYAKIKAGMASN
FT                   LLVGGIESSSLQPESVYASADWRQGAYKVAQFSPDSISPFAMIEGAERVAREHGFTKEY
FT                   LNHWTLRSHQKASYCQEQALLADLILDLPGASDQGIRPRLSSKVLSKVPPILGEDHVIS
FT                   AANACLTHDAAAFLQLSSQPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLEKHGLGMAD
FT                   MTAIEWNEAFAVIDGLFETHYPDLLDRYNIFGGALAYGHPYGASAAIIILHLMRALEIK
FT                   NGRYGIAAIAAAGGQGFAVLLKYHKEFSHADKARILGKAMPK"
FT   gene            410932..412179
FT                   /locus_tag="SpyM3_0370"
FT   CDS             410932..412179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK05880.1|AE006408_4
FT                   (AE006408) hypothetical protein [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78977"
FT                   /db_xref="GOA:Q8K8B5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8B5"
FT                   /protein_id="AAM78977.1"
FT                   /translation="MLTKLEYWAKQCPNKKAIVADQISLTHQELWQAVLIKDQTIKDSV
FT                   PYIISHSRYLNQLLSFLRGLKEGSCPIILHPNISGTFQQQIKHVDSELLKKADFAVLSS
FT                   GTTGKAKLFWRCLSTWTRLFDYQNKVFGMTGNSCLFLHGSFSFTGNLNLALAQLWAGGC
FT                   LVLSQKLSLKTWLSLWQAKKVSHLYLLPTYLNRLLPYLTKNNMTATHLLTSSQMISQEL
FT                   LRHYYKKFPQLEIVIFYGASELSFITWCNGRAAVKINGLVGQPFPDVSISFKDKEIFVE
FT                   TPYSVEGMSQPYSVSDLGKMSPAGLILEGRQDDWVNQRGVKCHLPSLVELAHQAPNVKE
FT                   AHALKIGKGENETLILVLVLTKKDCLAPIKDFLALYLNSGQLPKYYLVIDCLPLRDNGK
FT                   INREVLLNKIPKQWLS"
FT   gene            412275..413270
FT                   /locus_tag="SpyM3_0371"
FT   CDS             412275..413270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0371"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33522.1| (AE006510)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78978"
FT                   /db_xref="InterPro:IPR021462"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8B4"
FT                   /protein_id="AAM78978.1"
FT                   /translation="MKQAILDRYQALKCYQNAGLSNQAFRAIAKEPIIDNRLGSSTFWV
FT                   IWPIEKENQSAKQLLTFLLDLVEMPFELSGQLHETQTLLTRFHPSLLPDHIFWKELASL
FT                   VDQAFPGKTLSQAGELEKRLHQFRYVISSQQAQSIRNHYKMIEMTDAQALALFLRSKKG
FT                   PCLWRQAPDYTLMDSARLHNKLRFEDNKVIFPSQEVSYNIKVLLWFHTEFILDSTGFFL
FT                   NEVDAEVVTEKGIVNGASFNYGTDGPRHWDLDVDPISHHDPQFRRDTLKGFRSPKRVFR
FT                   QWFRAQKDDFMFSYFNAKGLFAYHNKSSFARVKKSAKQFKRQIHPIKGWF"
FT   gene            413432..414142
FT                   /gene="vicR"
FT                   /locus_tag="SpyM3_0372"
FT   CDS             413432..414142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicR"
FT                   /locus_tag="SpyM3_0372"
FT                   /product="two-component response regulator"
FT                   /note="best blastp hit: emb|CAB65451.1| (AJ012051) VicR
FT                   protein [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78979"
FT                   /db_xref="GOA:Q7CFD3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFD3"
FT                   /protein_id="AAM78979.1"
FT                   /translation="MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEK
FT                   PDLIILDLMLPELDGLEVAKEIRKTSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFS
FT                   NRELLARVKAHLRRTETIETAVAEENASSGTQELTIGNLQILPDAFVAKKHGQEVELTH
FT                   REFELLHHLANHMGQVMTREHLLEIVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYI
FT                   LTRRGVGYYMKSYD"
FT   gene            414135..415487
FT                   /gene="vicK"
FT                   /locus_tag="SpyM3_0373"
FT   CDS             414135..415487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicK"
FT                   /locus_tag="SpyM3_0373"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="best blastp hit: emb|CAB65452.1| (AJ012051) VicK
FT                   protein [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78980"
FT                   /db_xref="GOA:Q7CFD2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFD2"
FT                   /protein_id="AAM78980.1"
FT                   /translation="MTRDIIGNLSTFELAILILLVFVAFYFIHLAVRDYRNARIIRMMS
FT                   HKIRDLINGRYTDIIDEKADIELMELSDQLNDLSDVFRLTHENLAQEKNRLASILAYMS
FT                   DGVLATDRSGKIIMINETARKQLNLSKEEALKKNITDLLEGDTSYTYRDLVSKTPVVTV
FT                   NSRNDMGEFVSLRLRFALNRRESGFISGLVVVLHDTTEQEKEERERRLFVSNVSHELRT
FT                   PLTSVKSYLEALDEGALKEDIAPSFIKVSLDETNRMMRMISDLLNLSRIDNQVTQLAVE
FT                   MTNFTAFITSILNRFDLVKNQHTGTGKVYEIVRDYPITSVWIEIDNDKMTQVIENILNN
FT                   AIKYSPDGGKITVRMKTTDTQLIISISDQGLGIPKTDLPLIFDRFYRVDKARSRAQGGT
FT                   GLGLAIAKEIIKQHHGFIWAKSDYGKGSTFTIVLPYEKDAAIYEEWEEDVD"
FT   gene            415491..416300
FT                   /gene="vicX"
FT                   /locus_tag="SpyM3_0374"
FT   CDS             415491..416300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicX"
FT                   /locus_tag="SpyM3_0374"
FT                   /product="VicX protein"
FT                   /note="best blastp hit: emb|CAB65453.1| (AJ012051) VicX
FT                   protein [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78981"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFD1"
FT                   /protein_id="AAM78981.1"
FT                   /translation="MNESGFKYSILASGSTGNCFYLETPKKRLLIDAGLTGKKITSLLA
FT                   EIDRKPEDLDAILITHEHSDHIKGVGVMARKYHLDIYANEKTWQLMDECNMLGKLDASQ
FT                   KHIFQRDKVLTFGDVDIESFGVSHDAIDPQFYRIMKDNKSFVMLTDTGYVSDRMTGIIE
FT                   NADGYLIESNHDIEILRSGSYPWSLKQRILSDLGHLSNEDGAGAMIRSLGYNTKKIYLG
FT                   HLSKENNIKELAHMTMVNQLAMADLAVGTDFTVHDTSPDTACPLTDI"
FT   gene            416743..417435
FT                   /gene="acpA"
FT                   /locus_tag="SpyM3_0375"
FT   CDS             416743..417435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpA"
FT                   /locus_tag="SpyM3_0375"
FT                   /product="putative ribonuclease III"
FT                   /note="best non-GAS blastp hit: gb|AAK99930.1| (AE008485)
FT                   Ribonuclease III [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78982"
FT                   /db_xref="GOA:P0DF14"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF14"
FT                   /protein_id="AAM78982.1"
FT                   /translation="MKQLEELLSTSFDIQFNDLTLLETAFTHTSYANEHRLLNVSHNER
FT                   LEFLGDAVLQLIISEYLFAKYPKKTEGDMSKLRSMIVREESLAGFSRFCSFDAYIKLGK
FT                   GEEKSGGRRRDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQVEKGNFERVKDYKT
FT                   CLQEFLQTKGDVAIDYQVISEKGPAHAKQFEVSIVVNGAVLSKGLGKSKKLAEQDAAKN
FT                   ALAQLSEV"
FT   gene            417436..420963
FT                   /gene="smc"
FT                   /locus_tag="SpyM3_0376"
FT   CDS             417436..420963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="SpyM3_0376"
FT                   /product="putative chromosome condensation and segregation
FT                   SMC protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99929.1| (AE008485)
FT                   chromosome condensation and segregation SMC protein
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78983"
FT                   /db_xref="GOA:Q8K8B3"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8B3"
FT                   /protein_id="AAM78983.1"
FT                   /translation="MFLKEIELEGFKSFADKTKIEFYKGVTAVVGPNGSGKSNITESLR
FT                   WALGESSAKNLRGGKMPDVIFAGTQNRNPLNYAKVAVVLDNSDHFIKTAKKEIRVERHI
FT                   YRNGDSDYLIDGRKVRLRDIHDLFMDTGLGRDSFSIISQGRVEEIFNSKPEERRAIFEE
FT                   AAGVLKYKTRKKETQIKLNQTQDNLDRLEDIIYELDTQLAPLEKQAKVAKQFLELDANR
FT                   KQLQLDILVKDIDIAQERQTKDTEALAVLQQDLASYYAKRQSMEEDYQKFKQKKQVLSQ
FT                   ESDQTQTTLLELTKLIADLEKQIELVKLESGQEAEKKAEAKKHLEQLQEQLDGFQAEEK
FT                   QRTEQLLHIDQQLCDVKQQLNELSNALERFSSDPDQLMETLREEFVLLMQKEAALSNQL
FT                   TALKAHLDKEKQARQHKAQEYQLLVTKLDQLNDESQKAQAHYKAQKEQVEMLLQNYQEG
FT                   DKRVQELERDYQLNQERLFDLLDQKKGKEARKASLESIQKSHSQFYAGVRAVLQSQKKL
FT                   GGIIGAVSEHLSFDSDYQTALEIALGANSQHIIVTDEAAAKRAIAYLKKNRQGRATFLP
FT                   LTTIKARSLSEHYHRQLATCEGYLGTAESLVRYDDSLSAIIQNLLSSTAIFETIDQANI
FT                   AARLLGYKVRIVTLDGTELRPGGSFSGGANRQSNTTFIKPELEQISEELTRLVEQLKIT
FT                   EKEVAALQSDLIAKKEELTQLKLAGDQARLAEQRAQMAYQQLQEKQEDSKALLAALDQS
FT                   QTTHSDESLLAEQARIEEALTAIAKKKSALTCDIDDIKENKDLIRQKTQNIHQALSQAR
FT                   LQERDLLNEKKFEQANQSRLRTQLKQCQQNILKLESILNNNVSQDSIQRLPQWQKQLQD
FT                   ATEHKSGAQKRLVQLRFEIEDYEAHLEETAEKITKESEKNDTFIRRQTKLETHLEQVAN
FT                   RLRAYAKSLSEDFQMTLADAKEVTNSIDHLESAKEKLHHLQKTIRALGPINSDAIIQYE
FT                   EVHERLTFLTSQKTDLTKAKNLLLETINSMDSEVKARFKVTFEAIQKSFKETFTQMFGG
FT                   GSADLVLTETDLLSAGIEISVQPPGKKIQSLNLMSGGEKALSALALLFAIIRVKTIPFV
FT                   ILDEVEAALDEANVKRFGDFLNRFDKDSQFIVVTHRKGTMAAADSIYGITMQESGVSKI
FT                   VSVKLKEAQ"
FT   gene            complement(421228..422079)
FT                   /locus_tag="SpyM3_0377"
FT   CDS             complement(421228..422079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0377"
FT                   /product="putative positive transcriptional regulator"
FT                   /note="best non-GAS blastp hit: gb|AAK99764.1| (AE008468)
FT                   Similar to positive transcriptional regulator MutR.
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78984"
FT                   /db_xref="GOA:Q8K8B2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8B2"
FT                   /protein_id="AAM78984.1"
FT                   /translation="MKSKLGATLRKVRKGKQISLCFVADEHLSKSQISRFERGESEISC
FT                   IRLINILDKLHITLDEFLILHDEDYTNSETFANLVQYIRKQYSSQNINNIACLLSDTSD
FT                   YTLNSFEKTMVKSILHTMDSSIIPSDDELLQLTDYLFKVKKWGYYEILLLGNCVRTINY
FT                   NSYFLLTKEMLNNYIYSSRNKTNKRIVTQLAINCFILSINKEEFSNCSYLIDEIKTLLD
FT                   NELNFYEQTVFLYATGYFEFKRQLETGVEKMKQAIQVLDILNEDKLKLHYADHFDKLVN
FT                   KD"
FT   gene            422354..423226
FT                   /gene="aroE.2"
FT                   /locus_tag="SpyM3_0378"
FT   CDS             422354..423226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE.2"
FT                   /locus_tag="SpyM3_0378"
FT                   /product="putative shikimate 5-dehydrogenase"
FT                   /note="best non-GAS blastp hit: gb|AAL81817.1| (AE010267)
FT                   shikimate 5-dehydrogenase [Pyrococcus furiosus DSM 3638]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78985"
FT                   /db_xref="GOA:Q8K8B1"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8B1"
FT                   /protein_id="AAM78985.1"
FT                   /translation="MYSALLGNPVEHSISDELFEYLNHNIGVLDEYKHKKILVDSVCLE
FT                   DKIKHLINDPKCIGLNITLPYKREVMRYIDNLDRVAEITGSVNNIYKSGNIITGTNTDW
FT                   KGIYNTLVFFNISHITKCCVLGTGGTARAAIFTLQKLQISPTVVYREPISENTRSLIKS
FT                   FPDLKYITYKELADQQILNDIEIIINTTPVGMINYEESLPINFDHLDNVNYKDKYFMDV
FT                   VFNPLHTKLHEYFGKRGAKIIDGLWVLIFQGIEAFSLWSDKINGGKYFFSKDDVVLIHT
FT                   FLEGKIKGK"
FT   gene            423223..424059
FT                   /locus_tag="SpyM3_0379"
FT   CDS             423223..424059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK43130.1| (AE006894)
FT                   hypothetical protein [Sulfolobus solfataricus]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78986"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFD0"
FT                   /protein_id="AAM78986.1"
FT                   /translation="MTFHITVNLDEISDKLDDSLKFLNRLSIKSCELRMINTKNIIQLS
FT                   DAELINLKERLQKYNITPISIASPLFKWNIEENHLESNLDLYGISANVTLNEQWLYVRK
FT                   IIFIAKFLNIKYVRIFGGIGCSVDDFLNNELFLNLLKETEIIFLIENELGTSVSTADDL
FT                   LKIGHFIDEKSIKNLKIWFDIANYYIVEPQVDKVIPKLKKYIYYIHCKNYVNNDLGIHY
FT                   VELGKGIIDYKTIIHEIHEHFIDLIFSLEVHEKEIDKKAEVVRKSYLTLNEYINGG"
FT   gene            424061..424795
FT                   /locus_tag="SpyM3_0380"
FT   CDS             424061..424795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAB85515.1| (AE000874)
FT                   conserved protein [Methanothermobacter thermautotrophicus]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78987"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8B0"
FT                   /protein_id="AAM78987.1"
FT                   /translation="MNLSIFGLKNIPYLKEGDSIEKLIEESIKTSGFFIEDNDVLCIAS
FT                   KVVSVAEGQVMSLNEIQVSDVAKEIHRNIPRKDPRIIEIMLNLVNRDLSRLDIKKNYIG
FT                   CRLENGLKLTSGGIDRKSVDEVFLLPNNPDASVKRISEYLKKSLGKNVAVVITDSDGRE
FT                   DKRGATQVAIGIYGIHPLRKTEVIDSQGETIKFQEETLCDMIAACAGLVMGQRGTGIPA
FT                   VLIRGLDYKWSENTSIKEALNE"
FT   gene            424788..425774
FT                   /locus_tag="SpyM3_0381"
FT   CDS             424788..425774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0381"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33532.1| (AE006511)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78988"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8A9"
FT                   /protein_id="AAM78988.1"
FT                   /translation="MSRNQDCKNILIIGFGKIGKIKAYKWLSRGYEVYVKDLKFSSMKY
FT                   LNTNSDVLDDLSRQYFTIEICTPTNHHLTLLKTVITRYVYTYISIEKPLCNRLEDLEEM
FT                   KSLVESHPHLAKKMFASEQYFFSKILEKLLQVDCFSLDKIKEITVNFSKDRIEDNENGR
FT                   FLDKEILGYGIEIPHIIAVISYLGISLEEFKKGIFVNAIYIKDLEKHDYSIEILSCINQ
FT                   TVIKIISNLGSFAIREGKIEGGDAKTVRRVTIDDKTILFDPHPKLERYKSELVTGTNTF
FT                   QIHDDMMDTYISLLEGNAIPEDCYINNAIEITKLLINLYSECEKIYL"
FT   gene            425784..426983
FT                   /locus_tag="SpyM3_0382"
FT   CDS             425784..426983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0382"
FT                   /product="putative S-adenosylmethionine synthetase"
FT                   /note="best blastp hit: gb|AAK33533.1| (AE006511) putative
FT                   S-adenosylmethionine synthetase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78989"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF56"
FT                   /protein_id="AAM78989.1"
FT                   /translation="MDLKITNGFYDPSHLSYEVVERKGLGHPDTLADGIAEQIEIDYSL
FT                   YCLDKFGVIPHHNFDKIIIRGGHSVQDFGGSDFIEPIKIIFLGRASKKCFNSSIPLFKI
FT                   QKKAATKYLNRILPNLDVENYVEFETLTSDFTTKTNWFSPEAIEDLPEYLDVPKANDTA
FT                   TMISYWPLTISEELALMIEGYFYKLDKNELPTPRFTKMGGDIKVMVVRNDLEYSIRINF
FT                   PLISKFFNNDIESQLYVDKHVEKIKKYIEQKYKNISFSIDYHYYLTTTGSCIDFGEEGA
FT                   VGRGNKTHGIISSFRPNTMEAPAGKNCTYFVGKVWGFLSDTIAKEIYEAFNTPCQIIMQ
FT                   LNIGSKLYRPTHLFIQTEESVDQERVLEIVNRHLNNGKQNTNLILSTQHFIPKTNVYDG
FT                   "
FT   gene            426967..427935
FT                   /locus_tag="SpyM3_0383"
FT   CDS             426967..427935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0383"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33534.1| (AE006511)
FT                   hypothetical gene [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8A8"
FT                   /protein_id="AAM78990.1"
FT                   /translation="MFMMDKTVLYFGLVEISFDVPDFIFQKIKEQNNKIRYYSKSINIL
FT                   GSVKFINSNQQFIEYDGNGNILVYGRLKYFKEGISLYYIGEYLAECLLIEHSDTLLIHA
FT                   AAVYNPLSGHSILLLGDKGAGKTTVAIRLCIEHGYHLIGNDQVIFGSNSGILLTYAGTS
FT                   FFKIRRTAVLSDNLLFKLFSKFFNRSLQFNKASWDDKISIFPKELGIRTCNFSTEISKI
FT                   YYIKTDKKEKQIYHSIWSDSLASLYLNELLGRHISGQVACFQSDNGKYFSTMPLINYEK
FT                   NNRVREQIVKGIFAKQKLFKITAATPAKIAEAIIENVKKNS"
FT   gene            427990..428979
FT                   /locus_tag="SpyM3_0384"
FT   CDS             427990..428979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: emb|CAB50638.1| (AJ248288)
FT                   DOLICHYL-PHOSPHATE MANNOOSYLTRANSFERASE RELATED PROTEIN
FT                   [Pyrococcus abyssi]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78991"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVX6"
FT                   /protein_id="AAM78991.1"
FT                   /translation="MFVIGIPTLNEADNISRLVKQIDEYAVNLGKEIIIINSDSKSTDG
FT                   TPQIFLETKTYNTKVSIVSEAKGKGYNVRNIFEYAINHVPNFSGLILIDGDVVSMKKMW
FT                   LEKMFIAIESGNDLIIPNYARKSFEGNATNHFIYPMLVKFFKRDMPYQCISGDFGFSRG
FT                   LIKDLTLKCNWHKYTLGYGIDIFLTLTAILKSYKIKEIDLQSKIHKKSFEKIEKIFLEV
FT                   SQSFFETINDNSLNQDKLRLNINFESHSRQFIKSSDILSSNDIENLKLRALFLLQEEKQ
FT                   YPHGLSEVEWDGILSNTINNIYRYSSEEHSLYLLPLYLLRVYNYLKYN"
FT   gene            429671..430828
FT                   /locus_tag="SpyM3_0385"
FT   CDS             429671..430828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0385"
FT                   /product="putative nucleotide sugar dehydrogenase"
FT                   /note="best non-GAS blastp hit: dbj|BAB07427.1| (AP001519)
FT                   nucleotide sugar dehydrogenase [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78992"
FT                   /db_xref="GOA:Q8K8A7"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8A7"
FT                   /protein_id="AAM78992.1"
FT                   /translation="MKITVVGIGYVGLSIGLLLAKEHDVTFFDIDNKKIDLINKRQSPL
FT                   KEAAINKLLCKAKNINATYSEELAYKDATFIILSLPTNLKVNKLDTSIIEISVSNILKI
FT                   NKKATIVIKSTVPIGFTEYLRNRFHYNDIIFSPEFLREGSTIYDQLYPSRTIVGNESRN
FT                   SQLFLDILTDISVEKDSSSLLVGSSEAEAIKLFSNAYLAQKIAFFNELDTFAEMQNLDS
FT                   KKIIEAMGYDQRIGNSHNNPSFGFGGYCLPKDIKQLEYHFKEIPAPIITSISESNLLRK
FT                   IHIAKMILNSSAKTIGIYRINSKKDSDNCRESSTIDVAKLLKSSGKDVIIFEPLINQKK
FT                   FLGCPLINDFNEFIKYSDIIVANRIDDALRKCNSKVFTRDIFQYD"
FT   gene            430946..432121
FT                   /locus_tag="SpyM3_0386"
FT   CDS             430946..432121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0386"
FT                   /product="putative efflux protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99775.1| (AE008470)
FT                   ABC transporter membrane-spanning permease - macrolide
FT                   efflux [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78993"
FT                   /db_xref="GOA:Q8K8A6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8A6"
FT                   /protein_id="AAM78993.1"
FT                   /translation="MYSKVIYRIGDVMFDFANNTFLAGLNPASLSLVAVYQSLESVIGV
FT                   LFNLFGGVIADSFKRKKIIITTNILCGTACLVLSFLTKEQWLVYAIVLTNVILAFMSAF
FT                   SSPSYKAFTKEIVKKDGISQLNSLLETTSTVIKVTVPMVAIFLYKLLGIHGVLLLDGLS
FT                   FLIAALLISFILPVNDEVVIKEKVTIREIFNDLKIGFKYVYSHKSIFIITVLSALVNFF
FT                   LAAYNLLLPYSNQMFGEISTGLYGTFLTAEAIGGFIGAILSGFVNKELSSMRLILFLSL
FT                   SGLMLMLAPPFYIMFHNAIILALSPALFSLFLSIFNIQFFSLVQKDVDNDFLGRVFGII
FT                   FTITILFMPIGTGFFSVALNPNNSFNLFIIGSCITILSLVFRILFKKYNIR"
FT   gene            complement(432224..432433)
FT                   /locus_tag="SpyM3_0387"
FT   CDS             complement(432224..432433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99737.1| (AE008466)
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78994"
FT                   /db_xref="GOA:Q8K8A5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8A5"
FT                   /protein_id="AAM78994.1"
FT                   /translation="MRFSYNKLWKLLIDKGWTKTKLRQEAGISSSTIAKLGKGENITTD
FT                   ILLEICIALDCKIEGIVEIVDNNI"
FT   gene            complement(432423..432713)
FT                   /locus_tag="SpyM3_0388"
FT   CDS             complement(432423..432713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0388"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33539.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78995"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8A4"
FT                   /protein_id="AAM78995.1"
FT                   /translation="MIVFDLVMLYLTNLPALAHDSLLLSNVSYQATEALLKLYDQSRSL
FT                   NKQVFLAFDKASSYSPDANQLLSENTVLRLSSNGNEPYGISWNKGENSDEI"
FT   gene            complement(432710..434080)
FT                   /locus_tag="SpyM3_0389"
FT   CDS             complement(432710..434080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0389"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33540.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78996"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8A3"
FT                   /protein_id="AAM78996.1"
FT                   /translation="MLIEMWSPVFKKHGEIREPICFHHGLNVIMGLDLADNSIGKSSSL
FT                   LAIDFIFGGNSYLKSIAVKKLGDHPIYFCFQFEKKFYFSRDTANPDIILVCDKSYSPTG
FT                   ETMDLGIFLNKLKKRYHLDSPELSFRLAMSGFFRIAGKSNQNTDFPLQVYSSQKSSESI
FT                   TTLIQLFNLYDNIARYKERLKDKSDQLTTFRNARKYAFISNLVGGKKQFEANVSEIKRL
FT                   EYDLAHLQDTHQDKIDSDDIEKNQQKLQLRNTKLELESSLRDKQRRLKLLDISIEFGLY
FT                   PTESDLTELQQYFPDTNLKKLYEVEAYHKKLETILDSEFSTERESLIAEIDDLESQLTT
FT                   LNQELQELGNIPNLSSEYLENYSKLTATINALKEQNEAYLKESGLSKEKSEADADLKRS
FT                   TEDILLDLEVKINSKMREVNNILYPDIRKAPQLTSMLTIATPSIHQMMMVQELSLKG"
FT   gene            complement(434071..434301)
FT                   /locus_tag="SpyM3_0390"
FT   CDS             complement(434071..434301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0390"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33541.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78997"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8A2"
FT                   /protein_id="AAM78997.1"
FT                   /translation="MQLPNKLYSYQKSTLAYLPRVLNEIKSGNSNVKDIFHAISEELDD
FT                   PTDFLSIMDCLYALNAIEMSNEGEGEVKLCL"
FT   gene            complement(434301..435194)
FT                   /locus_tag="SpyM3_0392"
FT   CDS             complement(434301..435194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0392"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33542.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78998"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8A1"
FT                   /protein_id="AAM78998.1"
FT                   /translation="MTTMLDFPFHHEFIESLGRWTHILITLPKRHHGQVDTAIPRYLLV
FT                   TIREKTGIVKLTTVQNTAFTTQSNQLKKQYGQFLLTESNNCCACPGCDRPLILTSGNLA
FT                   AENYEVSAIEKDKDAEPLNLIALCPDCFLTYQADSRKKIVTALKNVKKILVSAHNSQQA
FT                   ISDMKLDSGIVSVLTSLNKLKCDEYDISYDSKQLTDKISPENNRTLYQLVKNQVIDNYL
FT                   TIQKIIVNLDKQGKIDYEEIQYQTRSMYKKLKAAKHNNLAIFNTISEKLHKATLQDIYF
FT                   CQTIVSYFIQKCEVLE"
FT   gene            435210..435386
FT                   /locus_tag="SpyM3_0391"
FT   CDS             435210..435386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0391"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: no hit found"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAM78999"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K8A0"
FT                   /protein_id="AAM78999.1"
FT                   /translation="MGQNVVMRQAPAGNIKPDKEKSVEKIDGIVGLILGLDRCIRRQGD
FT                   EASVYDERGILSF"
FT   gene            435442..435744
FT                   /locus_tag="SpyM3_0393"
FT   CDS             435442..435744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0393"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33543.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79000"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K899"
FT                   /protein_id="AAM79000.1"
FT                   /translation="MAKTGTLNLRVDDSVKSAADDILKRLGIPMSTAIDMFLNQIILTG
FT                   GIPFDVSLPEAPQRVNVDYMSQEKFYDKLISSFEDAKTGNRQDVREFLSQLKENA"
FT   gene            435744..436049
FT                   /locus_tag="SpyM3_0394"
FT   CDS             435744..436049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0394"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33544.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79001"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K898"
FT                   /protein_id="AAM79001.1"
FT                   /translation="MKEYQVTMSDDAKADLLSIYYYVCDELCAPQAADNLLERLSQAML
FT                   SLSIFPERCAIIEDLIGKGYTFRQLIVKKYRIVYHVLEDEVIIVAVVYGSRHMNNW"
FT   gene            436504..436860
FT                   /locus_tag="SpyM3_0395"
FT   CDS             436504..436860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0395"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: no hit found"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79002"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K897"
FT                   /protein_id="AAM79002.1"
FT                   /translation="MDEFKGIKVEFIQLSNKNIFDVLEKDLSKKLRFEDISIEAILGKY
FT                   LCNNDIEIIKCLYEKDKINMELLISLISKISNKLVKQEFIKVLVLYEYVKTFYQQIAFT
FT                   FHYLIYMEQDIIQV"
FT   gene            436974..437273
FT                   /locus_tag="SpyM3_0396"
FT   CDS             436974..437273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0396"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: no hit found"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79003"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K896"
FT                   /protein_id="AAM79003.1"
FT                   /translation="MGIGTTVLSQEIEYEIEDRIMILVEKIDVKIYKNCLELANKISGY
FT                   HCSVFEFPYKKIKKFFKHELYSRHHYIIVRLDGSMEYRFSSVALKNKIKSILDS"
FT   gene            complement(437648..438451)
FT                   /locus_tag="SpyM3_0397"
FT   CDS             complement(437648..438451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0397"
FT                   /product="probable transposase TnpA"
FT                   /note="best blastp hit: gb|AAB92607.1| (AF026542) TnpA
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79004"
FT                   /db_xref="GOA:Q8K895"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K895"
FT                   /protein_id="AAM79004.1"
FT                   /translation="MCRVLRVNRSTYYKFLKHKPSKRELDNQIYKKQILEIYTKANKRL
FT                   GVKSIKVILQRDYDTKISEGRIYRLMKNMALPKMATVKPKTALKRTQKTYPQNLLNQKF
FT                   NPDKPNQVWSTDFTYISIGYKKYVYLCAILDLYSRKCIAWKLSHHMDAKLACDTLELAL
FT                   NKRKIEGTLLFHSDQGSQFKARELRKIIDDNTIMHSFSKPGYPYDNAVTEAFFKYLKHR
FT                   QINRKKYQNIKQVQLDCFEYIENFYNNYNPHTANLGLTPNQKEEN"
FT   gene            complement(438499..438819)
FT                   /locus_tag="SpyM3_0398"
FT   CDS             complement(438499..438819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0398"
FT                   /product="probable transposase TnpA (fragment)"
FT                   /note="best blastp hit: gb|AAK33551.1| (AE006513)
FT                   transposase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79005"
FT                   /db_xref="GOA:Q8K894"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K894"
FT                   /protein_id="AAM79005.1"
FT                   /translation="MLQSVLKDTKTKGQPMSTVKRYDEEFKQSLVNLYQTGKTQSELCK
FT                   DYGVSASALAKWIKQYSQVKLEDNSVLTAKQIQELQKRNAQLEEENLILKKASAIFMQN
FT                   LK"
FT   gene            439079..439876
FT                   /locus_tag="SpyM3_0399"
FT   CDS             439079..439876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAL26978.1|AF380672_2
FT                   (AF380672) unknown [Streptococcus agalactiae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79006"
FT                   /db_xref="GOA:Q8K893"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K893"
FT                   /protein_id="AAM79006.1"
FT                   /translation="MIKLIATDMDGTFLAEDGTYNQEQLAALLPKLAEKGILFAVSSGR
FT                   SLLAIDQLFEPFLDQIAVIAENGSVVQYHGEILFADMMTKEQYTEVAKKVLANPHYVET
FT                   GMVFSGQKAAYILKGASEEYIQKTKHYYANVKVINGFEDMENDAIFKVSTNFTGHTVLE
FT                   GSDWLNQALPYATAVTTGFDSIDIILKEVNKGFGMEHLCQALGIKKAETIAFGDNFNDY
FT                   QMLEFAGRAIATENARPEIKVISDQVIGHCNDGAVLTYLKGLV"
FT   gene            439880..440704
FT                   /locus_tag="SpyM3_0400"
FT   CDS             439880..440704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAL26979.1|AF380672_3
FT                   (AF380672) unknown [Streptococcus agalactiae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79007"
FT                   /db_xref="GOA:Q8K892"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K892"
FT                   /protein_id="AAM79007.1"
FT                   /translation="MNIRILALDLDGTLYNTEKIVTDANKKALAAAREKGVKVVITTGR
FT                   PLKAIGNLLEELDLLDHDDYSITFNGGLVQRNTGEVLDKSSLSFDQVCQIQQALEAVGL
FT                   PTDIISGGDVYSIPSKDGRHSQYHLANPLLTFIEVTSVAELPKDITYNKIVTVTDPDFL
FT                   DQQIIKLSPSLFEDFEAFKSRDIIFEIMPKGIDKAFGLNLLCQHLGLDARHVMAMGDEA
FT                   NDFAMLEWAGLGVAMANGVSGAKAVADAVTTLTNDESGVAEAVKTFILEEES"
FT   gene            440704..442254
FT                   /gene="ftsY"
FT                   /locus_tag="SpyM3_0401"
FT   CDS             440704..442254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="SpyM3_0401"
FT                   /product="putative signal recognition particle-docking
FT                   protein FtsY"
FT                   /note="best non-GAS blastp hit: gb|AAL26980.1|AF380672_4
FT                   (AF380672) putative signal recognition particle
FT                   [Streptococcus agalactiae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79008"
FT                   /db_xref="GOA:Q8K891"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K891"
FT                   /protein_id="AAM79008.1"
FT                   /translation="MGLFDRLFGKKETPKVAEEKLEENLLTETTQKEELSEKANEQNKI
FT                   EVVQQEDVSSEGAGSVENGPEAASVNAQVEEETGDNSNHPSEDTNEFAADKTDLKVSEL
FT                   SQSTASEPKDLVDQPVVEQFPTKQAQADASNDSANEEAVDTSKEQSSSQQVMEDYYRRK
FT                   AALEKSLQEKAAATVPVMPEEVPQENQASTSAEASQNKATHDTIPETDQEKYKRSLKKT
FT                   RTGFSARLNSFFANFRRVDEEFFEDLEEMLILSDVGVHVATTLTEELRYEAKLENAKKP
FT                   DALKRVIVEKLVDIYEKDGHYNEAINYQDGLTVMLFVGVNGVGKTTSIGKLAYRYKQEG
FT                   KKVMLVAADTFRAGAVAQLVEWGRRVDVPVITGPEKADPASVVFDGMEKAVAKGVDILL
FT                   IDTAGRLQNKENLMAELEKMGRIIKRVLPDAPHETLLALDASTGQNALSQAKEFSKITP
FT                   LTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKVDDIGEFHSEDFMKGLLEGIL"
FT   gene            complement(442308..443675)
FT                   /locus_tag="SpyM3_0402"
FT   CDS             complement(442308..443675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0402"
FT                   /product="putative drug resistance protein (transporter)"
FT                   /note="best blastp hit: gb|AAK33555.1| (AE006513) putative
FT                   drug resistance protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79009"
FT                   /db_xref="GOA:Q8K890"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K890"
FT                   /protein_id="AAM79009.1"
FT                   /translation="MSHHQQTVSKQTIMAIIAIALIGFSGILSETSMNVTFPTLMSVYQ
FT                   LPLNSLQWMTTIYLLAVAIMMTTSATLKKNVRERPLFFMATGLFTFGTILAVLTQSFAI
FT                   MLLARIFQGIGTGLVMPQMFNIILERVPMHKVGLFMGFAGLIISLAPAFGPTYGGFMIS
FT                   HFSWQWIFICILPVPLIAGILAYYYLEDSPVSEKVPFDWLAFIALSISLTSALLAITSL
FT                   ENGSVNLYYLGLFILSLILFLYKNLTAKQPFLDIRILKIPSLTFGLIPFFVFQLINLGI
FT                   NFLTPNFIVMEKIANSSQAGMVLLPGTLLGALLAPAFGKLYDQKGARLSLYLGNALFSL
FT                   SLIIMTLQTRHFMLLPFTLLYILFTFGRNMGFNNSLATAIRELPAEKNADATAIFQMMQ
FT                   QFAGALGTAMASLIANSQPEFTSGVQSVYLLFTIFALLDFIFFFAMFYHLGKKGLA"
FT   gene            444003..444845
FT                   /gene="bglG"
FT                   /locus_tag="SpyM3_0403"
FT   CDS             444003..444845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglG"
FT                   /locus_tag="SpyM3_0403"
FT                   /product="putative transcription antiterminator"
FT                   /note="best non-GAS blastp hit: gb|AAK99308.1| (AE008429)
FT                   Transcriptional antiterminator (BglG family) [Streptococcus
FT                   pneumoniae R6], and gb|AAK74730.1| (AE007367) transcription
FT                   antiterminator Lict [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79010"
FT                   /db_xref="GOA:F7IUG8"
FT                   /db_xref="InterPro:IPR001550"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="UniProtKB/TrEMBL:F7IUG8"
FT                   /protein_id="AAM79010.1"
FT                   /translation="MLIKRVLNHNAAISTNHQGLDILLMGKGIAFGKKVGDSIELNAIE
FT                   TSFVLKNSDNMNRFTELFITVPQEVVACSERIINLGKIKLGKTLDEILYINLTDHIHSA
FT                   IERHEQGMLIHNPLRWEIQRYYPDEYSLGVKALELIERNLGVTLAIDEAAFIAMHFVNA
FT                   SLDTPFKEPHRLTEIVSYIEQKIKTDFKTELDDTSIDYYRFMTHIKLFAQRVLSEMSYD
FT                   DDDAELLLVVKTKYPKEYRCVLDISEEIKKRYNYHLNSSELLYLTVHVKRLVKHLKET"
FT   gene            444847..446709
FT                   /locus_tag="SpyM3_0404"
FT   CDS             444847..446709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0404"
FT                   /product="putative beta-glucoside permease IIABC component"
FT                   /note="best blastp hit: gb|AAK33557.1| (AE006513)
FT                   beta-glucoside permease IIABC component [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79011"
FT                   /db_xref="GOA:Q8K889"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K889"
FT                   /protein_id="AAM79011.1"
FT                   /translation="MTYQETAKAILAAVGGKTNIQRVTHCVTRLRLVLKNDEKVKDQQV
FT                   KAISNVIGVMRKNGQYQIILGNDVNNYYQAFLSLGHFDNQDEDHSSKAKGSILERLIET
FT                   IAGVITPLIPALLGGGMLKVVGILLPMLGLASADSQTVAFINFFGDAAYYFMPVMIAYS
FT                   AAARFKVTPVLAATIAGILLHPAFVAMVAEGKPLTLFGASVTPASYGSSVIPILMMVYL
FT                   MQYIEKWVNRLVPSVMKSFLQPTLIILISGFLALVVVGPLGVIIGQGLSNTMLAIYHVA
FT                   PWLALAILGAIMPLVVMTGMHWAFAPIFLAASVATPDVLILPAMLASNLAQGAASLAVA
FT                   FKTKQKQTRQVALAAGISALLAGITEPALYGVTLKFKKPLYAAMISGGLVGAFIGFVNI
FT                   ASYTFVVPSIIGLPQYINPSGGANFINALIAGAATIVLAFSLTWFMGIDEESPKQVSVA
FT                   ADMSQVKSGLSTKQTLYAPMTGEMLFLSEVPDETFSSKLLGEGFAILPSEGVVYAPFDG
FT                   EVITFFPTKHAVALKNTRGVEVLIHVGIDTVELKGQGFEQLVSVGDVVKRGQALLKMDI
FT                   DFITSKGYSLISPVVVTNSAEQLEIIIQDDKKMVTKEDALLVIL"
FT   gene            446728..448152
FT                   /gene="bglA.1"
FT                   /locus_tag="SpyM3_0405"
FT   CDS             446728..448152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA.1"
FT                   /locus_tag="SpyM3_0405"
FT                   /product="putative 6-phospho-beta-glucosidase"
FT                   /note="best non-GAS blastp hit: gb|AAK74732.1| (AE007367)
FT                   6-phospho-beta-glucosidase [Streptococcus pneumoniaeTIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79012"
FT                   /db_xref="GOA:Q8K888"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K888"
FT                   /protein_id="AAM79012.1"
FT                   /translation="MGIFPKDFLWGGAVAANQVEGAFEADTKGLSVQDVLPNGGLGEWT
FT                   DSPTSDNLTLEAIDFYHRYKEDIALFAEMGFKVFRTSIAWSRIFPNGDDDQPNEAGLQF
FT                   YDDLFDELLNYGIEPLVTLSHYETPLHLAKAYNGWTDRRLIGFFERFAQTVMERYKDKV
FT                   KYWLTFNEVNSILHMPFTSGGIMTEKEKLSLQDLYQAIHHELVASASVTKLAHEINPDV
FT                   KVGCMILAMPAYPMTSDPRDILAAHAFENLNLLFSDIHVRGKYPSYIKSYFKENGIEIV
FT                   FEDGDKELLAEHTVDFLSFSYYMSVTQAHNPEAYTSGQGNILGGLSNPYLESSEWGWQI
FT                   DPIGLRLVLNQYYDRYQIPLFIVENGLGAKDQLVQTADGSMTVHDDYRIDYMSQHLVQV
FT                   AKAIEDGVEVMGYTAWGCIDCVSMSTAQLSKRYGFIYVDRNDDGTGQLTRYKKKSFDWY
FT                   RQVIQTNGRYLEDNFS"
FT   gene            complement(448251..449066)
FT                   /locus_tag="SpyM3_0406"
FT   CDS             complement(448251..449066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75029.1| (AE007396)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79013"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K887"
FT                   /protein_id="AAM79013.1"
FT                   /translation="MIRFLILSGYFELTMYLQLSGKLDQYINVRYSYLAYISMVLSFIL
FT                   ALVQLYTWMKNIKVHSHLTGKIARLTSPFILVFPVLIGLLVPTVTLDSTTVSAKGYTFP
FT                   LAAGASKTGVSDDGTTIQYLKPDTSLYFTKSAYQKEMRQELHKYKGKKPVTITTENYME
FT                   VMELIYLYPDEFVDRDIQYTGFVYNEPGHDNYQFLFRFGIIHCIADSGVYGLLTTGNQT
FT                   SYPNNTWLTVKGRLHMEYDKNLEQHLPVLQLAEVHQTKEPNNPYVYRVF"
FT   gene            complement(449066..449968)
FT                   /locus_tag="SpyM3_0407"
FT   CDS             complement(449066..449968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAL26983.1|AF380672_7
FT                   (AF380672) unknown [Streptococcus agalactiae]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79014"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFC7"
FT                   /protein_id="AAM79014.1"
FT                   /translation="MSLFSNLPPSVLQWFAIFMSIIIEALPFVLLGTILSGCIEVFVTP
FT                   ELVQKYLPKQKCLRILFGTFVGFVFPSCECGIIPIINRFLEKKVPSYTAVPFLATAPII
FT                   NPIVLFATYSAFGNSLRFLILRLVGAALVAITLGVMLAFIVDDNILKDNAQPVHFHDYS
FT                   HESLPKRIYLALVHAIDEFFDTGRYLVFGTLIASAMQIYVPTRVLTTIGHNPLTAILIM
FT                   MLMAFILSLCSEADAFIGASLLSTFGVAPVLAFLLIGPMVDIKNLMMMVKAFKGRFIVQ
FT                   FIGVSVLMIAVYCLLVGVL"
FT   gene            450102..450299
FT                   /locus_tag="SpyM3_0408"
FT   CDS             450102..450299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0408"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33561.1| (AE006514)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79015"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFC6"
FT                   /protein_id="AAM79015.1"
FT                   /translation="MRQTSYGLLGFVCSVVFSLVASLPSVLTSKGLSKLGIDAKPASIF
FT                   SSSSFFLWVIAISMTFFHSR"
FT   gene            450505..452637
FT                   /locus_tag="SpyM3_0409"
FT   CDS             450505..452637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0409"
FT                   /product="putative transcriptional regulator"
FT                   /note="best non-GAS blastp hit: gb|AAK99612.1| (AE008457)
FT                   Toxin expression - transcriptional accessory protein
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79016"
FT                   /db_xref="GOA:Q7CFC5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023097"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFC5"
FT                   /protein_id="AAM79016.1"
FT                   /translation="MENNNNHNIAEALSVSLHQIEQVLALTAQGNTIPFIARYRKEVTG
FT                   NLDEVVIKSIIDMDKSLTTLNERKATILAKIEEQGKLTDQLRTSIEATEKLADLEELYL
FT                   PYKEKRRTKATIAREAGLFPLARLILQNAQNLETAAEPFVTEGFASPQEALAGAVDILV
FT                   EAMSEDAKLRSWTYNEIWQYSRLVSTLKDEQLDEKKVFQIYYDFSDQVSNMQGYRTLAL
FT                   NRGEKLGILKVSFEHNLEKMQRFFSVRFKETNPYIEEVINQTIKKKIVPAMERRVRSEL
FT                   SDAAEDGAIHLFSENLRHLLLVSPLKGKMVLGFDPAFRTGAKLAIVDQTGKLLTTQVIY
FT                   PVAPASQTKIQAAKETLTQLIETYQIDIIAIGNGTASRESEAFVADVLKDFPNTSYVIV
FT                   NESGASVYSASELARHEFPDLTVEKRSAISIARRLQDPLAELVKIDPKSIGVGQYQHDV
FT                   SQKKLSENLGFVVDTVVNQVGVNVNTASPSLLAHVSGLNKTISENIVKYREENGALTSR
FT                   ADIKKVPRLGAKAFEQAAGFLRIPGAKNILDNTGVHPESYPAVKELFKVLGIQDLDDAA
FT                   KATLAAVQVPQMAETLAIGQETLKDIIADLLKPGRDLRDDFEAPILRQDILDLKDLEIG
FT                   QKLEGTVRNVVDFGAFVDIGVHEDGLIHISEMSKTFVNHPSQVVSVGDLVTVWVSKIDL
FT                   DRHKVNLSLLPPRDTH"
FT   gene            452579..453061
FT                   /locus_tag="SpyM3_0410"
FT   CDS             452579..453061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75034.1| (AE007396)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79017"
FT                   /db_xref="GOA:P0DF74"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF74"
FT                   /protein_id="AAM79017.1"
FT                   /translation="MTWTATRSISAYCHRVTLTNYVQEVSLADFGKPFHHKAYWNKRLK
FT                   TTGGRFFPKDGHLDFNPRMLEEHGELIFRKIVRHELCHYHLYFEGRGYHHKDRDFKDLL
FT                   AQVNGLRYVPTSSKSKTNHHYSCQTCGQVYQRKRRINLAKYVCGNCHGKLMEKNQS"
FT   gene            453125..453397
FT                   /locus_tag="SpyM3_0411"
FT   CDS             453125..453397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99614.1| (AE008457)
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79018"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFC4"
FT                   /protein_id="AAM79018.1"
FT                   /translation="METKFYKQRKNRLVAGVIAGLADKYGWDLALARVLAALLIYGTGF
FT                   GVLLYILLAIFLPYKEDLLEERYGRGPRRRKDADVLNEEEDGWFW"
FT   gene            453762..454694
FT                   /gene="ptsK"
FT                   /locus_tag="SpyM3_0412"
FT   CDS             453762..454694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsK"
FT                   /locus_tag="SpyM3_0412"
FT                   /product="putative HPr (serine) kinase/phosphatase"
FT                   /note="best blastp hit: sp|Q9A0W5|HPRK_STRPY HPr(Ser)
FT                   kinase/phosphatase, and gb|AAK33566.1| (AE006514) Hpr
FT                   kinase/phosphatase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79019"
FT                   /db_xref="GOA:P0DD52"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD52"
FT                   /protein_id="AAM79019.1"
FT                   /translation="MPVTVKMLVQKVKLDVVYATDNLLSKEITTSDISRPGLEMTGYFD
FT                   YYAPERLQLFGMKEWSYLTQMTSHNRYSVLKEMFKKDTPAVVVSRNLAIPKEMVQAAKE
FT                   EGISLLSSRVSTSRLAGEMSYFLDASLAERTSVHGVLMDIYGMGVLIQGDSGIGKSETG
FT                   LELVKRGHRLVADDRVDVYAKDEETLWGEPAEILRHLLEIRGVGIIDVMSLYGASAVKD
FT                   SSQVQLAIYLENFEAGKVFDRLGNGNEEITFSGVRIPRIRIPVKTGRNVSVVIEAAAMN
FT                   HRAKEMGFDATKTFEDRLTQLITKNEVSQ"
FT   gene            454691..455470
FT                   /gene="lgt"
FT                   /locus_tag="SpyM3_0413"
FT   CDS             454691..455470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="SpyM3_0413"
FT                   /product="putative prolipoprotein diacylglycerol
FT                   transferase"
FT                   /note="best blastp hit: gb|AAK33567.1| (AE006514) putative
FT                   prolipoprotein diacylglycerol transferase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79020"
FT                   /db_xref="GOA:P0DC24"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC24"
FT                   /protein_id="AAM79020.1"
FT                   /translation="MINPIALKCGPLAIHWYALCILSGLVLAVYLASKEAPKKGISSDA
FT                   IFDFILIAFPLAIVGARIYYVIFEWSYYVKHLDEIIAIWNGGIAIYGGLITGALVLLAY
FT                   CYNKVLNPIHFLDIAAPSVMAAQAIGRWGNFINQEAYGKAVSQLNYLPSFIQKQMFIEG
FT                   SYRIPTFLYESFWNLLGFVIIMMWRRKPKSLLDGEIFAFYLIWYGSGRLVIEGMRTDSL
FT                   MFLGIRISQYVSALLIIIGLIFVIKRRRQKGISYYQE"
FT   gene            455492..455899
FT                   /locus_tag="SpyM3_0414"
FT   CDS             455492..455899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAD15621.1| (U75480)
FT                   unknown [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79021"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K883"
FT                   /protein_id="AAM79021.1"
FT                   /translation="MDLVGISLMIIALAFVALVIFLIIVLKKVSETIDEAKKTISVLTS
FT                   DVNVTLHQTNDILAKANNLVEDVNGKVATIDPLFVAIADLSESLSDLNSQARHFGQKAT
FT                   NATGNVSKAGKLALVGKVASKVFGKKGEKHE"
FT   gene            455892..456320
FT                   /locus_tag="SpyM3_0415"
FT   CDS             455892..456320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAD15622.1| (U75480)
FT                   unknown [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79022"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K882"
FT                   /protein_id="AAM79022.1"
FT                   /translation="MNKSFKNLVIGAASGVAAAYFLSTEKGKALKNRAEKAYQAYKESP
FT                   DDYHQFAKEKGSEYSHLARDTFYDVKDKLASGDLTKEDMLDLLKDKTTAFVQKTKETFA
FT                   EVEAKEKQDDVIIDLNEDDIIIDYTEQDEPVSDTLDKH"
FT   gene            complement(456480..456764)
FT                   /locus_tag="SpyM3_0416"
FT   CDS             complement(456480..456764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: dbj|BAB83974.1| (AB066355)
FT                   hypothetical conserved protein [Streptococcus suis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79023"
FT                   /db_xref="InterPro:IPR021688"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVT5"
FT                   /protein_id="AAM79023.1"
FT                   /translation="MPAPLKKHNSVEQDDSYQESQSKFRDFQEFNGQSAKLKELVFFAR
FT                   IASFSLITVLFAFVLLVMNLAPMFAFLFASIISLGITSLLAKVIKSLLM"
FT   gene            456963..457889
FT                   /locus_tag="SpyM3_0417"
FT   CDS             456963..457889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0417"
FT                   /product="putative protease"
FT                   /note="best non-GAS blastp hit: dbj|BAB83975.1| (AB066355)
FT                   putative protease [Streptococcus suis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79024"
FT                   /db_xref="GOA:Q7CFC2"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFC2"
FT                   /protein_id="AAM79024.1"
FT                   /translation="MEKIIITATAESIEQVKALLAAGVDRIYVGEANYGLRLPHNFSYD
FT                   ELRQIAKLVHDAGKELTVACNALMHQDMMDQIKPFLDLMIEIAVDYLVVGDAGVFYVNK
FT                   RDGYNFKLIYDTSVFVTSSRQVNFWGQHGAVESVLAREIPSAELFTLAENLEFPAEVLV
FT                   YGASVIHHSKRPLLENYYHFTKIDDEVSRERGLFLAEPGDASSHYSIYEDNHGTHIFIN
FT                   NDIDMMSKLGELYAHGLTHWKLDGIYCPGDDFVAITKLFIQAKTLLEAGQFTQEEAEKL
FT                   DQAVHAHHPAGRGLDTGFYEFDPKTVK"
FT   gene            457991..459277
FT                   /locus_tag="SpyM3_0418"
FT   CDS             457991..459277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0418"
FT                   /product="putative protease"
FT                   /note="best non-GAS blastp hit: gb|AAK75526.1| (AE007439)
FT                   peptidase, U32 family [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79025"
FT                   /db_xref="GOA:Q8K881"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K881"
FT                   /protein_id="AAM79025.1"
FT                   /translation="MSHMKKRPEVLSPAGTLEKLKVAIDYGADAVFVGGQAYGLRSRAG
FT                   NFSMEELQEGIDYAHARGAKVYVAANMVTHEGNEIGAGEWFRQLRDMGLDAVIVSDPAL
FT                   IVICSTEAPGLEIHLSTQASSTNYETFEFWKAMGLTRVVLAREVNMAELAEIRKRTDVE
FT                   IEAFVHGAMCISYSGRCVLSNHMSHRDANRGGCSQSCRWKYDLYDMPFGGERHSLKGEI
FT                   PEDYSMSSVDMCMIDHIPDLIENGVDSLKIEGRMKSIHYVSTVTNCYKAAVDAYMESPE
FT                   AFYAIKEELIDELWKVAQRELATGFYYGIPTENEQLFGARRKIPQYKFVGEVVAFDSAS
FT                   MTATIRQRNVIMEGDRIECYGPGFRHFETVVKDLHDADGQKIDRAPNPMELLTISLPRE
FT                   VKPGDMIRACKEGLVNLYQKDGTSKTVRT"
FT   gene            459487..459699
FT                   /locus_tag="SpyM3_0419"
FT   CDS             459487..459699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74919.1| (AE007385)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4], and gb|AAK99494.1| (AE008446) Conserved
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79026"
FT                   /db_xref="GOA:Q7CFC1"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFC1"
FT                   /protein_id="AAM79026.1"
FT                   /translation="MAEFTFNIEEHLLTLSENDKGWTKELNRVSFNGAEAKWDIRTWSP
FT                   DHTKMGKGITLTNEEFKTILDAFRK"
FT   gene            complement(460078..461571)
FT                   /gene="lysS"
FT                   /locus_tag="SpyM3_0420"
FT   CDS             complement(460078..461571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SpyM3_0420"
FT                   /product="putative lysyl-tRNA synthetase"
FT                   /note="best blastp hit: gb|AAK33574.1| (AE006515) putative
FT                   lysyl-tRNA synthetase [Streptococcus pyogenesM1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79027"
FT                   /db_xref="GOA:P0DG46"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG46"
FT                   /protein_id="AAM79027.1"
FT                   /translation="MSNQHIEELNDQQIVRREKMMALAEQGIDPFGKRFGRTANSAELK
FT                   ENYADKTKEELHELNETAIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDSVGEDNY
FT                   EIFKKADLGDFIGVEGEVMRTDMGELSIKATKLTHLSKSLRPLPEKFHGLTDIETIYRK
FT                   RHLDLISNRESFDRFVTRSKMISEIRRYLDGLDFLEVETPVLHNEAGGAAARPFVTHHN
FT                   AQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADY
FT                   LDIMNLTEGIIQHAAKAVKGDGPIDYQGTEIRINEPFKRVHMVDAIKEVTGVDFWPEMT
FT                   VEEAIALAKEKQVPLEKHFTSVGHIINAFFEEFVEETLVQPTFVFGHPVEVSPLAKKNP
FT                   EDTRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAQAKELGDDEATGIDYDFVEA
FT                   LEYGMPPTGGLGIGIDRLCMLLTNTTTIRDVLLFPTMKP"
FT   gene            461745..462647
FT                   /locus_tag="SpyM3_0421"
FT   CDS             461745..462647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: emb|CAC98713.1| (AL591976)
FT                   lmo0635 [Listeria monocytogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79028"
FT                   /db_xref="GOA:Q8K879"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K879"
FT                   /protein_id="AAM79028.1"
FT                   /translation="MITAIVFDVDDTIYDQQAPYRIAMEKCFPDFDMSVMNQAYIRFRH
FT                   YSDVGFPRVMAGEWTTEYFRFWRCKETLLEFGYREIDEAAGVHFQEVYEHELENITMLD
FT                   EMRMTLDFLKSKNVPMGIITNGPTEHQLKKVRKLGLYDYIDPKRVIVSQATGFQKPEKE
FT                   IFNLAAEQFDMNPQTTLYVGDSYDNDIMGAFNGGWHSMWFNHRGRQLKPGTKPIYDVAI
FT                   DNFEQLFGAVKVLFDLPDNKFIFDINDKKNPILQMGINNGLMMAAERLLESNMSIDKVV
FT                   ILLRLTKQQEKVLRLKYAR"
FT   gene            complement(462755..463378)
FT                   /locus_tag="SpyM3_0422"
FT   CDS             complement(462755..463378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0422"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33576.1| (AE006515) putative
FT                   phosphoglycerate mutase [Streptococcus pyogenes M1 GAS],
FT                   possible pseudogene aligns with N-terminal portion (amino
FT                   acids 1-207) of PgmA"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79029"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:F7IWG2"
FT                   /protein_id="AAM79029.1"
FT                   /translation="MKLYFVRHGKTLWNLEGRFQGAGGDSPLLEEAKDEIHLLGKELAK
FT                   VAFDAVYTSDLQRAMATAAIILDAFDQQPKLYHTDQLREWRLGKLEGAKIATMAAIYPQ
FT                   QMLAFRENLAQFKPDQFEAESIYQTTQRVCHLIQSFKDKHYQNVLIVGHGANLTATIRS
FT                   LLGFEPALLLAKGGLDNTSLTILETKDYLTYDCLIWNDKSFIEV"
FT   gene            complement(463719..464198)
FT                   /locus_tag="SpyM3_0423"
FT   CDS             complement(463719..464198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0423"
FT                   /product="putative transcriptional regulator"
FT                   /note="best non-GAS blastp hit: gb|AAK75104.1| (AE007402)
FT                   regulatory protein, putative [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79030"
FT                   /db_xref="GOA:Q7CFB9"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFB9"
FT                   /protein_id="AAM79030.1"
FT                   /translation="MAKKTKLKKTLVEQILDKANIAHQGLKLNALEGDFPDDLQPSDIY
FT                   KTLALTGDQTGPLIGIIPLTEHLSEKQLAKVSGNKKVSMVPQKDLQKTTGYIHGANNPV
FT                   GIRQKHSYPIFIDQTALEKGQIIVSAGEVGRSIKISSQALADFVGASFADLKKRK"
FT   gene            complement(464288..464851)
FT                   /locus_tag="SpyM3_0424"
FT   CDS             complement(464288..464851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: emb|CAC99507.1| (AL591979)
FT                   similar to unknown proteins [Listeria monocytogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79031"
FT                   /db_xref="GOA:Q8K878"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K878"
FT                   /protein_id="AAM79031.1"
FT                   /translation="MSPNTNVKYLIEAAIFAALAMALSFIPDFAGWFSPSYGAIALVIF
FT                   SLRRGLKYGMLAGLIWGLLHFVLGKVYYLSMSQVFIEYILAFTSMGLAGSFSDSLIKTL
FT                   RRQQTFFAVFLAIMASLLAVTVRYLWHFLAGIIFWGSYAPKGMSAVWYSFSVNGTAGVL
FT                   TFLITCLALMIALPIHPQLFDPKD"
FT   gene            complement(465120..465968)
FT                   /locus_tag="SpyM3_0425"
FT   CDS             complement(465120..465968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0425"
FT                   /product="putative endolysin, phage-associated"
FT                   /note="best blastp hit: gb|AAK33579.1| (AE006515) putative
FT                   endolysin, phage-associated [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79032"
FT                   /db_xref="GOA:F7IWB9"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:F7IWB9"
FT                   /protein_id="AAM79032.1"
FT                   /translation="MRRKIKPIVVLVFFILLAMVLIIGKRQANHAKQKEVEDAKSHIPI
FT                   ATSNPSKAKTSTSETEDFILNPIVDVSGWQLPEEIDYDTLSRHISGAIVRVYGGSQITA
FT                   HNNAAFTTGIDKSFKTHIKEFQKRNVPVAVYSYALGRSTKEMKEEARAFYKNAAPYNPT
FT                   YYWIDVEEATMKDMNKGVTAFREELKKLGAENVGLYIGTYFMAEQDISTKGFDAVWIPT
FT                   YGSDSGYYEAAPNTTLDYDLHQYTSQGYLSGFNNALDLNQIAVTKDTKKTFEKLFGNSN
FT                   N"
FT   gene            466293..466796
FT                   /locus_tag="SpyM3_0426"
FT   CDS             466293..466796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK05270.1|AE006349_5
FT                   (AE006349) unknown protein [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79033"
FT                   /db_xref="GOA:Q8K877"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K877"
FT                   /protein_id="AAM79033.1"
FT                   /translation="MSAKFMSRIAIMSALCVVLRMVFISLPNVQPVTAFLLSYLLYFGL
FT                   AEAVLVMMLCLFLSAFLLGFGPWVFWQVTCFVLVLLLWRFVLYPLSQQFPKYQLGCQAF
FT                   LVALCGLLYGVLIDTCFAYLYSMPWWSYVLAGMPFNIAHALSTLVFFPVVMMLFRRLIS
FT                   EQKI"
FT   gene            466780..467163
FT                   /locus_tag="SpyM3_0427"
FT   CDS             466780..467163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK05269.1|AE006349_4
FT                   (AE006349) unknown protein [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79034"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K876"
FT                   /protein_id="AAM79034.1"
FT                   /translation="MNKRFKTGFLALVAMLLVACSQGTKQTQTPSVPKADHHVRLVVKE
FT                   DTNTIDEKVSFGKGDTVLEILKDNYEVKEKDGFITAIDGIEQDTKANKYWLFKVNGKMA
FT                   DKGADQITVKDGDSIEFYQEVFK"
FT   gene            complement(467209..467688)
FT                   /locus_tag="SpyM3_0428"
FT   CDS             complement(467209..467688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0428"
FT                   /product="putative glutathione peroxidase"
FT                   /note="best blastp hit: gb|AAK33582.1| (AE006515) putative
FT                   glutathione peroxidase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79035"
FT                   /db_xref="GOA:Q8K875"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K875"
FT                   /protein_id="AAM79035.1"
FT                   /translation="MPNLYDFTVKAQDGSDISLVNYKEKVVLVVNTATKCGLTPQYQAL
FT                   QALYDTYHDKGFEVLDFPCNQFLNQTPGEAEEINRFCSLTYHTTFPRFAKIKVNGKDAD
FT                   PLFTWLKEEKSGPLGKRIEWNFTKFLIDQNGQVIKRYSSKTDPKLIEEDLKALLG"
FT   gene            complement(467681..469480)
FT                   /gene="pepF"
FT                   /locus_tag="SpyM3_0429"
FT   CDS             complement(467681..469480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="SpyM3_0429"
FT                   /product="putative oligoendopeptidase F"
FT                   /note="best non-GAS blastp hit: gb|AAK75853.1| (AE007471)
FT                   oligoendopeptidase F, putative [Streptococcus pneumoniae
FT                   TIGR4], and gb|AAL00409.1| (AE008527) Similar to
FT                   oligoendopeptidase [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79036"
FT                   /db_xref="GOA:Q8K874"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K874"
FT                   /protein_id="AAM79036.1"
FT                   /translation="MELKKRSEFPGNELWDLTALYKDRQDFLLAIEKALQDIDLFKRNY
FT                   EGRLTSVDDFTQALIEIEHIYIQMSHIGTYAFMPQTTDFSDESFAQIAQAGDDFMTKAS
FT                   VALSFFDTALANADLDVLDTLEKNPYFSAAIRMAKIQKEHLLSPDVEKALANLREVINA
FT                   PYDIYTKMRAGDFDMDDFEVDGKTYKNSFVSYENFYQNHENAEIREKAFRSFSKGLRKH
FT                   QNTAAAAYLAKVKSEKLLADMKGYASVFDYLLAEQEVDRSLFDRQIDLIMTEFGPVAQK
FT                   FLKHVAQVNGLEKMTFADWKLDIDNELNPEVSIDGAYDLVMKSLAPLGQEYTKEIERYQ
FT                   TERWVDFAANANKDSGGYAADPYKVHPYVLMSWTGRMSDVYTLIHEIGHSGQFIFSDNH
FT                   QSYFNTHMSTYYVEAPSTFNELMLSDYLEHQFDDPRQKRFALAHRLTDTYFHNFITHLL
FT                   EAAFQRKVYTLIEEGGTFGADQLNAMMKEVLTDFWGDAVDIDDDAALTWMRQAHYYMGL
FT                   YSYTYSAGLVMSTAGYLNLKHNPNGAKEWLDFLKSGGSRTPLDTAMLIGADIATEKPLR
FT                   DTIQFLSETVDQIISYTEDMSHA"
FT   gene            469640..472438
FT                   /gene="ppc"
FT                   /locus_tag="SpyM3_0430"
FT   CDS             469640..472438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="SpyM3_0430"
FT                   /product="putative phosphoenolpyruvate carboxylase"
FT                   /note="best blastp hit: gb|AAK33584.1| (AE006516) putative
FT                   phosphoenolpyruvate carboxylase [Streptococcus pyogenes M1
FT                   GAS"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79037"
FT                   /db_xref="GOA:P0DC98"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC98"
FT                   /protein_id="AAM79037.1"
FT                   /translation="MIEETSKEGDGHLPLKKLESSNNQTIIAEEVALLKEMLENITRRM
FT                   IGDDAFTVIESIMVLSEKQDYIELEKVVANISNQEMEVISRYFSILPLLINISEDVDLA
FT                   YEINHQNNTDTDYLGKLALTIKDLAGKDNGKDILEQVNVVPVLTAHPTQVQRKTILELT
FT                   THIHKLLRKYRDAKAGVINLEKWRQELYRYIEMIMQTDIIREKKLQVKNEIKNVMQYYD
FT                   GSLIQAVTKLTTEYKNLAQKHGLELDNPKPITMGMWIGGDRDGNPFVTAETLCLSATVQ
FT                   SEVILNYYIDKLAALYRTFSLSSTLVQPNSEVERLASLSQDQSIYRGNEPYRRAFHYIQ
FT                   SRLKQTQIQLTNQPAARMSSSVGLNTSAWSSPASLENPILAYDSPVDFKADLKAIEQSL
FT                   LDNGNSALIEGDLREVMQAVDIFGFFLASIDMRQDSSVQEACVAELLKGANIVDDYSSL
FT                   SETEKCDVLLQQLMEEPRTLSSAAVAKSDLLEKELAIYTTARELKDKLGEEVIKQHIIS
FT                   HTESVSDMFELAIMLKEVGLVDQQRARVQIVPLFETIEDLDNARDIMAAYLSHDIVKSW
FT                   IATNRNYQEIMLGYSDSNKDGGYLASGWTLYKAQNELTAIGEEHGVKITFFHGRGGTVG
FT                   RGGGPSYDAITSQPFGSIKDRIRLTEQGEIIENKYGNKDVAYYHLEMLISASINRMVTQ
FT                   MITDPNEIDSFREIMDSIVADSNTIYRKLVFDNPHFYDYFFEASPIKEVSSLNIGSRPA
FT                   ARKTITEITGLRAIPWVFSWSQNRIMFPGWYGVGSAFKRYIDRAQGNLERLQHMYQTWP
FT                   FFHSLLSNVDMVLSKSNMNIAFQYAQLAESQDVRDVFYEILDEWQLTKNVILAIQDHDD
FT                   LLEDNPSLKHSLKSRLPYFNVLNYIQIELIKRWRNNQLDENDEKLIHTTINGIATGLRN
FT                   SG"
FT   gene            472608..473882
FT                   /gene="ftsW"
FT                   /locus_tag="SpyM3_0431"
FT   CDS             472608..473882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="SpyM3_0431"
FT                   /product="putative cell division protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99777.1| (AE008470)
FT                   Cell division protein FtsW [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79038"
FT                   /db_xref="GOA:Q7CFB7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFB7"
FT                   /protein_id="AAM79038.1"
FT                   /translation="MKIDKRHLLNYSILLPYLILSVIGLIMVYSTTSVSLIQAHANPFK
FT                   SVINQGVFWIISLVAITFIYKLKLNFLTNTRVLTVVMLGEAFLLIIARFFTTAIKGAHG
FT                   WIVIGPVSFQPAEYLKIIMVWYLALTFAKIQKNISLYDYQALTRRKWWPTQWNDLRDWR
FT                   VYSLLMVLLVAAQPDLGNASIIVLTAIIMFSISGIGYRWFSAILVMITGLSTVFLGTIA
FT                   VIGVERVAKIPVFGYVAKRFSAFFNPFHDLTDSGHQLANSYYAMSNGGWFGQGLGNSIE
FT                   KRGYLPEAQTDFVFSVVIEELGLIGAGFILALVFFLILRIMNVGIKAKNPFNAMMALGV
FT                   GGMMLMQVFVNIGGISGLIPSTGVTFPFLSQGGNSLLVLSVAVGFVLNIDASEKRDDIF
FT                   KEAELSYRKDTRKENSKVVNIKQFQ"
FT   gene            474237..475433
FT                   /gene="tufA"
FT                   /locus_tag="SpyM3_0432"
FT   CDS             474237..475433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="SpyM3_0432"
FT                   /product="putative translation elongation factor EF-Tu"
FT                   /note="best blastp hit: sp|P82559|EFTU_STRPY Elongation
FT                   factor Tu (EF-Tu), and gb|AAK33586.1| (AE006516) putative
FT                   translation elongation factor EF-Tu[Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79039"
FT                   /db_xref="GOA:P0DA82"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA82"
FT                   /protein_id="AAM79039.1"
FT                   /translation="MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVN
FT                   QPKDYASIDAAPEERERGITINTAHVEYETATRHYAHIDAPGHADYVKNMITGAAQMDG
FT                   AILVVASTDGPMPQTREHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSE
FT                   YDFPGDDLPVIQGSALKALEGDTKFEDIIMELMDTVDSYIPEPERDTDKPLLLPVEDVF
FT                   SITGRGTVASGRIDRGTVRVNDEIEIVGIKEETKKAVVTGVEMFRKQLDEGLAGDNVGI
FT                   LLRGVQRDEIERGQVIAKPGSINPHTKFKGEVYILSKDEGGRHTPFFNNYRPQFYFRTT
FT                   DVTGSIELPAGTEMVMPGDNVTINVELIHPIAVEQGTTFSIREGGRTVGSGIVSEIEA"
FT   gene            475674..476432
FT                   /gene="tpi"
FT                   /locus_tag="SpyM3_0433"
FT   CDS             475674..476432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpi"
FT                   /locus_tag="SpyM3_0433"
FT                   /product="putative triosephosphate isomerase"
FT                   /note="best blastp hit: sp|P82478|TPIS_STRPY
FT                   Triosephosphate isomerase (TIM), and gb|AAK33587.1|
FT                   (AE006516) putative triosephosphate isomerase
FT                   [Streptococcuspyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79040"
FT                   /db_xref="GOA:P0DG10"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG10"
FT                   /protein_id="AAM79040.1"
FT                   /translation="MSRKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPA
FT                   VDLVTTIEAAKDSVLKVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFH
FT                   ETDEDINKKAKAIFANGLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASL
FT                   VLAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKD
FT                   YMACPDVDGALVGGASLEADSFLALLDFLN"
FT   gene            complement(476531..477766)
FT                   /gene="murN"
FT                   /locus_tag="SpyM3_0434"
FT   CDS             complement(476531..477766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murN"
FT                   /locus_tag="SpyM3_0434"
FT                   /product="putative peptidoglycan branched peptide synthesis
FT                   protein, alanine adding enzyme"
FT                   /note="best blastp hit: gb|AAK33588.1| (AE006516) putative
FT                   peptidoglycan branched peptide synthesis protein, alanine
FT                   adding enzyme [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79041"
FT                   /db_xref="GOA:Q8K871"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K871"
FT                   /protein_id="AAM79041.1"
FT                   /translation="MALIEISQEQFDHYCHSLVRHSFIQTSEMASLMAKRGAKPQFLGL
FT                   EKDGELKVAAMVFSQKVAGGWRMELNAGPNTNHPEELEHFYTQLKDYAKQKDVIELILK
FT                   PYDNYQSFDTDGIPISHPNTDLISLLTALGYKHDGLKTGYPEGEPVWHYVKKLEGIDSS
FT                   RLTHSFSKKGKALIKKANTFGIKLRQLKRDELHHFKEITEATSDRRDYLDKSLSYYQDF
FT                   YDSFGDSCEFMVATLNFEDYLNNLKQRQLQLATSINKVKGDLGKNPHSEKKQNRLKELS
FT                   SQFETFQVRISEALHFLEEYGTKDVFLAGSLFIYTKQEAVYLFSGSYPKFNKFYSPALL
FT                   QEHAMLKAIHKGIKQYNFLGITGKFDGSDGVLRFKQNFNGFILQKPGTFRCYPFPIKYH
FT                   FIRLAKKLLNRY"
FT   gene            complement(477753..478979)
FT                   /gene="murM.1"
FT                   /locus_tag="SpyM3_0435"
FT   CDS             complement(477753..478979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murM.1"
FT                   /locus_tag="SpyM3_0435"
FT                   /product="putative peptidoglycan branched peptide synthesis
FT                   protein, serine/alanine adding enzyme"
FT                   /note="best blastp hit: gb|AAK33589.1| (AE006516) putative
FT                   peptidoglycan branched peptide synthesis protein,
FT                   serine/alanine adding enzyme [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79042"
FT                   /db_xref="GOA:Q8K870"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K870"
FT                   /protein_id="AAM79042.1"
FT                   /translation="MYTYKIGISPEEHDQFVLAQPQAGLLQSSKWGKVKDNWKHERISF
FT                   YENGVQVAAAACLIRKLPLGFTMIYIPRGPIMDYANFELLDFVIKTLKTFGKSKRALFV
FT                   KIDPSLVIKQTLEGKESKENDVTLSIIAFLKKLGVEWSGRTKELEDTIQPRIQANIYAK
FT                   DFDFDSLPKKAKQSIRTATNKGVNVTIGGSELLDDFSALMKKTENRKGIILRGKSYYQK
FT                   LLGIYAGQSYITMASLDLPEQKKLLIQQLDKALAEQARLTDKSKPSKVAENQKTIARLQ
FT                   KDLTILSEQLAAGKTRIPLAATLTLIYGESSENLYAGMDDNYRNYQAPLLTWYETAKEA
FT                   FKRGCRWHNLGGVENQQDGGLYHFKARLNPTIEEFTGEFNIPVGLVSSLAILTYNLRKK
FT                   LRSTTNGTN"
FT   gene            complement(478979..479788)
FT                   /locus_tag="SpyM3_0436"
FT   CDS             complement(478979..479788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75395.1| (AE007428)
FT                   Cof family protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79043"
FT                   /db_xref="GOA:Q8K869"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K869"
FT                   /protein_id="AAM79043.1"
FT                   /translation="MSIKLVAVDIDGTLLTDDRRITDDVFQAVQEAKAQGVHVVIATGR
FT                   PIAGVISLLEQLELNHKGNHVITFNGGLVQDAETGEEIVKELMTYDDYLETEFLSRKLG
FT                   VHMHAITKEGIYTANRNIGKYTVHESTLVNMPIFYRTPEEMTNKEIIKMMMIDEPDLLD
FT                   AAIKQIPQHFFDKYTIVKSTPFYLEFMPKTVSKGNAIKYLAKKLGLDMSQTMAIGDAEN
FT                   DRAMLEVVANPVVMENGVPELKKIAKYITKSNNDSGVAHAIRKWVLN"
FT   gene            complement(479938..480171)
FT                   /locus_tag="SpyM3_0437"
FT   CDS             complement(479938..480171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0437"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33591.1| (AE006517)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFB6"
FT                   /protein_id="AAM79044.1"
FT                   /translation="MEFYALFLSLGSQKFRVTSLPVLTPLLPQQKAAVLAHVTRRNKKS
FT                   VVKSAEQFMLFEHQTGFVSILRLKKEYFLQSF"
FT   gene            complement(480243..481544)
FT                   /locus_tag="SpyM3_0438"
FT   CDS             complement(480243..481544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99972.1| (AE008489)
FT                   Conserved hypothetical protein [Streptococcus
FT                   pneumoniaeR6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79045"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K868"
FT                   /protein_id="AAM79045.1"
FT                   /translation="MNEKVFRDPVHNYIHIDNPLIYDLINTKEFQRLRRIKQVPTTAFT
FT                   FHGAEHSRFSHCLGVYEIARRVTAIFEEKYADIWNKDESLVTMTAALLHDIGHGAYSHT
FT                   FEALFHTDHEAFTQEIITNPETEINAILVRHAPDFPDKVASVINHTYPNKQVVQLISSQ
FT                   IDCDRMDYLLRDSYFSAANYGQFDLMRILRVIRPVEDGIVFEHSGMHAVEDYIVSRFQM
FT                   YMQVYFHPASRAVELILQNLLKRAQHLYPEQQAYFQKTAPGLIPFFEKKANLADYIALD
FT                   DGVMNTYFQVWMASEDHILSDLASRFINRKILKSVTFDQDSQGELERLRQLVESVGFDP
FT                   DYYTGIHINFDLPYDIYRPELENPRTQIEMIQKDGSLAELSQLSPIVKALTGTTYGDRR
FT                   FYFPKEMLELDDLFAPSKETFMSYISNGHFHFSQ"
FT   gene            481626..482012
FT                   /locus_tag="SpyM3_0439"
FT   CDS             481626..482012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75393.1| (AE007428)
FT                   hypothetical protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79046"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFB5"
FT                   /protein_id="AAM79046.1"
FT                   /translation="MKLQLTNHIRFGDETEIIQEIHDCEWREKGGYQYLIYQNTDKEKV
FT                   VIKYNETELTMSRFSNPQSIMKFFAGKKVLIALPTPMGVQQFLTDTSHYHLDCSCQKLD
FT                   LHYHLLQAQTEMLFASYHLELSWD"
FT   gene            482242..484923
FT                   /gene="pacL"
FT                   /locus_tag="SpyM3_0440"
FT   CDS             482242..484923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pacL"
FT                   /locus_tag="SpyM3_0440"
FT                   /product="putative calcium transporter"
FT                   /note="best non-GAS blastp hit: gb|AAK75638.1| (AE007449)
FT                   cation-transporting ATPase, E1-E2 family [Streptococcus
FT                   pneumoniae TIGR4], and gb|AAL00214.1| (AE008510) P-type
FT                   ATPase - calcium transporter [Streptococcuspneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79047"
FT                   /db_xref="GOA:Q8K867"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K867"
FT                   /protein_id="AAM79047.1"
FT                   /translation="MSKEQRHEAFYTQSEETVLAQLETSREGLTSAQAKERLAEYGRNE
FT                   LDEGEKRSLFMKFLDQFKDLMIIILIVAALLSVLTEGMEGLTDAIIILAVVILNAAFGV
FT                   YQEGQAEAAIEALKSMSSPLARIRRDGHVTEIDSKELVPGDIVLLEAGDVVPADLRLLE
FT                   ANSLKIEEAALTGESVPVEKDLSTAVSKDAGIGDRVNMGYQNSNVTYGRGIGVITNTGM
FT                   YTEVGHIAGMLANADETDTPLKQNLDNLSKILTYAILVIAAVTFAVGVFLRGQHPLEGL
FT                   MTSVALAVAAIPEGLPAIVTVVLSLGTQVLAKRNAIIRKLPAVETLGSTEIIASDKTGT
FT                   LTMNQMTVEKVYTNGALQSSSADIAFDNTTLRVMNFANDTKVDPSGKLIGDPTETALVQ
FT                   FGLDHNFDVREAMVAEPRVAELPFDSDRKLMSTIHKQADGKYFIAVKGAPDQLLKRVTQ
FT                   IEENGQIRPITDADKKTILDTNKSLAKQALRVLMMAYKYSDALPTLETEIVEANLVFSG
FT                   LVGMIDPERPEAAQAVKVAKEAGIRPIMITGDHQDTAKAIAKRLGIIEEDGVDHVFTGA
FT                   ELNELSDEEFQKVFKQYSVYARVSPEHKVRIVKAWQNEGKVVAMTGDGVNDAPSLKTAD
FT                   IGIGMGITGTEVSKGASDMVLADDNFATIIVAVEEGRKVFSNIQKTIQYLLSANMAEVF
FT                   TIFLATLFGWDVLQPVHLLWINLVTDTLPAIALGVEPAEPGVMKHKPRGRKSSFFDGGV
FT                   KEAILYQGAFQTILVLGVYGFALMFPEHTSYHDVHADALTMAYVTLGLIQLVHAYNVKS
FT                   VYQSIFTVGLFKNKLFNYSIPVAFVALMATVVVPGFNQFFHVTHLTITQWLVVIIGSLL
FT                   MVVLVELVKAVQRSLGQDEKAI"
FT   gene            complement(485007..486002)
FT                   /gene="regR"
FT                   /locus_tag="SpyM3_0441"
FT   CDS             complement(485007..486002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regR"
FT                   /locus_tag="SpyM3_0441"
FT                   /product="putative transcriptional regulator (LacI family)"
FT                   /note="best non-GAS blastp hit: gb|AAK74506.1| (AE007345)
FT                   sugar binding transcriptional regulator RegR [Streptococcus
FT                   pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79048"
FT                   /db_xref="GOA:F7IVD8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVD8"
FT                   /protein_id="AAM79048.1"
FT                   /translation="MQRKVTIKDIAELAKTSKTTVSFYLNGRFDKMSEETKNRIKSTIE
FT                   ATNYKPSIAARSLNAKSTKLIGVVIGDITNSFSNQIVKGIESKAQEFGYQIIIGNSNYD
FT                   PSREDELIEKMLNLGVDGFIIQPTSNFRKYSRIIDIKKKKVVFFDSQLYEHRTNWVKTN
FT                   NYDAVYDTIQQCIDKGYEHFIMITGNPNLLSTRIERASGFIDVLEANHLTHQEMIIDEN
FT                   QTSSEAIAQFLQGSLTKKSLVFVPNCWALPKVFTAMKSLKFNIPEIGLVGFDNIEWTKF
FT                   SSPTLTTIIQPAYEEGEQATKILIDDIEGHSQEAKQQIFDCQVNWQESTF"
FT   gene            complement(486066..487973)
FT                   /locus_tag="SpyM3_0442"
FT   CDS             complement(486066..487973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99101.1| (AE008410)
FT                   hypothetical protein [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79049"
FT                   /db_xref="GOA:Q8K866"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K866"
FT                   /protein_id="AAM79049.1"
FT                   /translation="MSLAFARFKETVNPDFCKNYLLDYQANSYADQKRIADLLLTNTFL
FT                   FEDNWDMEPCSIPYRLETITWQKAVTDDPEWNFMLNRQTYLQTLILVYLVERDERYLLT
FT                   AKGFILNWIESAIPLDPKGLATRTLDTGIRCFAWVKCLIYLNLFNALTKQEESLILASL
FT                   EKQLQFLHTNYLDKYSLSNWGILQTTAILLADAYYGSDLDIAAATAFARKELTQQIALQ
FT                   ILEDGSQFEQSTMYHVEVLKSLLELTALVPDYLPQLRPTLLAMSDYLLKMTDPDHKQIP
FT                   LGDSDFTDTRDILTLAATILEEPHLKAAAFPTLDIDSLLLLGEKGVHTFEQLPIQTLPT
FT                   FAHHFEHSGHITINQENYYLFFKNGPIGSSHTHSDQNSICLYYKGQPLFCDAGRYTYKE
FT                   EPLRYALKSASHHSTAFLEEQLPEQIDSSWAYLSYPKSNYCHLRQNGHVYFIDGSYQTQ
FT                   FSDRNNYQHDRQILILPPGIFLIIDTIQAQGNHCLVSQFILDNHLEVKTDHLSDLRLIS
FT                   DYPFTIEETILSKKYNQYLTSHKLIKRKPFKDKGCTSTLLVPDDTKVTPLTPLQTGKRN
FT                   PIETALSWHLKGKQFDYSICVLQEDLIKGEKLVLLNGHKIRGKVVVINHITNEIIRLKH
FT                   "
FT   gene            complement(488060..488881)
FT                   /gene="agaD"
FT                   /locus_tag="SpyM3_0443"
FT   CDS             complement(488060..488881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaD"
FT                   /locus_tag="SpyM3_0443"
FT                   /product="putative PTS dependent galactosamine IID
FT                   component"
FT                   /note="best blastp hit: gb|AAK33597.1| (AE006517) putative
FT                   PTS dependent galactosamine IID component [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79050"
FT                   /db_xref="GOA:Q8K865"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K865"
FT                   /protein_id="AAM79050.1"
FT                   /translation="MTGSNKLTKKDYLKTALRAFFLQNGFNYSNYQGIGYANVIYPALK
FT                   KHFGSDKKGLYQALEDNCEFYNTNPHFLPFITSLHLVMLENDRPEEETRNIKMALMGPL
FT                   AGIGDSLSQFCLAPLFSTIAASLASDGLVLGPIFFFLAMNIILTAIKIGSGLYGYKVGT
FT                   SFIDKLSEQMAVVSRMANIVGVTVIAGLAATSVKITVPITFAAGKVDAANAAQKFVTIQ
FT                   GMLDKIAPALLPALFTLLMYYLIKNKKWTTYKLVLLTVLIGIIGSWLGILA"
FT   gene            complement(488868..489650)
FT                   /gene="agaW"
FT                   /locus_tag="SpyM3_0444"
FT   CDS             complement(488868..489650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaW"
FT                   /locus_tag="SpyM3_0444"
FT                   /product="putative PTS dependent N-acetyl-galactosamine-IIC
FT                   component"
FT                   /note="best blastp hit: gb|AAK33598.1| (AE006517) putative
FT                   PTS dependent N-acetyl-galactosamine-IIC component
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79051"
FT                   /db_xref="GOA:Q8K864"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K864"
FT                   /protein_id="AAM79051.1"
FT                   /translation="MDINLLQALLIGLWTAFCFSGMLLGIYTNRCSILSFGVGIILGDL
FT                   PTALSMGAISELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSAGKVTPEAALALSTPI
FT                   AVAIQFLQTFAYTAFAGAPETAKKQLQKGNIRGFKFAANGTIWAFAFIGLGLGLLGALS
FT                   MDTLLHLVDYIPPVLLNGLTVAGKMLPAIGFAMILSVMAKKELIPFVLIGYVCAAYLQI
FT                   PTIGIAIIGIIFALNEFYNKPKQVDATTVQGGQQDDWI"
FT   gene            complement(489669..490157)
FT                   /gene="agaV"
FT                   /locus_tag="SpyM3_0445"
FT   CDS             complement(489669..490157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaV"
FT                   /locus_tag="SpyM3_0445"
FT                   /product="putative PTS dependent N-acetyl-galactosamine-IIB
FT                   component"
FT                   /note="best blastp hit: gb|AAK33599.1| (AE006517) putative
FT                   PTS dependent N-acetyl-galactosamine-IIB component
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79052"
FT                   /db_xref="GOA:Q8K863"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K863"
FT                   /protein_id="AAM79052.1"
FT                   /translation="MTQPNIIMTRVDERLIHGQGQLWVKFLNCNTVIVANDAVSEDKIQ
FT                   QSLMKTVIPSSIAIRFFSIQKVIDIIHKASPAQSIFIVVKDLQDAKRLVEGGVPITEIN
FT                   IGNIHKTDDKVAITQFISLGETDKSAIRCLAHDHQVVFNTKTTPAGNSASDVDILDYI"
FT   gene            complement(490193..491392)
FT                   /gene="ugl"
FT                   /locus_tag="SpyM3_0446"
FT   CDS             complement(490193..491392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugl"
FT                   /locus_tag="SpyM3_0446"
FT                   /product="putative unsaturated glucuronyl hydrolase"
FT                   /note="best blastp hit: gb|AAK33600.1| (AE006517) putative
FT                   unsaturated glucuronyl hydrolase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79053"
FT                   /db_xref="GOA:Q8K862"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K862"
FT                   /protein_id="AAM79053.1"
FT                   /translation="MTRRLKTIALEPIKQPERFTKEDFLSQEDITQALDLALKQVRLNM
FT                   GYFKEDFPTPATKDNQYAIMDNTEWTNAFWTGCLWLAYEYSGDDAIKALAQANDLSFLD
FT                   RVTRDIELDHHDLGFLYTPSCMAEWKLLKTPEAREVALKAADKLVQRYQDKGGFIQAWG
FT                   ELGKKQDYRLIIDCLLNIQLLFFASQETGDNRYRDMAINHFYASANHVIRDDASAYHTF
FT                   YFDPETGDPVKGVTRQGYSDDSAWARGQAWGIYGIPLTYRSLKEPELIQLFKGMTHYFL
FT                   NRLPKDQVSYWDLIFGDGSEQSRDSSATAIAVCGIHEMLKTLPDHDPDKKTYEAAMHSM
FT                   LRALIKDYANKDLNPGAPLLLHGVYSWHSGKGVDEGNIWGDYYYLEALLRFYKDWNPYW
FT                   "
FT   gene            complement(491392..491829)
FT                   /gene="agaF"
FT                   /locus_tag="SpyM3_0447"
FT   CDS             complement(491392..491829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaF"
FT                   /locus_tag="SpyM3_0447"
FT                   /product="putative PTS dependent N-acetyl-galactosamine-and
FT                   galactosamine IIA component"
FT                   /note="best blastp hit: gb|AAK33601.1| (AE006517) putative
FT                   PTS dependent N-acetyl-galactosamine- and galactosamine IIA
FT                   component [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79054"
FT                   /db_xref="GOA:Q8K861"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K861"
FT                   /protein_id="AAM79054.1"
FT                   /translation="MIAIIVMGHGHFASGIVSSLELIAGQQEKVTAIDFTTEMTAADVQ
FT                   DQLSRALIPEEETLVLCDLLGGTPFKVAATLMESLPNTTCNVLSGLNLAMLIEASFARQ
FT                   TAASFDDLVSGLIICSKEGIVDWKTLSQQEDGATDDELGGI"
FT   gene            492164..492958
FT                   /locus_tag="SpyM3_0448"
FT   CDS             492164..492958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0448"
FT                   /product="putative 5-keto-D-gluconate 5-reductase"
FT                   /note="best blastp hit: gb|AAK33602.1| (AE006518) putative
FT                   5-keto-D-gluconate 5-reductase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79055"
FT                   /db_xref="GOA:Q8K860"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K860"
FT                   /protein_id="AAM79055.1"
FT                   /translation="MENMFSLQGKIALITGASYGIGFEIAKAYAQAGATIVFNDIKQEL
FT                   VDRGMAAYRELGIEAHGYVCDVTDEAGIQQMVSQIEDEVGVIDILVNNAGIIRRTPMLE
FT                   MAAEDFRQVIDIDLNAPFIVSKAVLPSMIAKGHGKIINICSMMSELGRETVSAYAAAKG
FT                   GLKMLTKNIASEFGEANIQCNGIGPGYIATPQTAPLRERQADGSRHPFDQFIIAKTPAA
FT                   RWGTTEDLAGPAVFLASDASNFVNGHILYVDGGILAYIGKQP"
FT   gene            492983..493624
FT                   /locus_tag="SpyM3_0449"
FT   CDS             492983..493624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0449"
FT                   /product="putative sugar-phosphate isomerase"
FT                   /note="best blastp hit: gb|AAK33603.1| (AE006518)
FT                   sugar-phosphate isomerase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79056"
FT                   /db_xref="GOA:F7IVS3"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR022133"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVS3"
FT                   /protein_id="AAM79056.1"
FT                   /translation="MKIALINENSQAAKNGIIYDALTSVTDKHGYQVFNYGMYGTEGES
FT                   QLTYVQNGLLASILLTTKAADFVVTGCGTGVGAMLALNSFPGVTCGFASEPTEAYLFSQ
FT                   INGGNALSIPFAKGFGWGAELNLTLIFERLFAEPMGGGYPKERAIPEQRNARILSDLKK
FT                   ITYRDLLAIVKDIDQDFLKETISGAHFKEYFFANAEPSELVTYLKSVLEQ"
FT   gene            493653..494654
FT                   /gene="kdgK"
FT                   /locus_tag="SpyM3_0450"
FT   CDS             493653..494654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgK"
FT                   /locus_tag="SpyM3_0450"
FT                   /product="putative 2-keto-3-deoxygluconate kinase"
FT                   /note="best blastp hit: gb|AAK33604.1| (AE006518) putative
FT                   2-keto-3-deoxygluconate kinase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79057"
FT                   /db_xref="GOA:Q8K859"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K859"
FT                   /protein_id="AAM79057.1"
FT                   /translation="MFKLLLVGEPLIRVSPNQFQPLTNACDAQLFFGGSEVNIARTLGG
FT                   FGLETRLFTALPDNSVGHAFHQFLKQIGVDMTLTAWQGNRVGLYYLENGFGCRASQVYY
FT                   DRCGSSFSALDKDSLDLAAIFEGIRHFHFSGISLALGKKTQDLIEILAREARKRQVCVS
FT                   FDLNFRSNMIAVADAKRLFSHFAQYADIIFGMEPLLLDSDDFDMFDRNKADATMIRERL
FT                   AGLYQRYQLQAIYHTERSNDAQGSNRFKAYAYDGQFYESCEVTTPVLQRVGSGDAFVAG
FT                   LLYQLLEGNEKQRNLDFAVATASLKCTVAEDQLYHSVQQVEAVLANQRDVQR"
FT   gene            494659..495294
FT                   /gene="kgdA"
FT                   /locus_tag="SpyM3_0451"
FT   CDS             494659..495294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kgdA"
FT                   /locus_tag="SpyM3_0451"
FT                   /product="putative 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase"
FT                   /note="best blastp hit: gb|AAK33605.1| (AE006518) putative
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79058"
FT                   /db_xref="GOA:Q8K858"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K858"
FT                   /protein_id="AAM79058.1"
FT                   /translation="MGKIEILTKLKANRLVLVVRGESSEEALACSLASIEGGIKTIEVT
FT                   YTNPFASEVIGQLAERFKEDPEVLIGAGTVLDDVTARQAILAGAQFIVGPNFNRAVALI
FT                   CHRYSIPYLPGCMTVNEVVTALESGVDMVKIFPGSTVGMSFIRAIKSPLPQVEVMVTGG
FT                   VSSDNLKDWLAAGVDVLGIGGEFNQLASQKQYNLITKKAAHYIKSLRQ"
FT   gene            495591..496241
FT                   /locus_tag="SpyM3_0452"
FT   CDS             495591..496241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit:gb|AAK04841.1|AE006308_1
FT                   (AE006308) conserved hypothetical protein [Lactococcus
FT                   lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79059"
FT                   /db_xref="GOA:Q8K857"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K857"
FT                   /protein_id="AAM79059.1"
FT                   /translation="MIKGIIFDMDGVLFDTEPFYLRRREDFFKTKGIPIDHLNSKDFIG
FT                   GNLQELWKELLGKNRDDAIVKAITTDYDAYKQAHKPPYQKLLITEVNSCLEQLKKQGIK
FT                   LAVASNSKRQDVLLALETTQIKDYFEIILAREDVSRGKPYPDIYNKAVQKLGLQKKQLL
FT                   VVEDSQKGIAAAKAANLTVFAITDYRYGIDQSQADHKIDHLGQLCVKIGCFGS"
FT   gene            496937..498061
FT                   /locus_tag="SpyM3_0453"
FT   CDS             496937..498061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: emb|CAB07527.1| (Z93102)
FT                   hypothetical 48.5 kd protein [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79060"
FT                   /db_xref="GOA:Q8K856"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K856"
FT                   /protein_id="AAM79060.1"
FT                   /translation="MTIKAEIKALAKEIGISKIGFTTADNFDYLEKSLRASVEEGRNSG
FT                   FEHKVIEDRISPERLLESAKTIISIGVAYPHKLPQQPQKTPYKRGKITPSSWGLDYHYV
FT                   VGEKLDRLSKGIEELCRDFPLQQKAMVDTGALVDTAVAQRAGIGFIGKNGLVISKEYGS
FT                   YMFLGELITNLEIEPDKPVDYDCGDCRRCLDACPTSCLIGDGSMNAKRCLSFQTQDKGM
FT                   MDIEFRKKIKTVIYGCDICQICCPYNKGINNSPATEIDPELAQPELIPFLSLSNGQFKE
FT                   KFGMIAGSWRGKNILQRNAIIALANAHDKTAVVKLIEIIDKNNNPIHTATAIWALGEIV
FT                   KKPNDEILAFMSHLTLKDEDSQKELELIRHKWQV"
FT   gene            498248..499228
FT                   /gene="prfB"
FT                   /locus_tag="SpyM3_0454"
FT   CDS             498248..499228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="SpyM3_0454"
FT                   /product="putative peptide chain release factor 2"
FT                   /note="best blastp hit: gb|AAK33608.1| (AE006518) putative
FT                   peptide chain release factor 2 [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79061"
FT                   /db_xref="GOA:Q8K855"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K855"
FT                   /protein_id="AAM79061.1"
FT                   /translation="MTEPDFWNDNIAAQKTSQELNELKGKYDTFHNMQELSDETELLLE
FT                   MLDEDDFLKEELEENLMQLDKITGAYEMTLLLSEPYDHNNAILEIHPGSGGTEAQDWGD
FT                   LLLRMYTRFGNANGFKVEVLDYQAGDEAGIKSVTLSFEGPNAYGLLKSEMGVHRLVRIS
FT                   PFDSAKRRHTSFASVEVMPELDDTIEVEVRDDDIKMDTFRSGGAGGQNVNKVSTGVRLT
FT                   HIPTGIVVSSTVDRTQYGNRDRAMKMLQAKLYQLEQEKKAQEVDALKGDKKEITWGSQI
FT                   RSYVFTPYTMVKDHRTNFELAQVDKVMDGEINGFIDAYLKWRIED"
FT   gene            499247..499939
FT                   /gene="ftsE"
FT                   /locus_tag="SpyM3_0455"
FT   CDS             499247..499939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="SpyM3_0455"
FT                   /product="putative cell-division ATP-binding protein"
FT                   /note="best blastp hit: gb|AAK33609.1| (AE006518) putative
FT                   cell-division ATP-binding protein [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79062"
FT                   /db_xref="GOA:Q7CFB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFB2"
FT                   /protein_id="AAM79062.1"
FT                   /translation="MALIEMSGVTKKYRRSTTALRDVNVSVNQGEFVYLVGPSGAGKST
FT                   FIKLLYREEQLTTGKLYVGEFNLTKLKARDVPILRRHIGVVFQDYKLLPRKTVFENVAY
FT                   AMEVIGEKRRHIKKRVPEVLDLVGLKHKMRSFPSQLSGGEQQRVAIARAIVNNPKLLIA
FT                   DEPTGNLDPEISWEIMQLLERINVQGTTILMATHNSHIVNTFRHRVVAIEDGRIVRDEE
FT                   KGDYGYDD"
FT   gene            499932..500861
FT                   /gene="ftsX"
FT                   /locus_tag="SpyM3_0456"
FT   CDS             499932..500861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="SpyM3_0456"
FT                   /product="putative cell-division protein"
FT                   /note="best blastp hit: gb|AAK33610.1| (AE006518) putative
FT                   cell-division protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79063"
FT                   /db_xref="GOA:Q7CFB1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFB1"
FT                   /protein_id="AAM79063.1"
FT                   /translation="MIRYFFRHIWESIKNLKRNFWMTFASVSMVAVTLTLVGVFAATLL
FT                   NIQRVASGVENNVHINTYLQVDSTDAAKVIQNTAGEPVNNDNYHSVYDKIAQIKGVKKI
FT                   TFSSKDEQLKKLQETLGDVWNMYDQDTNPLQDIYLIETQTPKQVKAITKKIRTIEGVEA
FT                   ADYGGINSDKLFKFSTLIQTWGLIGTAMLLFVAVFLISNTIRMTIMSRKRDIEIMRLVG
FT                   AKNSYIRGPFFFEGAWVGLLGAVLPSLLIYYGYDLVYKHFAQELQRNNLSMYPLDPYVY
FT                   YLIGALFVIGIMIGSLGSVLSMRRYLKF"
FT   gene            complement(501170..501868)
FT                   /locus_tag="SpyM3_0457"
FT   CDS             complement(501170..501868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0457"
FT                   /product="putative metallo-beta-lactamase superfamily
FT                   protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75726.1| (AE007458)
FT                   metallo-beta-lactamase superfamily protein [Streptococcus
FT                   pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79064"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K854"
FT                   /protein_id="AAM79064.1"
FT                   /translation="MPFIFRYSFFNKALIFWYTILMKIYKTINHIAGENTYYLVNDQAV
FT                   ILIDPGSNGQEIIAKIKSFEKPLVAILLTHTHYDHIFSLDLVRDAFDHPPVYVSEKEAA
FT                   WLSSPDDNLSGLGRHDDIITVIARPAENFFKLKQPYQLNGFEFTVLPTPGHSWGGVSFV
FT                   FHSDELVVTGDALFRETIGRTDLPTSNFEDLITGIRQELFTLPNHYRVYPGHGPSTTIC
FT                   HEKNANPFFH"
FT   gene            502036..502800
FT                   /locus_tag="SpyM3_0458"
FT   CDS             502036..502800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0458"
FT                   /product="putative acetoin reductase"
FT                   /note="best blastp hit: gb|AAK04996.1|AE006323_11
FT                   (AE006323) acetoin reductase (EC 1.1.1.5) [Lactococcus
FT                   lactissubsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79065"
FT                   /db_xref="GOA:Q8K853"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K853"
FT                   /protein_id="AAM79065.1"
FT                   /translation="MSKVAIVTGAGQGIGFAIAKRLHADGFKIGILDYNEETVQAAVDK
FT                   LSPEDAVAVVADVSKRDQVFDAFQKVVDTFGDLNVVVNNAGVAPTTPLDTITEEQFEKA
FT                   FAINVGGTIWGSQAAQKHFRELGHGGKIINATSQAGCEGNPNLTVYGGTKFTVRGITQT
FT                   LAKDLASEGITVNAYAPGIVKTPMMFDIAHEVGKNAGKDDEWGMEQFAKDITLKRLSEP
FT                   EDVANAVGFLAGDDSNYITGQTIVVDGGMVFH"
FT   gene            502908..505409
FT                   /gene="dinG"
FT                   /locus_tag="SpyM3_0459"
FT   CDS             502908..505409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinG"
FT                   /locus_tag="SpyM3_0459"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /note="best non-GAS blastp hit: gb|AAK74939.1| (AE007387)
FT                   DNA polymerase III, epsilon subunit/ATP-dependent helicase
FT                   DinG [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79066"
FT                   /db_xref="GOA:Q8K852"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K852"
FT                   /protein_id="AAM79066.1"
FT                   /translation="MFCFIDIACYNRLTMTQKKLRKYAVVDLEATGAGPNASIIQVGIV
FT                   IIQGNKIIDSYETDVNPHESLDEHIVHLTGITDKQLAKAPDFGQVAHHIYQLIEDCIFV
FT                   AHNVKFDANLLAEALFLEGYELTIPRVDTVELAQLFFPRFEKYNLSHLSRQLNIDLAEA
FT                   HTAIADARATAILFLRLLQKIESLPIECLESLLAYSDSLLFETAMVIQEGLAKAKPYDP
FT                   NKYIKIRQILLPKGSKALKSYQISKSFPINIALLGLEERPKQTQFAQLIDEDYHQGAAS
FT                   FIEAQTGIGKTYGYLLPLLAKEDQNQIIVSVPTKLLQDQLMAGEVAAIQEQFHIACHSL
FT                   KGPANYLKLDSFADSLDQNDQNRLVNRYKMQLLVWLLETKTGDLDEIKQKQRFAAYFEQ
FT                   LKHDGDIKQSSEFYDYDFWRVSYEKAKTARLLITNHAYFLHRVQDDKDFARNKVLVFDE
FT                   AQKLMLQLDQLSRHQLNLTVFLQTIQAKLSNPLPLLEKRLLESLSFELGQVSSDYYQNK
FT                   EHQLAHDWSRIAGYAKELTGADYQELQAFFATSDGDYWLSSEKQEEKRVTYLNSASKAF
FT                   IHFQQLLPETVKTYFVSATLTISSEVTLADLLGFEEYLYHVIEKDKKQDQLVLVDQEAP
FT                   IVTEVSDQIYVEAIAKRIESLKQEGYPILVLFNSKKHLLLVSDYLDQWQVPHLAQEKNG
FT                   TAYNIKKRFDQGEQTILLGLGSFWEGVDFIQADRMITLIARLPFDNPEDFFVKKMSHYL
FT                   LEKGKNPFRDYFLPMTILRLKQAIGRTMRRKDQKSVVIILDRRLLTKSYGQVILEGLGQ
FT                   EFLISQQNFHDCLVETDCFLI"
FT   gene            505755..506948
FT                   /gene="aspC"
FT                   /locus_tag="SpyM3_0460"
FT   CDS             505755..506948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="SpyM3_0460"
FT                   /product="putative aspartate aminotransferase"
FT                   /note="best blastp hit: gb|AAK33613.1| (AE006519) putative
FT                   aspartate aminotransferase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79067"
FT                   /db_xref="GOA:Q8K851"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K851"
FT                   /protein_id="AAM79067.1"
FT                   /translation="MPKLSKRVLEMKESVTLAAGARAKALKAQGRDVLNLTLGEPDFFT
FT                   PKHIQDKAIESIQNGTASFYTNASGLPELKAAIATYLKNQYGYHLSPDQIVAGTGAKFI
FT                   LYAFFMAVLNPGDQVLIPTPYWVSYSDQVKMAEGQPIFVQGLEENQFKVTVDQLERART
FT                   SKTKVVLINSPSNPTGMIYGAEELRAIGEWAVHNDILILADDIYGSLVYNGNQFVPIST
FT                   LSEAIRRQTITVNGVAKSYAMTGWRVGFAAGEPEIISAMSKIIGQTTSNLTTVSQYAAI
FT                   EAFCGSQSSLEEMRLAFEERLNITYPLLCQVPGFEVVKPQGAFYFFPNVKKAMEMTGFS
FT                   DVTSFANAILEEVGLAVVSGAGFGAPENVRLSYATDIKTLKEAVRRLHVFMESNEIN"
FT   gene            506969..508315
FT                   /gene="asnS"
FT                   /locus_tag="SpyM3_0461"
FT   CDS             506969..508315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="SpyM3_0461"
FT                   /product="putative asparaginyl-tRNA synthetase"
FT                   /note="best blastp hit: gb|AAK33614.1| (AE006519) putative
FT                   asparaginyl-tRNA synthetase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79068"
FT                   /db_xref="GOA:P0DG28"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG28"
FT                   /protein_id="AAM79068.1"
FT                   /translation="MSKKLISIVDVKDYVGQEVTIGAWVANKSGKGKIAFVQLRDGSAF
FT                   FQGVAFKPNFIEKYGEESGLEKFDVIKRLNQETSVYVTGIVKEDERSKFGYELDITDLE
FT                   IIGESHEYPITPKEHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKF
FT                   DSPILSENAAEDSTELFETDYFGKPAFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSK
FT                   TRRHLTEFWMMDAEYSFLSHEESLDLQEAYVKALIQGVLDRAPQALDILERDVEALKRY
FT                   ITEPFKRVSYDDAITLLQEHEADEDTDYEHLEHGDDFGSPHETWISNYFGVPTFVVNYP
FT                   ASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAKMDELGMDKSEY
FT                   DFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRMLHRIRP"
FT   gene            508729..509619
FT                   /locus_tag="SpyM3_0462"
FT   CDS             508729..509619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75653.1| (AE007451)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79069"
FT                   /db_xref="GOA:P0DG76"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG76"
FT                   /protein_id="AAM79069.1"
FT                   /translation="MSDKHINLVIVTGMSGAGKTVAIQSFEDLGYFTIDNMPPALVPKF
FT                   LELIEQTNENRRVALVVDMRSRLFFKEINSTLDSIESNPSIDFRILFLDATDGELVSRY
FT                   KETRRSHPLAADGRVLDGIRLERELLSPLKSMSQHVVDTTKLTPRQLRKTISDQFSEGS
FT                   NQASFRIEVMSFGFKYGLPLDADLVFDVRFLPNPYYQVELREKTGLDEDVFNYVMSHPE
FT                   SEVFYKHLLNLIVPILPAYQKEGKSVLTVAIGCTGGQHRSVAFAHCLAESLATDWSVNE
FT                   SHRDQNRRKETVNRS"
FT   gene            509760..510593
FT                   /locus_tag="SpyM3_0463"
FT   CDS             509760..510593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0463"
FT                   /product="conserved hypothetical protein-phage-associated"
FT                   /note="best non-GAS blastp hit: emb|CAB96620.1| (AJ400630)
FT                   hypothetical protein [Streptococcus pneumoniae
FT                   bacteriophage MM1]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79070"
FT                   /db_xref="GOA:P0DG78"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG78"
FT                   /protein_id="AAM79070.1"
FT                   /translation="MQLAPPGDLRNVLLAMSDMPKFYERVFQYRFNESDGALAGHPLGN
FT                   LIIAGISEMQGSTYNAIQILTKFFHITGKIYPSSEQALTLHAVFKDGHEVAGESSIAKY
FT                   QGMIDHVYVTNTYNDQKPQASRKVVEAILESDMIVLGPGSLFTSILPNLVIPEIKEALR
FT                   QTKAEVVYICNIMTQYGETEQFSDADHVAVLNQHLGRDLIDTVLVNVAKVPQAYMNSNK
FT                   FDEYLVQVDHDFAGLCRAAKRVISSYFLRLENGGAFHDGNLVVEELMNLVRIVKQ"
FT   gene            510590..511501
FT                   /locus_tag="SpyM3_0464"
FT   CDS             510590..511501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0464"
FT                   /product="conserved hypothetical protein-phage-associated"
FT                   /note="best non-GAS blastp hit: emb|CAB96619.1| (AJ400630)
FT                   hypothetical protein [Streptococcus pneumoniae
FT                   bacteriophage MM1]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79071"
FT                   /db_xref="GOA:P0DH42"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DH42"
FT                   /protein_id="AAM79071.1"
FT                   /translation="MSFTTKVKEELIHLSTGDNNELAAIIKLSGSLGLAHQSLHLSITT
FT                   ENAKIARYIYSFIEDAYVIVPEIRYHQKTNLRKNRVYTVYVEQGVETILADLKLADSFF
FT                   GLETGIEPQVLSDDNAGRSYLKGAFLAAGSIRDPESGKYQLEIYSVYLDHAQDLAQLMQ
FT                   KFMLDAKTIEHKSGAVTYLQKAEDIMDFLIIIGAMSCKEDFEAIKLLREARNDINRANN
FT                   AETANIAKTISASMKTINNIIKIMDTIGLESLPIELQQVAQLRVKHPDYSIQQVADALE
FT                   FPITKSGVNHRLRKINKIADDL"
FT   gene            511634..513031
FT                   /gene="pepD"
FT                   /locus_tag="SpyM3_0465"
FT   CDS             511634..513031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="SpyM3_0465"
FT                   /product="putative dipeptidase"
FT                   /note="best blastp hit: sp|Q9A0M0|PEDA_STRPY Probable
FT                   dipeptidase A, and gb|AAK33666.1| (AE006523) putative
FT                   dipeptidase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79072"
FT                   /db_xref="GOA:P0DD24"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD24"
FT                   /protein_id="AAM79072.1"
FT                   /translation="MACTTILVGKKASYDGSTMVARTEDSQNGDFTPKKMIVVKPEDQP
FT                   RHYRSVQSSFEMDLPDNPMTYTSVPDALGKDGIWAEAGVNEANVAMSATETITTNSRVL
FT                   GADPLVASGIGEEDMVTLVLPYIRSAREGVLRLGAILEDYGTYESNGVAFSDEHDIWWL
FT                   ETIGGHHWIARRVPDDAYVTNPNQFGIDHFEFNNPEDYLCSADLKDFIDTYHLDLTYSH
FT                   EHFNPRYAFGSQRDKDRQYNTPRVWIMQKFLNPEIVQDPRSFALAWCQKPYRKITVEDV
FT                   KYVLSSHYQDTVYDPYGSEGTPVSKKVFRPIGINRTSQTAILHIRPNKPQEIAAIQWMA
FT                   YGSMPFNTMVPFFTQVKTIPDYFANTYENVSTDNFYWTNRLIAALADPHYNHHETDLDN
FT                   YLEETMAKGHAMLHAVEAQLLAGETVDLEEENQKMSDYVQGETQTLLNKILFDASNLMT
FT                   NRFSLSD"
FT   gene            513183..514730
FT                   /gene="adcA"
FT                   /locus_tag="SpyM3_0466"
FT   CDS             513183..514730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcA"
FT                   /locus_tag="SpyM3_0466"
FT                   /product="putative adhesion protein"
FT                   /note="best blastp hit: sp|Q9A0L9|ADCA_STRPY zinc-binding
FT                   protein adcA precursor, and gb|AAK33667.1| (AE006523)
FT                   putative adhesion protein [Streptococcus pyogenes M1 GAS];
FT                   zinc-binding protein AdcA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79073"
FT                   /db_xref="GOA:P0DF58"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015304"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF58"
FT                   /protein_id="AAM79073.1"
FT                   /translation="MKKKILLMMSLISVFFAWQLTQAKQVLAEGKVKVVTTFYPVYEFT
FT                   KGIVGNDGDVSMLMKAGTEPHDFEPSTKDIKKIQDADAFVYMDDNMETWVSDVKKSLTS
FT                   KKVTIVKGTGNMLLVAGVGHDHHHEEADKKHEHNKHSEEGHNHAFDPHVWLSPYRSITV
FT                   VENIRDSLSKAYPEKAENFKANAATYIEKLKELDKDYTAALSDAKQKSFVTQHAAFGYM
FT                   ALDYGLNQISINGVIPDAEPSAKRIATLSKYVKKYGIKYIYFEENASSKVAKTLAKEAG
FT                   VKAAVLSPLEGLTEKEMKAGQDYFTVMRKNLETLRLTTDVAGKEILPEKDTTKTVYNGY
FT                   FKDKEVKDRQLSDWSGSWQSVYPYLQDGTLDQVWDYKAKKSKGKMTAAEYKDYYTTGYK
FT                   TDVEQIKINGKKKTMTFVRNGEKKTFTYTYAGKEILTYPKGNRGVRFMFEAKEPNAGEF
FT                   KYVQFSDHAIAPEKAEHFHLYWGGDSQEKLHKELEHWPTYYGSDLSGREIAQEINAH"
FT   gene            514878..515600
FT                   /locus_tag="SpyM3_0467"
FT   CDS             514878..515600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0467"
FT                   /product="putative transcriptional regulator (GntR family)"
FT                   /note="best blastp hit: gb|AAK33668.1| (AE006523) putative
FT                   transcriptional regulator (GntR family) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79074"
FT                   /db_xref="GOA:Q8K846"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K846"
FT                   /protein_id="AAM79074.1"
FT                   /translation="MPKEQPLYLQIVDDLEVKIKKSMTENDKLLSERELSDLYGVSRIT
FT                   IRLALKELELRDLIYKKQGKGTYVSGIKEPVTDLSSTYSFTEQMKKVGKTPKTEILSFE
FT                   QYQVTPYLSGLLEFDLDTEVFELERLRIADDMPLMFERSYIPAQLFQGLSIADLKRKAL
FT                   YDIFAKDYQETIRLAEEEFYASIALDYEADLLGIKKGDPVLHIIRKTYNDKNILIEFTF
FT                   SIARADQFRYRVQHHPNG"
FT   gene            515620..516819
FT                   /gene="agaS"
FT                   /locus_tag="SpyM3_0468"
FT   CDS             515620..516819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaS"
FT                   /locus_tag="SpyM3_0468"
FT                   /product="putative tagatose-6-phosphate aldose/ketose
FT                   isomerase"
FT                   /note="best blastp hit: gb|AAK33669.1| (AE006523) putative
FT                   tagatose-6-phosphate aldose/ketose isomerase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79075"
FT                   /db_xref="GOA:Q8K845"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K845"
FT                   /protein_id="AAM79075.1"
FT                   /translation="MFTKTQEALEALGAAITTKEIKQEPRLWQETMTFFDETRDSLDSF
FT                   LKRVCKSANGNNVHVIFTGAGTSEYIGNTICPYLKKVGNRQCYLFESVASTDLVAAPDY
FT                   YLAEEETVLLVSFARSGNSRESVAAVNLVNQLVPNSYHLTITCAKDGELAKKAQQDERS
FT                   YLYLMPEDANDAGFAMTGSFTCMMLAALLIFDDANSIAQKEVYVTDMILAGQAVIDQER
FT                   RLQELADLGFERLVYLGSAGLAKLTQEAQLKMLELTAGQVATLYESSMGFRHGPKSFIN
FT                   DRTLVIGFVNNDAYVRQYDLDMLEEIQADGIALKILALLQGGDINFSEDQFRLDTRHLL
FT                   PEVYLAFPMILVAQTLALLTAVTLGNSPDTPSATGTVNRVVKGVTIHPYPTSSRQCNKA
FT                   "
FT   gene            complement(516916..517176)
FT                   /gene="rpmE"
FT                   /locus_tag="SpyM3_0469"
FT   CDS             complement(516916..517176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="SpyM3_0469"
FT                   /product="50S ribosomal protein L31"
FT                   /note="best blastp hit: sp|Q9A0L6|R31B_STRPY 50S ribosomal
FT                   protein L31 type B, and gb|AAK33670.1| (AE006523) 50S
FT                   ribosomal protein L31 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79076"
FT                   /db_xref="GOA:P0DE38"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE38"
FT                   /protein_id="AAM79076.1"
FT                   /translation="MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFEGETYPLI
FT                   RVEISSDSHPFYTGRQKFTQADGRVDRFNKKYGLKDANAAK"
FT   gene            complement(517291..518232)
FT                   /locus_tag="SpyM3_0470"
FT   CDS             complement(517291..518232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75402.1| (AE007429)
FT                   DHH subfamily 1 protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79077"
FT                   /db_xref="GOA:Q8K844"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K844"
FT                   /protein_id="AAM79077.1"
FT                   /translation="MITTFETILDKIKAHQTIIIHRHQNPDPDALGSQAGLKEIIAQNF
FT                   PDKKVLMTGFDEPSLTWISQMDQVTDKDYKEALVIITDTANRPRIDDERYTLGQCLIKI
FT                   DHHPNDDVYGDFYYVDTSASSASEIIADFAFSQNLTLSDKAAKLLYTGIVGDTGRFLYA
FT                   STTSKTLSIASQLRHFEFDFAAISRQMDSFPLKIAKLQSYVFEHLTIDESGAAYVLVSQ
FT                   ETLKHFDVTLAESSAIVCAPGKIDNVQAWAIFVELTDGNYRVRMRSKEKIINGIAKRHG
FT                   GGGHPLASGANSANLEENQAIFRELIAVCQEI"
FT   gene            518626..519075
FT                   /gene="flaV"
FT                   /locus_tag="SpyM3_0471"
FT   CDS             518626..519075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaV"
FT                   /locus_tag="SpyM3_0471"
FT                   /product="putative flavodoxin"
FT                   /note="best blastp hit: gb|AAK33672.1| (AE006524) putative
FT                   flavodoxin [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79078"
FT                   /db_xref="GOA:Q7CFB0"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFB0"
FT                   /protein_id="AAM79078.1"
FT                   /translation="MALAKIVYASMTGNTEEIADIVANKLQELGHDVDIDECTTVDASE
FT                   FENADIAVVATYTYGDGDLPDEIVDFYEDLQDLDLEGKIYGVVGSGDTFYDYFCKSVDD
FT                   FSEQFALTGAIKGAEPVKVDLAAEDEDIDRLEAFAEQLSQAVNNL"
FT   gene            519250..519534
FT                   /locus_tag="SpyM3_0472"
FT   CDS             519250..519534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75400.1| (AE007428)
FT                   chorismate mutase, putative [Streptococcus pneumoniae
FT                   TIGR4], and gb|AAK99977.1| (AE008489) Strong similarity to
FT                   chorismate mutase; prephenate dehydratase [Streptococcus
FT                   pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79079"
FT                   /db_xref="GOA:Q8K843"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR011279"
FT                   /db_xref="InterPro:IPR020822"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K843"
FT                   /protein_id="AAM79079.1"
FT                   /translation="MRLEEIRQEINSIDHHLVALLEKRMALVEQVTAYKLANHLPVLDQ
FT                   VRENQILDRVSYLVKDQAFEPAIHETFKTIMSLSRKYQTQHLTGGDTND"
FT   gene            519527..520789
FT                   /locus_tag="SpyM3_0473"
FT   CDS             519527..520789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0473"
FT                   /product="putative transmembrane protein"
FT                   /note="best non-GAS blastp hit: gb|AAK19834.1| (AF013585)
FT                   putative TM protein [Streptococcus thermophilus]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79080"
FT                   /db_xref="GOA:Q8K842"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K842"
FT                   /protein_id="AAM79080.1"
FT                   /translation="MIKSIATLPKPSLKEALGLIGLALPIGVAVGVIDVIFGKGLLFLS
FT                   EYRDHHLFLLLPFLALAGLVIVFLYDKLGKEVRQGMGLVFQVGHGQKDQIPPILIPLIL
FT                   LSTWVTHLFGASAGREGVAVQIGATISHYCRRFVTSQEAARHLLIMGMAAGFAGLFQTP
FT                   IAAVVFALEVLLVGTLRYCALLPSLVAACVASWTSHSLGLEKFTIVLEETLTITPLTLV
FT                   KLIGLGLIFGLVGNSFACLLGWFKPYLSQKLPNPYLRIAFIGVLLSICLMIGRVGRYSG
FT                   LGTHLIAAAFSGQTILTYDWLLKMIVTVISLSAGFQGGEVTPLFAIGASLGIVLAPYLG
FT                   LPVLLVAALGYVTVFGSATNTFWAPIFIGIEVFGPENALAYFVTSAAAYMVSHRHSIYS
FT                   YQKVVMINLKDMTVNQMDLKK"
FT   gene            520904..521251
FT                   /gene="rplS"
FT                   /locus_tag="SpyM3_0474"
FT   CDS             520904..521251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="SpyM3_0474"
FT                   /product="50S ribosomal protein L19"
FT                   /note="best blastp hit: sp|P58169|RL19_STRPY 50S ribosomal
FT                   protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79081"
FT                   /db_xref="GOA:P0DE14"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE14"
FT                   /protein_id="AAM79081.1"
FT                   /translation="MNPLIQSLTEGQLRSDIPNFRPGDTVRVHAKVVEGTRERIQIFEG
FT                   VVISRKGQGISEMYTVRKISGGIGVERTFPIHTPRVDKIEVIRHGKVRRAKLYYLRALQ
FT                   GKAARIKEIRR"
FT   gene            521499..521570
FT                   /locus_tag="SpyM3_t45"
FT   tRNA            521499..521570
FT                   /locus_tag="SpyM3_t45"
FT                   /product="tRNA-Arg"
FT   gene            522267..522836
FT                   /locus_tag="SpyM3_0475"
FT   CDS             522267..522836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0475"
FT                   /product="putative hydrolase"
FT                   /note="best non-GAS blastp hit: gb|AAK74942.1| (AE007387)
FT                   hydrolase, haloacid dehalogenase-like family [Streptococcus
FT                   pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79082"
FT                   /db_xref="GOA:Q8K841"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K841"
FT                   /protein_id="AAM79082.1"
FT                   /translation="MKGMNYQDYIWDLGGTLLDNYELSTQAFVQTLAFFSLPGDHDAVY
FT                   QKLKESTAIAVATFAPNEPEFLHVYRLREADKLAQPIWCLGAKEILEKIATSGSRNFLI
FT                   SHRDCQVNQLLEQAGLLIYFTEVVTASNGFARKPNPESLFYLKEKYDINSGLVIGDRLI
FT                   DKQAGQAAGFNTLLVDGRKNLLEIVT"
FT   gene            522927..524789
FT                   /gene="gyrB"
FT                   /locus_tag="SpyM3_0476"
FT   CDS             522927..524789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="SpyM3_0476"
FT                   /product="putative DNA gyrase, subunit B"
FT                   /note="best blastp hit: gb|AAK33677.1| (AE006524) putative
FT                   DNA gyrase, subunit B [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79083"
FT                   /db_xref="GOA:P0DG04"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG04"
FT                   /protein_id="AAM79083.1"
FT                   /translation="MRPGMYIGSTAKEGLHHLVWEIVDNSIDEALAGFASHIKVFIEAD
FT                   NSITVVDDGRGIPVDIQVKTGRPAVETVFTVLHAGGKFGGGSYKVSGGLHGVGSSVVNA
FT                   LSTQLDVRVYKNGQIHYQEFKRGAVVADLEVIGTTDVTGTTVHFTPDPEIFTETTQFDY
FT                   SVLAKRIQELAFLNRGLKISITDKRSGMEQEEHFHYEGGIGSYVEFLNDKKDVIFETPI
FT                   YTDGELEGIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKN
FT                   KILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQR
FT                   FLLENPQVARKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDANQN
FT                   ELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTG
FT                   FGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGV
FT                   KVGSEIKEYIQPGIDQEDQLKTALEKYSIGRSKPTVQRYKGLGEMDDHQLWETTMDPEN
FT                   RLMARVTVDDAAEADKVFDMLMGDRVEPRRDFIEENAVYSTLDI"
FT   gene            525157..526881
FT                   /locus_tag="SpyM3_0477"
FT   CDS             525157..526881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0477"
FT                   /product="putative cell division regulator"
FT                   /note="best non-GAS blastp hit: gb|AAK99520.1| (AE008448)
FT                   Cell division regulator, negative regulator of FtsZ ring
FT                   formation [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79084"
FT                   /db_xref="GOA:P0DA98"
FT                   /db_xref="InterPro:IPR010379"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA98"
FT                   /protein_id="AAM79084.1"
FT                   /translation="MSSGIILLIVAIVLLVIIAYLVGVIIRKRNDSLITSLEERKQALF
FT                   ALPVNDEIEEVKSLHLIGQSQTSFREWNQKWVDLTVNSFADIENHIFEAENLNDTFNFI
FT                   RAKHEINSVESQLNLVEEDIASIREALNILKEQEEKNSARVTHALDLYEKLQASISENE
FT                   DNFGSTMPEIDKQMKNIETEFSQFVALNSSGDPVEASEVLDRAEEHTIALGQITEQIPA
FT                   IVAKLEDDFPDQLDDLETGYRRLLEENYHFPEKNIEARFQEIRESIRANSSELVTLDLD
FT                   RAREENTHIQERIDSLYEVFEREIAAYKVAAKNSKMLPRYLAHVKRNNEQLKDEIARLS
FT                   RKYILSETESLTVKAFEKDIKEIEDSTLAVAEQFGLQEKPFSELQVTFERSIKTLTNVE
FT                   SGQMDVFAAVKDIEKIESQARHNLDVYVTQLHMIKRYMEKRHLPGIPQDFLSAFFTTSS
FT                   QLEALMDELSRGRINIEAVSRLSEVATVAIANLEDLTYQVVQNATLTEQLLQYSNRYRS
FT                   FEAGVQSSFEHALRLFEVENDYQASFDEISYALETVEPGVTDRFVNSYEKTREHIRF"
FT   gene            complement(527013..527471)
FT                   /locus_tag="SpyM3_0478"
FT   CDS             complement(527013..527471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75237.1| (AE007413)
FT                   hypothetical protein [Streptococcus pneumoniae TIGR4], and
FT                   gb|AAK99839.1| (AE008476) hypothetical protein
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79085"
FT                   /db_xref="InterPro:IPR012543"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFA9"
FT                   /protein_id="AAM79085.1"
FT                   /translation="MTNLEDKLLKGAWGERRLNPEQQRYYLGTYAERVVLSALLDEAQT
FT                   KTVKDYLKRELPSLQLVYQPLHLKISSKLAPQLQILYMKLAKENHLPVTIITETHMTSP
FT                   FAFILHTDHAINLKETRLEVILKQTKNDQLSKQTPEKTKSFWKRFLKK"
FT   gene            527704..529011
FT                   /gene="eno"
FT                   /locus_tag="SpyM3_0479"
FT   CDS             527704..529011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="SpyM3_0479"
FT                   /product="putative enolase"
FT                   /note="best blastp hit: sp|P82479|ENO_STRPY Enolase
FT                   (2-phosphoglycerate dehydratase) (2-phospho-D-glycerate
FT                   hydro-lyase), and gb|AAK33680.1| (AE006524) putative
FT                   enolase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79086"
FT                   /db_xref="GOA:P0DA94"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA94"
FT                   /protein_id="AAM79086.1"
FT                   /translation="MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGE
FT                   HEAVELRDGDKSRYLGLGTQKAVDNVNNIIAEAIIGYDVRDQQAIDRAMIALDGTPNKG
FT                   KLGANAILGVSIAVARAAADYLEVPLYTYLGGFNTKVLPTPMMNIINGGSHSDAPIAFQ
FT                   EFMIMPVGAPTFKEGLRWGAEVFHALKKILKERGLVTAVGDEGGFAPKFEGTEDGVETI
FT                   LKAIEAAGYEAGENGIMIGFDCASSEFYDKERKVYDYTKFEGEGAAVRTSAEQVDYLEE
FT                   LVNKYPIITIEDGMDENDWDGWKVLTERLGKRVQLVGDDFFVTNTEYLARGIKENAANS
FT                   ILIKVNQIGTLTETFEAIEMAKEAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGSL
FT                   SRTDRIAKYNQLLRIEDQLGEVAQYKGIKSFYNLKK"
FT   gene            529573..529734
FT                   /gene="sagA"
FT                   /locus_tag="SpyM3_0480"
FT   CDS             529573..529734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagA"
FT                   /locus_tag="SpyM3_0480"
FT                   /product="streptolysin S associated protein"
FT                   /note="best blastp hit: gi|15674789|ref|NP_268963.1|
FT                   Streptolysin S associated protein [Streptococcus pyogenes]
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79087"
FT                   /db_xref="InterPro:IPR019891"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFA8"
FT                   /protein_id="AAM79087.1"
FT                   /translation="MLKFTSNILATSVAETTQVAPGGCCCCCTTCCFSIATGSGNSQGG
FT                   SGSYTPGK"
FT   gene            529956..530906
FT                   /gene="sagB"
FT                   /locus_tag="SpyM3_0481"
FT   CDS             529956..530906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagB"
FT                   /locus_tag="SpyM3_0481"
FT                   /product="streptolysin S associated protein"
FT                   /note="best blastp hit: gb|AAC25178.1| (AF067649) SagB
FT                   [Streptococcus pyogenes], and gb|AAK33685.1| (AE006526)
FT                   streptolysin S associated ORF [Streptococcus pyogenes
FT                   M1GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79088"
FT                   /db_xref="GOA:Q8K838"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K838"
FT                   /protein_id="AAM79088.1"
FT                   /translation="MSFFTKEKQPKENCPPITVEKARQLFEFNTNHLSLSDYHHQTVLK
FT                   TSKQLVAQHLMPNATDNLSQHFLMNYKANNNYLGFQASIVDFFTDSAVANFSSSYVYES
FT                   QEKIIRLPKPTKISTALSTCIIKRRSHRQFSDRQMPLQDLSNILYYACGVSSQASIRDG
FT                   ASDKITLRNCASGGGLYPIHLVFYARNISKLIDGFYEYLPYQHALRCYRHSSEENVRDF
FT                   AEYGAINAENCNIIIIYVYHYIKNTRKYGNQATAYAFIESGEIAQNIQLTATALTYGSI
FT                   DIGGYNKEYLQELLDLDGLGEHVIHMTLVGTKESQ"
FT   gene            530903..531961
FT                   /gene="sagC"
FT                   /locus_tag="SpyM3_0482"
FT   CDS             530903..531961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagC"
FT                   /locus_tag="SpyM3_0482"
FT                   /product="streptolysin S associated protein"
FT                   /note="best blastp hit: gb|AAC25179.2| (AF067649) SagC
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79089"
FT                   /db_xref="InterPro:IPR019892"
FT                   /db_xref="UniProtKB/TrEMBL:F7IWD6"
FT                   /protein_id="AAM79089.1"
FT                   /translation="MKYQLNSNVRVVTFQDTFCFRKGIWDFNEAILDLTQEPQNLKIVY
FT                   QEIVSQLVKGVAIDTETYENTLEPETFANLMEVISGLYYNDMLMLEDDYNLEENVMKIL
FT                   MGNFRFMAQAGHMVSNDPVLFISDSTYVNESAELLAEQLHLQLQVASDDLKMLIQQTDV
FT                   SSRLDALEHRRNMNCLSDALCDYQSIIICQERLNIMMLRHLNEVSVAMKKQLVIGFVDG
FT                   PFLHACTLNPPHSADFDSLERRVLARLQDSTLYQHFANQILPATQDVSQAYLPLLNVLM
FT                   NLVVSEAFIIAQTGSSKFEGRLLSIYLPTLEIQVQDILKMSNSQTQGALAKLKYEDQQI
FT                   STREIVKKLLDE"
FT   gene            531981..533339
FT                   /locus_tag="SpyM3_0483"
FT   CDS             531981..533339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAL80126.1| (AE010126)
FT                   hypothetical protein [Pyrococcus furiosus DSM 3638]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79090"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFA6"
FT                   /protein_id="AAM79090.1"
FT                   /translation="MLYYYPSFNHIFDELKSLSGNRTGILNQSQVPVCNHPHDVYLKSI
FT                   TGQMPDYHKQFIGELSQVSYHIIGYGSYYEEALIKYLGESIERYATVIAGDLLSDRIVY
FT                   ASYNELKLLHKVMPLEYLQVFTQEQIALSCDLQMMMCDKMVTENDVLGWVKCPMFFEDA
FT                   EMYVPAQMLCVGYKTNETVGERRIIPGFSTGTASHKTLEAAMCNSLIEYIQIDSMMLSW
FT                   YTKKPCPKIIVDDPDIEVILEEARLGKDSLYDIIPIDMTVGEDNPLYTFGIILKNKYDE
FT                   GPYLLFGVQAGLDPKHALLRGIMEASAISYSYYYNLLYQKASLANIECEEPLFLDLDSN
FT                   VFYYAHPKDQDHKWKAFEPLISGEVLLSDLEDHSGKDKKEDLKTLLAYAKKVSPNAVFL
FT                   DITPPEALEKGWYVTRVLMPELLEMCIPAFPFANHPRMRQFGGVTNAFVHPMP"
FT   gene            533314..533985
FT                   /locus_tag="SpyM3_0484"
FT   CDS             533314..533985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0484"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33688.1| (AE006526)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79091"
FT                   /db_xref="GOA:Q8K837"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K837"
FT                   /protein_id="AAM79091.1"
FT                   /translation="MPLSIQCLNLCFLLVTFCPSIPMQAIFGKEDSGYAFNLIGFLRAT
FT                   LIYDILALVSIYVLSPQITLSLESIDSKTFFMGLVFCVLIVLIELIFLHGLRCWQKKQW
FT                   LPATFSFVGTTNDWSKIGYPLLLALFEETIYRFLWFNILAFQWHLPTIIVLIVTSFCYA
FT                   LNHLLMGKSIFYAKLVTGIIYGSIYMLTSQLWLVVIMHVGGNLLVECLSHLQTKKKKEV
FT                   T"
FT   gene            533982..534665
FT                   /locus_tag="SpyM3_0485"
FT   CDS             533982..534665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0485"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33689.1| (AE006526)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79092"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K836"
FT                   /protein_id="AAM79092.1"
FT                   /translation="MMLLVLLSFLGLTTLWLTSYRRRCLARWHLQWLMALSYQDFLDVL
FT                   LSLFQFVVIILVLFFYSATINLGEVLTFLTQTSWHWQILCYLVLYLMAIIEMTLLVLIL
FT                   IFDVLLQKDSRLLFKKITWLPFRQDKPVLSILLLGIVILVDSLFYLGLLILLGEQSLTS
FT                   LATLILGYGIVKACRYSGWLNVLLAFCLFTIVGLWAVTATLLYGWLVGAMILTVTYLMI
FT                   SCKEY"
FT   gene            534688..535611
FT                   /locus_tag="SpyM3_0486"
FT   CDS             534688..535611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0486"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="best blastp hit: gb|AAK33690.1| (AE006526) putative
FT                   ABC transporter (ATP-binding protein)[Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79093"
FT                   /db_xref="GOA:Q7CFA5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFA5"
FT                   /protein_id="AAM79093.1"
FT                   /translation="MSFVQLTNVVKSYKNGKKAVNDVSLSIEAGNIYGLLGPNGAGKST
FT                   LINLILGLIPLSSGKITVLGQSQKTIRKISSQIGYVPQDIAVYPDLTAYENVELFGSLY
FT                   GLKGAQLKKQVLKSLEFVGLHSQAKQFPSQFSGGMKRRLNIACALVHSPKLIIFDEPTV
FT                   GIDPQSRNHILESIRLLNKEGATVIYTTHYMEEVEALCDYIFIMDHGQVIEEGPKFELE
FT                   KRYVANLANQIIVTLTDSRHLELADKPDWSLIEDGEKLMLKIDNSDMTSVVHQLTQANI
FT                   TFSEIRHNHLNLEEIFLHLTGKKLRD"
FT   gene            535620..536747
FT                   /gene="sagH"
FT                   /locus_tag="SpyM3_0487"
FT   CDS             535620..536747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagH"
FT                   /locus_tag="SpyM3_0487"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="steptolysin S associated protein; best blastp hit:
FT                   gb|AAD49330.1|AF163682_1 (AF163682) SagH [Streptococcus
FT                   pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79094"
FT                   /db_xref="GOA:Q8K835"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K835"
FT                   /protein_id="AAM79094.1"
FT                   /translation="MVLFHLIKKESLQIFRNRTALLMMVIFPILMIVILSFAFKSSFNT
FT                   ATTVPKLTIRYQLEGEKTDYQKNFLAFLKVLNQKLHLEAKPSNSLEKDRQRVSEGALTA
FT                   VLEVKKNQTIKVITNNINQQNADLINMLVKNYVDNAKTYDSIAALYPQQLNHIRKRSVD
FT                   YVKVSSIQTSKGMTSADYYAISMFTMITFYSMMSAMNLVLSDRQQRITNRIHLTGVSPS
FT                   LLVFGKLIGAMLATTVQLSLLYIFTRFVLRVNWGTNEWMLIGITASLVYLSVAIGIGLG
FT                   ISIKNEAFLTVASNTIIPIFAFLGGSYVPLTTLHSSIINQLSNISPIKWVNDSLFYLIF
FT                   GGQYNPIPVTLIVNISIGTIFIILSLIGMRKQVTT"
FT   gene            536744..537862
FT                   /locus_tag="SpyM3_0488"
FT   CDS             536744..537862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0488"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="best blastp hit: gb|AAK33692.1| (AE006526) putative
FT                   ABC transporter (ATP-binding protein)[Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79095"
FT                   /db_xref="GOA:Q8K834"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K834"
FT                   /protein_id="AAM79095.1"
FT                   /translation="MICFIKTLFVKIKRKKTSYVTFFLMPILTTLLALSLSFSNNNQAK
FT                   IGILDKDNSQISKQFIAQLKQNKKYDIFTKIKKEHIDHYLQDKSLEAVLTIDKGFSDKV
FT                   LQGKSQKLNIRSIANSEITEWVKAQTNYLLENYNIIGDVALGNEDTFNRILQKNQQLNY
FT                   DVKQVTLTDRSRSKAVSSTTTGFLLILMLGSTSVIYSGILADKSSQLYHRLMLSNLSRF
FT                   RYMLSYVCVGFVAFTIQIVIMLSLLKVFNISFFVPTSLLLIIFFLFSLLAIGFGLLIGA
FT                   ITQNSQQSSQLANLIVMPTSMLAGCLWPLSITPSYMQAIGKLLPQNWVLSAIAIFQSGG
FT                   TLSQAWPYLLALMGTALALIIFSSLLLKPTRL"
FT   gene            538433..541165
FT                   /locus_tag="SpyM3_0489"
FT   CDS             538433..541165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: emb|CAB46409.1| (AL096743)
FT                   putative large secreted protein [Streptomyces coelicolor
FT                   A3(2)]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79096"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K833"
FT                   /protein_id="AAM79096.1"
FT                   /translation="MINKKCIISVSLLTLAITLTSVEEVTSRQNLTYANEIVTQRPKRE
FT                   SVISDKSNFPVISPYLASVDFGERKTPLPTPDKGVKVTTEQSIAQVRKGPEERTYTVTG
FT                   KITSVINGWGGYGFYIQDSEGIGLYVYPQKDLGYSKGDIVQLTGTLTRFKGDLQLQQVT
FT                   AHKKLELSFPTSVKEAVISELETTTPSTLVKLSHVTVGELSTDQYNNTSFLVRDDSGKS
FT                   IVVHIDHRTGVKGADVVTKISQGDLINLTAILSIVDGQLQLRPFSLEQLEVVKKVTSSN
FT                   SDASSRNIVKIGEIQGASHTSPLLKKAVTVEQVVVTYLDDSTHFYVQDLNGDGDLATSD
FT                   GIRVFAKNAKVQVGDVLTISGEVEEFFGRGYEERKQTDLTITQIVAKAVTKTGTAQVPS
FT                   PLVLGKDRIAPANIIDNDGLRVFDPEEDAIDYWESMEGMLVAVDDAKILGPMKNKEIYV
FT                   LPGSSTRPLNNSGGVLLPANSYNTDVIPVLFKKGKQIIKAGDSYKGRLAGPVSYSYGNY
FT                   KVFVDDSKNMPSLMDGHLKPEKTNLQKDLSKLSIASYNIENFSANPSSTKDEKVKRIAE
FT                   SFIHDLNAPDIIGLIEVQDNNGPTDDGTTDATQSAQRLIDAIKKLGGPTYRYVDIAPEN
FT                   NVDGGQPGGNIRTGFLYQPERVSLSDKPKGGARDALTWVNGELNLSVGRIDPTNVAWKD
FT                   VRKSLAAEFIFQGRKVVVVANHLNSKRGDNALYGRVQPVTFKSEQRRHVLANMLAQFAK
FT                   EGAKHQANIVMLGDFNDFEFTKTIQLIEEGDMVNLVSRHDISDRYSYFHQGNNQTLDNI
FT                   LVSRHLLDHYEFDMVHVNSPFMEAHGRASDHDPLLLQLSFSKENDKAESSKQSVKAKKT
FT                   SKGKLLPKTGDSLVYVITLLGTASLLVPILLLTKGKKES"
FT   gene            541443..541943
FT                   /locus_tag="SpyM3_0490"
FT   CDS             541443..541943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75128.1| (AE007404)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79097"
FT                   /db_xref="GOA:Q8K832"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K832"
FT                   /protein_id="AAM79097.1"
FT                   /translation="MTKLTVHDYVHIGLVAALYVVLTITPPLNAISYGMYQFRISEMMN
FT                   FLAFYHRKYIIAVTLGCMIANFYSFGLIDVFVGGGSTLIFVTLGVILFSKYQKYYLFNG
FT                   IFNKAFVYFSFFFATSMFTVAIELYFFGAPFLLTWFITALGELVSLLIGSLIIDKLSQR
FT                   ISF"
FT   gene            542138..544096
FT                   /gene="lig"
FT                   /locus_tag="SpyM3_0491"
FT   CDS             542138..544096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /locus_tag="SpyM3_0491"
FT                   /product="putative DNA ligase"
FT                   /note="best blastp hit: gb|AAK33695.1| (AE006527) putative
FT                   DNA ligase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79098"
FT                   /db_xref="GOA:P0DA72"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA72"
FT                   /protein_id="AAM79098.1"
FT                   /translation="MKKRIKELTDLLNRYRYDYYTKDAPSVSDSDYDKLYRELVTLEQS
FT                   YPEYVLQDSPTQQVGGTILKGFEKYRHQYPLFSLQDAFSREELDAFDKRVKAEFPNATY
FT                   LAELKIDGLSISLSYENGFLQVGATRGDGNIGENITENIKKIKDIPHQLSEPLTITVRG
FT                   EAYMSRQSFKAINEGRQENGETEFANPRNAAAGTLRQLDTAVVAKRQLATFLYQEVSPT
FT                   ARNQQNEVLAELADLGFSVNPYYQLTSSMDEIWDFIKTIEAKRDQLAYDIDGVVIKVNS
FT                   LAMQEELGFTVKAPRWAIAYKFPAEEKEAEILSVDWTVGRTGVVTPTANLTPVQLAGTT
FT                   VSRATLHNVDYIAEKDIRIGDTVIVYKAGDIIPAVLNVVMSKRNQQEVMLIPKLCPSCG
FT                   SELVHFEDEVALRCINPLCPSLIQRSLEHFASRDAMNITGLGPAIVEKLFLAGFVHDVA
FT                   DIYQLTKEDFMQLDGIKEKSADKLLAAIEASKSNSAEKLLFGLGIRHIGSKVSRLILEV
FT                   YGDISALLTAKEEEIARIDGLGSTIAQSLTQYFEQKTAAILVDELKTAGVNMHYSGQKV
FT                   NSDAALFGLTVVLTGKLNQLNRNEAKDKLEALGAKVTGSVSKKTDLVIAGSDAGSKLEK
FT                   AKSLGIRIEDEDWLRQL"
FT   gene            544167..545132
FT                   /locus_tag="SpyM3_0492"
FT   CDS             544167..545132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0492"
FT                   /product="putative transcriptional regulator"
FT                   /note="best non-GAS blastp hit: gb|AAK04518.1|AE006278_9
FT                   (AE006278) transcriptional regulator [Lactococcus lactis
FT                   subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79099"
FT                   /db_xref="GOA:Q8K830"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K830"
FT                   /protein_id="AAM79099.1"
FT                   /translation="MRKSVPEVLDILEGFGYETSAFQTTAQKNSALNEARRAAKAGFDL
FT                   LIAAGGDGTINEVVNGIAPLKKRPKMAIIPTGTTNDFARALKVPRGNPSQAAKLIGKNQ
FT                   TIQMDIGRAKKDTYFINIAAAGSLTELTYSVPSQLKTMFGYLAYLAKGVELLPRVSNVP
FT                   VKITHDKGVFEGQVSMIFAAITNSVGGFEMIAPDAKLDDGMFTLILIKTANLFEIVHLL
FT                   RLILDGGKHITDRRVEYIKTSKIVIEPQCGKRMMINLDGEYGGDAPITLENLKNHITFF
FT                   ADTDLISDDALVLDQDELEIEEIVKKFAHEVEDLEQELEE"
FT   gene            545524..545721
FT                   /locus_tag="SpyM3_0493"
FT   CDS             545524..545721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0493"
FT                   /product="putative H+-transporting ATP synthase chain C"
FT                   /note="best blastp hit: gb|AAK33697.1| (AE006527)
FT                   H+-transporting ATP synthase chain C [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79100"
FT                   /db_xref="GOA:Q7CFA4"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFA4"
FT                   /protein_id="AAM79100.1"
FT                   /translation="MNPIFALALACFGVSLAEGFLMANLFKAASRQPEIIGQLRSLMIL
FT                   GVAFIEGTFFVTLVMAFILK"
FT   gene            545756..546472
FT                   /locus_tag="SpyM3_0494"
FT   CDS             545756..546472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0494"
FT                   /product="putative proton-translocating ATPase subunit a"
FT                   /note="best blastp hit: gb|AAK33698.1| (AE006527) putative
FT                   proton-translocating ATPase subunit a [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79101"
FT                   /db_xref="GOA:P0CZ90"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CZ90"
FT                   /protein_id="AAM79101.1"
FT                   /translation="MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLK
FT                   PEGKQTALEYLISFVDGIGEEHLDHNLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNG
FT                   YNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLVAHLKRLATPWPMTPMNLLEEFTN
FT                   FLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFSVFISCIQAFVFT
FT                   KLTATYLGKKVNESEE"
FT   gene            546490..546984
FT                   /locus_tag="SpyM3_0495"
FT   CDS             546490..546984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0495"
FT                   /product="putative putative proton-translocating ATPase
FT                   subunit b"
FT                   /note="best blastp hit: gb|AAK33699.1| (AE006527) putative
FT                   proton-translocating ATPase, subunit b [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79102"
FT                   /db_xref="GOA:P0CZ92"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CZ92"
FT                   /protein_id="AAM79102.1"
FT                   /translation="MSITFGELVGNFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQI
FT                   SRDIDQAEQSRLSAQQLEAKSQANLDASRSQASKIISDAKEIGQLQGDKLVAEATDEAK
FT                   RLKEKALTDIEQSKSDAISAVKTEMSDLTVLLAKKIMGANLDKTAQSQLIDSYLDDLGE
FT                   A"
FT   gene            546984..547520
FT                   /locus_tag="SpyM3_0496"
FT   CDS             546984..547520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0496"
FT                   /product="putative proton-translocating ATPase delta
FT                   subunit"
FT                   /note="best blastp hit: gb|AAK33700.1| (AE006527) putative
FT                   proton-translocating ATPase, delta subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79103"
FT                   /db_xref="GOA:P0CZ94"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CZ94"
FT                   /protein_id="AAM79103.1"
FT                   /translation="MTKKEQALIEQYGKSLVEVASEHHSLDTLQADVLAILETFETTNL
FT                   DQSLSSLAVPHAEKIKLLTLLKGNNSVYMNNFLNLILQNEREAYLYQMLQAVLNEIAIV
FT                   SNQYDVTVTSSLPLTEEQKSRVRAVVAKKFAVTAGRLIEKVDPSLIGGFIISVNNKVID
FT                   TSIRRQLQAFKMNLK"
FT   gene            547536..549044
FT                   /locus_tag="SpyM3_0497"
FT   CDS             547536..549044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0497"
FT                   /product="putative putative proton-translocating ATPase
FT                   alpha subunit"
FT                   /note="best blastp hit: gb|AAK33701.1| (AE006527) putative
FT                   proton-translocating ATPase, alpha subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79104"
FT                   /db_xref="GOA:P0DA02"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA02"
FT                   /protein_id="AAM79104.1"
FT                   /translation="MAINAQEISALIKKQIENFQPNFDVTETGIVTYIGDGIARARGLD
FT                   NAMSGELLEFENGAYGMAQNLESNDVGIIILGDFSAIREGDVVKRTGKIMEVPVGEALI
FT                   GRVVNPLGQPVDGLGDIETTGFRPVETPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQ
FT                   RELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRRYGALDYTI
FT                   VVTASASQPSPLLFIAPYAGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERSAKVSDDLGGGSITALPFIETQAGDISAYIATNVISITDG
FT                   QIFLQENLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFG
FT                   SDLDAATQAKLNRGRRTVEILKQPLHKPLPVEKQVVILYALTHGFLDDVPVDDILAFEE
FT                   ALYDYFDVHYNDLFETIRTTKDLPEEAALDAAIKAFKEHSNFKS"
FT   gene            549060..549935
FT                   /locus_tag="SpyM3_0498"
FT   CDS             549060..549935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0498"
FT                   /product="putative proton-translocating ATPase gamma
FT                   subunit"
FT                   /note="best blastp hit: gb|AAK33702.1| (AE006527) putative
FT                   proton-translocating ATPase, gamma subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79105"
FT                   /db_xref="GOA:P0CZ98"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR023633"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CZ98"
FT                   /protein_id="AAM79105.1"
FT                   /translation="MAGSLSEIKAKIISTEKTSKITSAMRMVSSAKLVRSEQAARDFQI
FT                   YASKIRQITTDLLKSELTIGSDNPMLVSRPVKKTGYIVITSDKGLVGGYNSKILKSVMD
FT                   MITEYHADGDYEIISIGSVGSDFFKARGMNVAFELRGLADQPSFEQVRQIISQSVDMFV
FT                   NEIFDELYVCYNHHVNSLTSQVRVQQMLPISDLVADEAAEEGVTGFELEPNRHDILDQL
FT                   LPQFTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAITQEIT
FT                   EIVAGANALE"
FT   gene            550097..551503
FT                   /locus_tag="SpyM3_0499"
FT   CDS             550097..551503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0499"
FT                   /product="putative proton-translocating ATPase beta
FT                   subunit"
FT                   /note="best blastp hit: gb|AAK33703.1| (AE006527) putative
FT                   proton-translocating ATPase, beta subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79106"
FT                   /db_xref="GOA:P0DA04"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA04"
FT                   /protein_id="AAM79106.1"
FT                   /translation="MSSGKIAQVVGPVVDVMFASGDKLPEINNALIVYKDSDKKQKIVL
FT                   EVALELGDGMVRTIAMESTDGLTRGLEVLDTGRAISVPVGKETLGRVFNVLGETIDLEE
FT                   PFAEDVDRQPIHKKAPSFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTV
FT                   LIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGAR
FT                   MRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATE
FT                   MGQLQERITSTQKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPA
FT                   VDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGR
FT                   ARRIQFFLSQNFNVAEQFTGLPGSYVPVAETVRGFKEILEGKYDDLPEDAFRSVGPIED
FT                   VIKKAEKMGF"
FT   gene            551516..551932
FT                   /locus_tag="SpyM3_0500"
FT   CDS             551516..551932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0500"
FT                   /product="putative proton-translocating ATPase epsilon
FT                   subunit"
FT                   /note="best blastp hit: gb|AAK33704.1| (AE006527) putative
FT                   proton-translocating ATPase, epsilon subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79107"
FT                   /db_xref="GOA:P0CZ96"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CZ96"
FT                   /protein_id="AAM79107.1"
FT                   /translation="MTQMTVQVVTPDGIKYDHHAKCISVTTPDGEMGILPNHINLIAPL
FT                   QVHEMKIRRGGEDEKVDWIAINGGIIEIKDNVVTVVADSAERDRDIDVSRAERAKLRAE
FT                   REIAQAETTHNIDEVRRAKVALRRALNRINVSKK"
FT   gene            552198..552455
FT                   /locus_tag="SpyM3_0501"
FT   CDS             552198..552455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0501"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33705.1| (AE006528)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79108"
FT                   /db_xref="InterPro:IPR009526"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFA1"
FT                   /protein_id="AAM79108.1"
FT                   /translation="MVCYNNPMELLMKIIAFSCHLFFIGLSYQLLISVIDWTKFSHYHP
FT                   ENLGRLRLFVFLLATALGYLVSHCMLELLQISQTLFFEFR"
FT   gene            552520..553791
FT                   /gene="murA"
FT                   /locus_tag="SpyM3_0502"
FT   CDS             552520..553791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="SpyM3_0502"
FT                   /product="putative UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="best blastp hit: gb|AAK33706.1| (AE006528) putative
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79109"
FT                   /db_xref="GOA:P0DC44"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC44"
FT                   /protein_id="AAM79109.1"
FT                   /translation="MDKIIIEGGQTRLEGEVVIEGAKNAVLPLLAASILPSKGKTILRN
FT                   VPILSDVFTMNNVVRGLDIRVDFNEAANEITVDASGHILDEAPYEYVSQMRASIVVLGP
FT                   ILARNGHAKVSMPGGCTIGSRPINLHLKGLEAMGATITQKGGDITAQADRLQGAMIYMD
FT                   FPSVGATQNLMMAATLADGVTTIENAAREPEIVDLAQFLNKMGARIRGAGTETLTITGV
FT                   TSLHGVEHDVVQDRIEAGTFMVAAAMTSGNVLIRDAVWEHNRPLISKLMEMGVSVTEEE
FT                   YGIRVQANTPKLKPVTVKTLPHPGFPTDMQAQFTALMAVVNGESTMVETVFENRFQHLE
FT                   EMRRMGLQSEILRETAMIHGGRQLQGAPVMSTDLRASAALILTGIVAQGVTIVNNLVHL
FT                   DRGYYQFHEKLAKLGATISRSSEV"
FT   gene            553795..553983
FT                   /locus_tag="SpyM3_0503"
FT   CDS             553795..553983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0503"
FT                   /product="putative competence associated hypothetical
FT                   protein"
FT                   /note="best blastp hit: gb|AAK33707.1| (AE006528) conserved
FT                   competence associated hypothetical protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79110"
FT                   /db_xref="InterPro:IPR024596"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K824"
FT                   /protein_id="AAM79110.1"
FT                   /translation="MTNGLKYVLEQMLLLLVIAALACLFLAIGLMIGYSFMGDGHSPWH
FT                   ILSMDKWAELVNKFTGK"
FT   gene            554019..554883
FT                   /gene="endA"
FT                   /locus_tag="SpyM3_0504"
FT   CDS             554019..554597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="endA"
FT                   /locus_tag="SpyM3_0504"
FT                   /product="putative DNA-entry nuclease"
FT                   /note="best blastp hit: gb|AAK76031.1| (AE007486) DNA-entry
FT                   nuclease [Streptococcus pneumoniae TIGR4], and
FT                   gb|AAL00582.1| (AE008543) DNA-entry nuclease
FT                   (competence-specific nuclease) [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79111"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K823"
FT                   /protein_id="AAM79111.1"
FT                   /translation="MLTRKKRKRMLNSFLLILLVLGSNSLAKSDFIASTHPIKQLYQTL
FT                   VGEKKKSLLTHNNLPADVPTEALAASVLTPSIKKQLGPDVQWNGAGAYIINRNKTDLTA
FT                   KVASPPYANNETKWVQEQKVPTRANALLTKSTRQYQNRYQTNNAYRTFKPAGWHRLHHL
FT                   KGSYDHAVDRGHLLGYALVGGLKGFDAYQ"
FT   gene            554584..554883
FT                   /gene="endA"
FT                   /locus_tag="SpyM3_0505"
FT   CDS             554584..554883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="endA"
FT                   /locus_tag="SpyM3_0505"
FT                   /product="putative DNA-entry nuclease"
FT                   /note="best blastp hit: gb|AAK76031.1| (AE007486) DNA-entry
FT                   nuclease [Streptococcus pneumoniae TIGR4], and
FT                   gb|AAL00582.1| (AE008543) DNA-entry nuclease
FT                   (competence-specific nuclease) [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79112"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K822"
FT                   /protein_id="AAM79112.1"
FT                   /translation="MLTSNPDNIATQLSWANQVNKPYSTGQNYYEGLVRRALDKGHRVR
FT                   YRVTLLYDGDNLLASGSHLEAKSSDDSLTFNVFVPNVQPGLTVDYRTGQIAINL"
FT   gene            555166..556209
FT                   /gene="pheS"
FT                   /locus_tag="SpyM3_0506"
FT   CDS             555166..556209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="SpyM3_0506"
FT                   /product="putative phenylalanyl-tRNA synthetase alpha
FT                   subunit"
FT                   /note="best blastp hit: gb|AAK33709.1| (AE006528) putative
FT                   phenylalanyl-tRNA synthetase (alpha subunit) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79113"
FT                   /db_xref="GOA:P0DG50"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG50"
FT                   /protein_id="AAM79113.1"
FT                   /translation="MDLQAQLEELKTKTLETLQSLTGNHTKELQDLRVAVLGKKGSLTE
FT                   LLKGLKDLSNDLRPVVGKQVNEVRDLLTKAFEEQAKIVEAAKIQAQLDAESIDVTLPGR
FT                   QMTLGHRHVLTQTSEEIEDIFLGMGFQIVDGFEVEKDYYNFERMNLPKDHPARDMQDTF
FT                   YITEEILLRTHTSPVQARTLDQHDFSKGPLKMVSPGRVFRRDTDDATHSHQFHQIEGLV
FT                   VGKNISMGDLKGTLEMIIKKMFGEERSIRLRPSYFPFTEPSVEVDVSCFKCGGKGCNVC
FT                   KKTGWIEILGAGMVHPSVLEMSGVDAKEYSGFAFGLGQERIAMLRYGINDIRGFYQGDQ
FT                   RFSEQFN"
FT   gene            556464..558824
FT                   /gene="pheT"
FT                   /locus_tag="SpyM3_0507"
FT   CDS             556464..558824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="SpyM3_0507"
FT                   /product="putative phenylalanyl-tRNA synthetase beta
FT                   subunit"
FT                   /note="best blastp hit: gb|AAK33710.1| (AE006528)
FT                   phenylalanyl-tRNA synthetase (beta subunit) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79114"
FT                   /db_xref="GOA:P0DG52"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG52"
FT                   /protein_id="AAM79114.1"
FT                   /translation="MTPAALAEKMSTTGIEVEGIEVPAEGLSKLVVGHVLSCEDVPETH
FT                   LHLCQVDTGDETPRQIVCGAPNVKAGIKVIVAVPGARIADNYKIKKGKIRGMESLGMIC
FT                   SLQELGLSDSIIPKEFSDGIQILPDEAVPGDAIFKYLDLDDHIIELSITPNRADALSMR
FT                   GVAHEVAAIYGKSVSFPEKNLQESDKATSEAIEVAIASDNVLTYASRVVENVKVKPSPQ
FT                   WLQNLLMNAGIRPINNVVDVTNYVLLYFGQPMHAFDYDKFEDHKIVTRAARQGESLVTL
FT                   DGEKRELTTEDLVITVADKPVALAGVMGGQATEIDANSQTVVLEAAVFDGKSIRKTSGR
FT                   LNLRSESSSRFEKGVNYATVLEALDFAAAMLQELAEGQVLSGHVQAGQLSTEPVEVSTN
FT                   LDYVNVRLGTELTFADIQRIFNQLGFGLTGDETRFTVAVPRRRWDISIPADLVEEIARI
FT                   YGYDKLPTTLPEAGGTAAELTPTQALRRKVRGLAEGLGLTEIISYALTTPEKAIEFAVA
FT                   PSHLTELMWPMSVERSALRQNMVSGMLDTVAYNVARKQSNLALYEIGKIFEQEVNPKED
FT                   LPNEVNHFAFTICGLVAQKDFQTQAQAVDFYHAKGILDTLFANLNLKVQYVPTKDLANM
FT                   HPGRTALILLDEQVIGFVGQVHPGTAKAYSIPETYVAELDMAALEAALPSDQTFAEITK
FT                   FPAMTRDIALLLDREVSHQAIVTAIESAGVKRLTKIKLFDVYEGATIQAGKKSMAYSLT
FT                   FQNPNDNLTDEEVAKYMEKITKALTEQVGAEVR"
FT   gene            558934..559311
FT                   /locus_tag="SpyM3_0508"
FT   CDS             558934..559311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0508"
FT                   /product="hypothetical protein"
FT                   /note="best blastp hit: gb|AAK33711.1| (AE006528)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79115"
FT                   /db_xref="GOA:Q8K819"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K819"
FT                   /protein_id="AAM79115.1"
FT                   /translation="MYQTKITGNRLYHTVSKGYGDSVTLFGKTDQGETPMSLLVIALSS
FT                   CVTMCVQVFYHRQFQQDTLAVSVEASYEEEVFELLVRIDDVLDDKKKADLLAYIGTYCR
FT                   VKQLLKPEVTVTITLEGLSHV"
FT   gene            559304..559690
FT                   /locus_tag="SpyM3_0509"
FT   CDS             559304..559690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: dbj|BAB43470.1| (AP003137)
FT                   hypothetical protein [Staphylococcus aureus subsp. aureus
FT                   N315]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79116"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="InterPro:IPR016996"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CFA0"
FT                   /protein_id="AAM79116.1"
FT                   /translation="MSDASLKTYQKQWAYQKYWVMAHSQQHYNALRELFKGNQWSEEKV
FT                   LTFHCLIEEAQAIPPTVKSLRTAYQHVWGYFKKVASQEEKDHFKDLDAQLETKSEEMLC
FT                   FLQEMTAHYQPSYLLSCRLITKGP"
FT   gene            559763..560839
FT                   /locus_tag="SpyM3_0510"
FT   CDS             559763..560839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK06353.1|AE006454_6
FT                   (AE006454) hypothetical protein [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79117"
FT                   /db_xref="GOA:Q8K818"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K818"
FT                   /protein_id="AAM79117.1"
FT                   /translation="MFLALNEMKQSKLRYGLIAGLLCLVAYLMFFLSGLAFGLMQENRS
FT                   AVDLWKADSVLLAKDADATLTLSQVSRAQENQITADKVAPLAQLNTVAWSVKNPKDADK
FT                   VKVSLFGIDSNSFIRPNIVKGRLFKTNKEVVLDQSLAKEEAFAIGKDFYTSSSSQALTI
FT                   VGYTQNARFSVAPVVYMNLEAFETLKYGEPLPKDKQVVNAFITKGSLIDYPKKDFQKLD
FT                   IKTFITKLPGYSAQLLTFGFMISFLVIISAIIIGIFMYILTIQKAPIFGIMKAQGISNK
FT                   TITTAVLMQTFFLSFLGSGLGLLGTWLTSLLLPTVVPFQSNWFLYLAIFVSMICFALLG
FT                   TLFSVFNIIRIDPLKAIG"
FT   gene            560849..561517
FT                   /locus_tag="SpyM3_0511"
FT   CDS             560849..561517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0511"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="best blastp hit: gb|AAK33714.1| (AE006528) putative
FT                   ABC transporter (ATP-binding protein)[Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79118"
FT                   /db_xref="GOA:F7IW06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F7IW06"
FT                   /protein_id="AAM79118.1"
FT                   /translation="MSVLTFKQVTKTFQDGHHEINALKATDFSIEAGEFVAIIGPSGSG
FT                   KSTFLTIAGGLQTPSSGQLIIDGTDYTHLSEKERSRLRFKSVGFILQASNLIPFLTVQQ
FT                   QLELVDHLTGSKEKAKANQLFDDLGITGLKHQLPQELSGGERQRAAIARALYHDPALIL
FT                   ADEPTASLDTEKAYEVVKLLAKESKEKNKAIIMVTHDDRMLEYCDKVYRMQDGELRQER
FT                   "
FT   gene            complement(561622..562374)
FT                   /locus_tag="SpyM3_0512"
FT   CDS             complement(561622..562374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK87920.1| (AE008134)
FT                   AGR_C_3948p [Agrobacterium tumefaciens str. C58 (Cereon)],
FT                   and gb|AAL43164.1| (AE009168) conserved hypothetical
FT                   protein [Agrobacteriumtumefaciens str. C58 (U.
FT                   Washington)]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79119"
FT                   /db_xref="GOA:Q8K817"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K817"
FT                   /protein_id="AAM79119.1"
FT                   /translation="MGGGGLSGVLGGKPSSTNNNAYQSSQVTRTNGDKASQEQVSFVSK
FT                   VFASTEDYWTKTFREKGLTYHKPTLVLYTGATQTACGRGQASSGPFYCPGDQKVYLDIS
FT                   FYNELSTKYGAKGDFAMAYVIAHEVGHHIQNELGIMDNYASARQGKSKAKANQLNVKLE
FT                   LQADYYAGAWANYVQGQGLLEKGDIEEAMAAAHAVGDDTLQEETYGRTVPDSFTHGTSK
FT                   QRQRWFDRGYQYGDFEHGDTFSIPYSKL"
FT   gene            562689..565904
FT                   /gene="rexB"
FT                   /locus_tag="SpyM3_0513"
FT   CDS             562689..565904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rexB"
FT                   /locus_tag="SpyM3_0513"
FT                   /product="putative ATP-dependent exonuclease subunit B"
FT                   /note="best blastp hit:gb|AAK75260.1| (AE007415)
FT                   exonuclease RexB [Streptococcus pneumoniae TIGR4], and
FT                   gb|AAK99843.1| (AE008476) Second subunit of major
FT                   exonuclease [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79120"
FT                   /db_xref="GOA:P0CZ54"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014141"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CZ54"
FT                   /protein_id="AAM79120.1"
FT                   /translation="MKLIYTEMSYSMTEILVNEARKAADQGYRVFYIAPNSLSFEKERE
FT                   VLTLLPERGTFSIIVTRFVQMSRYFTVESSPSKQHLDDTTLAMIFYRALMQLKPEDLPS
FT                   YGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDHPQKQEDLIKIIELAETIMIQQDY
FT                   NQDSPLQSFARAIKLGLLNNQLSKTVVVIDGFSRFSAEEDYLLSLLNNNCQEVIIGSYV
FT                   SQKAYQKSFIKGNIYEASLHFLQDLAQKYHIKPVFATSNQVFKPAFSRLTQLFEATHDF
FT                   SQVDWQLQKNDLDHFSLWQCHHQKEEIEHVAKSIRQKLYEGYRYKDILVLLGDMDAYQL
FT                   QIGPIFDKFEIPYYLGKAEPMAAHPLVQFIESLERSQRYNWRREDILNMLKSGLFGCFD
FT                   DSDIDRFEEYTQFADIKGFTKFSKPFTINSSRQYPLDFLNEMRQDIVLPLQELFKSQKQ
FT                   LGASLVDKLILFLKKIRLAENMQGLAQSQLEVEKNEEVWKRFTDILTSFHHIFGQEKLR
FT                   LSDCLALIKTGMKSAQYRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHH
FT                   SGLLSDQERARINEIRNYRHFDIASAENSKKNHQTALSLFNAATKELVLSVPTVINETF
FT                   DDLSPYLKELINFGLPLLDKGKNYLSYDNSDIGNYKALLSQIIAINRQDLIEMSDQDKM
FT                   FWTVVLRYLRKQLRKQQLELPTSDYRLSTKSLSKEVIEVCFPKRIPLKLSATALTVFYN
FT                   NQYNYFLKYVLNLNKTESIHPDSRIHGQYLHRVFERLMKDHTQEPFDNKLKQAIYHTNQ
FT                   ESFFQQIYQDNAEAEYSLAILEDIVRSTAPILQLNQNIQVIDQEKNFHLDMGNEILVHG
FT                   IIDRIDQLSDGSLGIVDYKSSANQFDIGTFYNGLSPQLVTYLAALKQITPHDINQLFGA
FT                   MYLHLQDPKLDLVTFKQIDNTLVESIYKALTYKGIFSEVEKEHLSTGAYQTKNALYSND
FT                   ELETLLNYNRYLYLKAAKHIKKGHFLINPYTSDGKTVQGDQLKAITRFEADLDMGQARR
FT                   LVTLPAKEKKECFLTLMRKESHL"
FT   gene            565865..569533
FT                   /gene="rexA"
FT                   /locus_tag="SpyM3_0514"
FT   CDS             565865..569533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rexA"
FT                   /locus_tag="SpyM3_0514"
FT                   /product="putative ATP-dependent exonuclease subunit A"
FT                   /note="best non-GAS blastp hit: gb|AAK75261.1| (AE007415)
FT                   exonuclease RexA [Streptococcus pneumoniae TIGR4], and
FT                   gb|AAK99844.1| (AE008476) First subunit of major
FT                   exonuclease [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79121"
FT                   /db_xref="GOA:P0CZ52"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CZ52"
FT                   /protein_id="AAM79121.1"
FT                   /translation="MLFNINEKGEPLVISFAPFLSPEAIKHLQENERYSDQSQKRTAQQ
FT                   IEAIYTSGQNILVSASAGSGKTFVMVERILDKILRGVSIDRLFISTFTVKAATELRERI
FT                   ENKLYSQIAQTTDFQMKVYLTEQLQSLCQADIGTMDAFAQKVVSRYGYSIGISSQFRIM
FT                   QDKAEQDVLKQEVFSKLFSEFMNQKEAPAFRALVKNFSGNCKDTSAFRELVYTCYSFSQ
FT                   STENPKIWLQENFLSAAKTYQRLEDIPDHDIELLLLAMQDTANQLRDVTDMEDYGQLTK
FT                   AGSRSAKYTKHLTIIEKLSDWVRDFKCLYGKAGLDRLIRDVTDLIPSGNDVTVSKVKYP
FT                   VFKTLHQKLKQFRHLETILMYQKDCFPLLEQLQDFVFAFSEAYLAVKIQESAFEFSDIA
FT                   HFAIKILEENTDIRQSYQQHYHEVMVDEYQDNNHMQERLLTLLSNGHNRFMVGDIKQSI
FT                   YRFRQADPQIFNQKFRDYQKKPEQGKVILLKENFRSQSEVLNVSNAVFSHLMDESVGDV
FT                   LYDEQHQLIAGSHAQTVPYLDRRAQLLLYNSDKDDGNAPSDSEGISFSEVTIVAKEIIK
FT                   LHNDKGVPFEDITLLVSSRTRNDIISHTFNQYGIPIVTDGGQQNYLKSVEVMVMLDTLR
FT                   TINNPRNDYALVALLRSPMFAFDEDDLARIALQKDNELDKDCLYDKMQRAVIGRGAHPE
FT                   LIHDTLLGKLNVFLKTLKSWRRYAKLGSLYDLIWKIFNDRFYFDFVASQAKAEQAQANL
FT                   YALALRANQFEKSGYKGLYRFIKMIDKVLETQNDLADVEVAAPKQAVNLMTIHKSKGLQ
FT                   FPYVFILNCDKRFSMTDIHKSFILNRQHGIGIKYLADIKGLLGETTLNSVKVSMETLPY
FT                   QLNKQELRLATLSEQMRLLYVAMTRAEKKVYFIGKASKSKSQEITDPKKLGKLLPLALR
FT                   EQLLTFQDWLLAIADIFSTEDLYFDVRFIEDSDLTQESVGRLQTPQLLNPDDLKDNRQS
FT                   ETIARALDMLEAVSQLNANYEAAIHLPTVRTPSQLKAAYEPLLEPIGVDIIEKSSRSLS
FT                   DFTLPHFSKKAKVEASHIGSALHQLMQVLPLSKPINQQTLLDALRGIDSNEEVKTALDL
FT                   KKIESFFCDTSLGQFFQTYQKHLYREAPFAILKVDPISQEEYVLRGIIDAYFLFDDHIV
FT                   LVDYKTDKYKQPIELKKRYQQQLELYAEALTQTYKLPVTKRYLVLMGGGKPEIVEV"
FT   gene            569673..570485
FT                   /locus_tag="SpyM3_0515"
FT   CDS             569673..570485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0515"
FT                   /product="putative ABC transporter"
FT                   /note="substrate-binding protein; best blastp hit:
FT                   gb|AAK33718.1| (AE006529) putative ABC transporter
FT                   substrate-binding protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79122"
FT                   /db_xref="GOA:Q8K814"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K814"
FT                   /protein_id="AAM79122.1"
FT                   /translation="MNFKKIRFGFLLCLLLYLLAACNKSEQLNHYERIKKTRKLVVAVS
FT                   PDYAPFEFKALVNGKDTIVGADVQLAQAIADELDVDLELSPMSFDNVLSSLQTGKADLA
FT                   ISGISHTKERAKVYDFSIPYYQAENAIVMRASDAKVTKNISDLNGKKVAAQKGSIEEGL
FT                   VKIQLPKANLISLTAMGEAINELKAGQVYAVTLEAPVAAGFLAQHKDLALAPFSLKTSD
FT                   GDAKAVALPKNSGDLTKAVNKVIAKLDEQERYKSFIAETIALTKNTMK"
FT   gene            570626..570802
FT                   /gene="rpsU"
FT                   /locus_tag="SpyM3_0516"
FT   CDS             570626..570802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="SpyM3_0516"
FT                   /product="30S ribosomal protein S21"
FT                   /note="best blastp hit: gb|AAK33719.1| (AE006529) 30S
FT                   ribosomal protein S21 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79123"
FT                   /db_xref="GOA:P0DE86"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE86"
FT                   /protein_id="AAM79123.1"
FT                   /translation="MSKTVVRKNESLDDALRRFKRSVTKAGTLQESRKREFYEKPSVKR
FT                   KRKSEAARKRKKF"
FT   gene            complement(570930..571292)
FT                   /gene="mscL"
FT                   /locus_tag="SpyM3_0517"
FT   CDS             complement(570930..571292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="SpyM3_0517"
FT                   /product="putative large conductance mechanosensitive
FT                   channel"
FT                   /note="best blastp hit: gb|AAK33720.1| (AE006529) putative
FT                   large conductance mechanosensitive channel [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79124"
FT                   /db_xref="GOA:Q8K813"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR029027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K813"
FT                   /protein_id="AAM79124.1"
FT                   /translation="MVKELKAFLFRGNIIELAVAVIIGGAFGAIVTSFVNDIITPLILN
FT                   PALKAANVENITQLSWNGVKYGNFLGAVINFLIIGTSLFFVVKAAEKAMPKKEKEAAAP
FT                   TQEELLTEIRDLLAQK"
FT   gene            571467..573236
FT                   /gene="dnaG"
FT                   /locus_tag="SpyM3_0518"
FT   CDS             571467..573236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="SpyM3_0518"
FT                   /product="putative DNA primase"
FT                   /note="best blastp hit: gb|AAK33721.1| (AE006529) putative
FT                   DNA primase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79125"
FT                   /db_xref="GOA:Q8K812"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K812"
FT                   /protein_id="AAM79125.1"
FT                   /translation="MISQVKNSVNIVDVIGEVVKLSRSGRHYLGLCPFHKEKTPSFNVV
FT                   EDRQFFHCFGCGKSGDVFKFIEEYRQVPFLESVQIIADKTGMSLNISPSQAVIASQHKH
FT                   PNHALMTLHEDAAKFYHAVLMTTTIGQEARKYLYQRGLDDQLIEHFNIGLAPDESDYLY
FT                   QALSKKYEEGQLVASGLFNLSDQSNTIYDAFRNRIMFPLSDDRGHIIAFSGRIWTAADT
FT                   EKRQAKYKNSRGTVLFNKSYELYHLDKARPVIAKTHEVFLMEGFMDVIAAYRSGYENAV
FT                   ASMGTALTQEHVNHLKQVTKKVVLIYDGDDAGQHAIAKSLELLKDFVVEIVRIPNKMDP
FT                   DEFVQRHSPEAFADLLKQSRISSVEFFIDYLKPTNVDNLQSQIVYVEKMAPLIAQSPSI
FT                   TAQHSYINKIADLLPNFDYFQVEQSVNALRIQDRQKRQGQIAQAVSNLVTLPMPKSLTA
FT                   IAKTESHLMHRLLHHDYLLNEFRHRDDFYFDTSTLELLYQRLKQQGHITSYDLSEMSEE
FT                   VNRAYYNVLEENLPKEVALGEIDDILSKRAKLLAERDLHKQGKKVRESSNKGYHQAALE
FT                   VLEHFIAQKRKME"
FT   gene            573245..574354
FT                   /gene="rpoD"
FT                   /locus_tag="SpyM3_0519"
FT   CDS             573245..574354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="SpyM3_0519"
FT                   /product="putative RNA polymerase sigma 42 protein RpoD"
FT                   /note="best blastp hit: gb|AAK33722.1| (AE006529) putative
FT                   RNA polymerase sigma 42 protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79126"
FT                   /db_xref="GOA:Q8K811"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K811"
FT                   /protein_id="AAM79126.1"
FT                   /translation="MTKQKEITTFNVQVAEFIRYHKKEGTAIDDDVTEKLVIPFALDAD
FT                   QIDDLLERLTDGGISITDKEGNPSSKYIVEELKPEELTDEELIGSNSAKVNDPVRMYLK
FT                   EIGVVPLLTSEEEKELAVAVAKGDLMAKQRLAEANLRLVVSIAKRYVGRGMQFLDLIQE
FT                   GNMGLMKAVDKFDYSKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLVRE
FT                   QRNLLQELGQDPTPEQIAERMEMTPDKVREILKIAQEPVSLETPIGEEDDSHLGDFIED
FT                   EVIENPVDYTTRVVLREQLDEVLDTLTDREENVLRLRFGLDDGKMRTLEDVGKVFNVTR
FT                   ERIRQIEAKALRKLRHPSRSKQLRDFIED"
FT   gene            574590..574928
FT                   /locus_tag="SpyM3_0520"
FT   CDS             574590..574928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: dbj|BAA21508.1| (AB000631)
FT                   unnamed protein product [Streptococcus mutans]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79127"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CF98"
FT                   /protein_id="AAM79127.1"
FT                   /translation="MSDTPKYTQDQVIAIKNRILEALETVIDPELGIDVVNLGLIYEIR
FT                   FNDNGYTEIDMTLTTMGCPLADLLTDYIHDALQDVPEVTKTEVKLVWYPAWTVDKMSRY
FT                   ARIALGIR"
FT   gene            575066..575920
FT                   /gene="rmlD"
FT                   /locus_tag="SpyM3_0521"
FT   CDS             575066..575920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlD"
FT                   /locus_tag="SpyM3_0521"
FT                   /product="putative dTDP-4-keto-L-rhamnose reductase"
FT                   /note="best blastp hit: gb|AAK33724.1| (AE006530) putative
FT                   dTDP-4-keto-L-rhamnose reductase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79128"
FT                   /db_xref="GOA:Q8K810"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K810"
FT                   /protein_id="AAM79128.1"
FT                   /translation="MILITGSNGQLGTELRYLLDERGVDYVAVDVAEMDITNEDKVEAV
FT                   FAQVKPTLVYHCAAYTAVDAAEDEGKALNEAINVTGSENIAKACGKYGATLVYISTDYV
FT                   FDGNKPVGQEWVETDRPDPKTEYGRTKRLGELAVERYAEHFYIIRTAWVFGNYGKNFVF
FT                   TMEQLAENHSRLTVVNDQHGRPTWTRTLAEFMCYLTENQKAFGYYHLSNDAKEDTTWYD
FT                   FAKEILKDKAVEVVPVDSSAFPAKAKRPLNSTMNLDKAKATGFVIPTWKEALKAFYQQG
FT                   LKK"
FT   gene            576039..577193
FT                   /gene="rgpAc"
FT                   /locus_tag="SpyM3_0522"
FT   CDS             576039..577193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpAc"
FT                   /locus_tag="SpyM3_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: dbj|BAA32089.1| (AB010970)
FT                   rgpAc [Streptococcus mutans], possibly involved in cell
FT                   wall localization and side chain formation of
FT                   rhamnose-glucose polysaccharide"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79129"
FT                   /db_xref="GOA:Q8K809"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR015393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K809"
FT                   /protein_id="AAM79129.1"
FT                   /translation="MQDVFIIGSRGLPAKYGGFETFVEELISHQSSKNIRYHVACLSDT
FT                   KHKVHFDYKGADCFYLNPPKLGPARVIAYDMMAITYALSYSDQHQIQNPIFYVLGNTVG
FT                   AFIAPFVKQIHNRGGRFFINPDGLEWKRSKWSKPVQAYLKFSEKQMTRQADLVISDNIG
FT                   IDRYLKQVYPWSKTCFIAYGTQTQPSRLTTADSKVRAYFQTFDIREKDYYLILGRFVPE
FT                   NNYETAIKEFMASSTKRDLVIICNHEGNAYFKQLLAETECDKDPRIKFVGTLYDKELLA
FT                   YIREQAYAYIHGHEVGGTNPGLLEALAHTNLNLVLGVDFNQSVAKSAALYWTKQKGQLA
FT                   ELINQVDAGFDSDRLGKEAKAIIQEHYTWEKIVGEYEALFLNEH"
FT   gene            577183..578115
FT                   /gene="rgpBc"
FT                   /locus_tag="SpyM3_0523"
FT   CDS             577183..578115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpBc"
FT                   /locus_tag="SpyM3_0523"
FT                   /product="putative rhamnosyltransferase"
FT                   /note="best non-GAS blastp hit: dbj|BAA32090.1| (AB010970)
FT                   rhamnosyltransferase [Streptococcus mutans], possibly
FT                   involved in cell wall localization and side chain formation
FT                   of rhamnose-glucose polysaccharide"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79130"
FT                   /db_xref="GOA:Q8K808"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K808"
FT                   /protein_id="AAM79130.1"
FT                   /translation="MNINILLSTYNGERFLAEQIQSIQRQTVNDWTLLIRDDGSTDGTQ
FT                   DIIRTFVKEDKRIQWINEGQTENLGVIKNFYTLLKHQKADVYFFSDQDDIWLDNKLEVT
FT                   LLEAQKHEMTAPLLVYTDLKVVTQHLAICHNSMIKTQSGHANTSLLQELTENTVTGGTM
FT                   MITHALAEEWTTCDGLLMHDWYLALLASATGKLVYLDIPTELYRQHDANVLGARTWSKR
FT                   MKNWLTPHHLVNKYWWLITSSQKQAQLLLDLPLKPNDHELVTAYVSLLDMPFTKRLATL
FT                   KRYGFRKNRIFHTFIFRSLVVTLFGYRRK"
FT   gene            578118..578921
FT                   /gene="rgpCc"
FT                   /locus_tag="SpyM3_0524"
FT   CDS             578118..578921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpCc"
FT                   /locus_tag="SpyM3_0524"
FT                   /product="putative ABC-transporter (permease protein)"
FT                   /note="possiblyinvolved in cell wall localization and side
FT                   chain formation of rhamnose-glucose polysaccharide; best
FT                   non-GAS blastp hit: pir||T00088 ABC-type transport protein
FT                   rgpCc - Streptococcus mutans"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79131"
FT                   /db_xref="GOA:Q8K807"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K807"
FT                   /protein_id="AAM79131.1"
FT                   /translation="MNFLTKKNRILLREMVKTDFKLRYQGSAIGYLWSILKPLMMFTIM
FT                   YLVFIRFLRLGGNVPHFPVALLLANVIWSFFSEATSMGMVSIVSRGDLLRKLNFSKHII
FT                   VFSAVLGALINFLINLVVVLIFALINGVTISGYAYLSLFLFIELVVLVLGIALLLSNVF
FT                   VYYRDLAQVWEVLLQAGMYATPIIYPITFVLDSHPLAAKLLMLNPVAQMIQDFRYLLID
FT                   RANVTIWQMSTNWFYIVIPYLVPFVILFIGIFVFKKNADRFAEII"
FT   gene            578921..580126
FT                   /gene="rgpDc"
FT                   /locus_tag="SpyM3_0525"
FT   CDS             578921..580126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpDc"
FT                   /locus_tag="SpyM3_0525"
FT                   /product="putative ABC-transporter (ATP-binding protein)"
FT                   /note="best non-GAS blastp hit: pir||T00089 ABC transporter
FT                   rgpDc [Streptococcus mutans], possibly involved in cell
FT                   wall localization and side chain formation of
FT                   rhamnose-glucose polysaccharide"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79132"
FT                   /db_xref="GOA:Q7CF97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CF97"
FT                   /protein_id="AAM79132.1"
FT                   /translation="MINREIAVKVQHVSKTFKLPTEATKSFRTTLVNRLRGIKGFTEQH
FT                   VLKDINFDVYKGDFFGIVGRNGSGKSTLLKIISQIYVPEKGQVTVDGKMVSFIELGVGF
FT                   NPELTGRENVYMNGAMLGFTKDEVDDMYNDIVDFAELHHFMNQKLKNYSSGMQVRLAFS
FT                   VAIKAQGDVLILDEVLAVGDEAFQRKCNDYFMERKDSGKTTILVTHDMGAVKKYCNRAV
FT                   LIEDGLVKAYGEPFDVANQYSVDNTETAEDAMNAEKISVSDIAKDLKVSLISNPRITPN
FT                   DTITFEVSYEVLKDDFTYIAFSLTDIDRNIWVYNDNSLDYPTQGIGRKCISYQCQLSQL
FT                   NDIKLKLEVTVRDKNGQMLLFSTAEQSPQIVIQRNDIDQDDLSALDSASGLYQRNGKWV
FT                   FH"
FT   gene            580151..581158
FT                   /gene="rgpEc"
FT                   /locus_tag="SpyM3_0526"
FT   CDS             580151..581158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpEc"
FT                   /locus_tag="SpyM3_0526"
FT                   /product="putative glycosyltransferase"
FT                   /note="best non-GAS blastp hit: pir||T00090
FT                   glycosyltransferase rgpEc [Streptococcus mutans], possibly
FT                   involved in cell wall localization and side chain formation
FT                   of rhamnose-glucose polysaccharide"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79133"
FT                   /db_xref="GOA:Q8K806"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K806"
FT                   /protein_id="AAM79133.1"
FT                   /translation="MYKVSIICTNYNKAPWISDALDSFLSQVTDFEVEIIVIDDASTDD
FT                   SREILKSYQKKSSGKIKLLFNETNIGITKTWIKACLYAKGKYIARCDGDDYWTDSFKLQ
FT                   KQVDVLEASKRSRWCNTDFDFVNSQGDLLYANAFSSGHTPLTDTYEKVLALKGMTMAST
FT                   WLVDADLMRQVNQKINVDTPDDTFDIQLELFQLTQLTYIKDSTTIYRMTTDSDSRPTDT
FT                   PKMIHRIQKLLDTQLNYLKKYNQVDTKEVSKLLLQQDAKQEIRIHELSCFIQELQQTIV
FT                   DKTKQQETREVELQNVIEEQKNQLSELRQQYHAIINSRQWKYTSKLIAFIRRKK"
FT   gene            581155..582900
FT                   /gene="rgpFc"
FT                   /locus_tag="SpyM3_0527"
FT   CDS             581155..582900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpFc"
FT                   /locus_tag="SpyM3_0527"
FT                   /product="putative protein"
FT                   /note="best non-GAS blastp hit: pir||T00091 rgpFc protein
FT                   [Streptococcus mutans], possibly involved in cell wall
FT                   localization and side chain formation of rhamnose-glucose
FT                   polysaccharide"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79134"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K805"
FT                   /protein_id="AAM79134.1"
FT                   /translation="MNRILLYVHFNKYNKISAHVYYQLEQMRSLFSKIVFISNSKVSHE
FT                   DLKRLKNHCLIDEFLQRKNKGFDFSAWHDGLITMGFDKLEEFDSLTIMNDTCFGPIWEM
FT                   APYFENFEEKEAVDFWGITNNRGTKAFKEHVQSYFMTFKNQVIQNKVFQQFWQSIIEYE
FT                   NVQEVIQHYETQLTSILLNEGFSYQTVFDTRKAESSFMPHPDFSYYNPTAILKHHVPFI
FT                   KVKAIDANQHIAPYLLNLIRETTNYPIDLIVSHMSQISLPDAKYLLSQKYLNCQRLAKQ
FT                   TCQKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADI
FT                   RVTGNRGRDIYPMLLLKDKLSQYDYIGHFHTKKSKEADFWAGESWRKELIDMLVKPADS
FT                   ILSAFETNDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDT
FT                   FVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLLVYIAWGNSYDFR
FT                   IVKNPYELTPFIDNKLLNLREDEGAHTYVNFNQMGGIKGALKYIIVGPAKAMKYIFLRL
FT                   MEKLK"
FT   gene            582897..585371
FT                   /locus_tag="SpyM3_0528"
FT   CDS             582897..585371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: pir||T00092 hypothetical
FT                   protein 7 [Streptococcus mutans], possibly involved in
FT                   polysaccharide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79135"
FT                   /db_xref="GOA:Q8K804"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K804"
FT                   /protein_id="AAM79135.1"
FT                   /translation="MIKDTFLKTNWLNISHHIILLVFGFYFSFYSLAKELVSSTTQPVN
FT                   YYTHLLNVSFVGYIISLIGLSYYLSRQVSRQLFLKTSFIVISYLIVSYWVQITQHLNDK
FT                   RFDIWSLTKNQFYQFQALPSLLIILVMATLIKILVAYFAIEKDRFGLLGYQGNTFSVAL
FT                   ILAVVPINDIHLLKLISSRFSELVTAGNSQIALLKISGLLIVLLVIFATIIYVVLNALK
FT                   HLKSNKPSFSVAATTSLFLALVFNYTFQYGVKGDEALLGYYVFPGTTLFQIVAITLVAL
FT                   LAYVITNRYWPTTFFLLILGTIISVVNDLKESMRSEPLLVTDFVWLQELGLVTSFVKKS
FT                   VIVEMVVGLAICIVVAWYLHGRVLAGKLFMSPVKRASAVLGLVIVSCSMLIPFSYEKEG
FT                   KILSGLPIISALNNDNDINWLGFSTNARYKSLAYVWTRQVTKKIMEKPTNYSQETIASI
FT                   AQKYQKLAEDINKDRKNNIADQTVIYLLSESLSDPDRVSNVTVSHDVLPNIKAIKNSTT
FT                   AGLMQSDSYGGGTANMEFQTLTSLPFYNFSSSVSVLYSEVFPKMAKPHTISEFYQGKNR
FT                   IAMHPASANNFNRKTVYSNLGFSKFLALSGSKDKFKNIENVGLLTSDKTVYNNILSLIN
FT                   PSESQFFSVITMQNHIPWSSDYPEEIVAEGKNFTEEENHNLTSYARLLSFTDKETRAFL
FT                   EKLTQINKPITVVFYGDHLPGLYPDSAFNKHIENKYLTDYFIWSNGTNEKKNHPLINSS
FT                   DFTAALFEHTDSKVSPYYALLTEVLNKASVDKSPDSPEVKAIQNDLKNIQYDVTIGKGY
FT                   LLKHKTFFKISR"
FT   gene            585550..586245
FT                   /locus_tag="SpyM3_0529"
FT   CDS             585550..586245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0529"
FT                   /product="putative glycosyl transferase"
FT                   /note="best blastp hit: gb|AAK33732.1| (AE006531) putative
FT                   glycosyl transferase [Streptococcus pyogenes M1 GAS],
FT                   possible glycosyl transfer to a polyprenyl-phosphate
FT                   acceptor"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79136"
FT                   /db_xref="GOA:Q7CF96"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CF96"
FT                   /protein_id="AAM79136.1"
FT                   /translation="MKKLIIIPAYNESSNIVNTIRTIESDAPDFDYIIIDDCSTDNTLA
FT                   ICQKQGFNVISLPINLGIGGAVQTGYRYAQRCGYDVAVQVDGDGQHNPCYLEKMVEVLV
FT                   QSSVNMVIGSRFITKEGFQSSFARRIGIKYFTWLIALLTGKKITDATSGLRLIDRSLIE
FT                   RFANHYPDDYPEPETVVDVLVSHFKVKEIPVVMNERQGGVSSISLTKSVYYMIKVTLAI
FT                   LVVRLKGNR"
FT   gene            586247..586588
FT                   /locus_tag="SpyM3_0530"
FT   CDS             586247..586588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK04308.1|AE006259_2
FT                   (AE006259) hypothetical protein [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79137"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CF95"
FT                   /protein_id="AAM79137.1"
FT                   /translation="MTVTASLFISFIVLTFVFFLINLIKKDKLAIKYSLLWFILALLIL
FT                   LFTWLPNILNKMSHFLGIHSPTNMLFFLGFCLSLAIIFSLTNNISLQNDKVKRLTQEVA
FT                   LMKKEKTND"
FT   gene            586581..587867
FT                   /locus_tag="SpyM3_0531"
FT   CDS             586581..587867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: sp|P39855|CAPF_STAAU
FT                   Capsular polysaccharide biosynthesis protein capF"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79138"
FT                   /db_xref="GOA:Q7CF94"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CF94"
FT                   /protein_id="AAM79138.1"
FT                   /translation="MINPSKQNQTIFLWNMLGSLSTAVISVILLMVVTRLLTSADSDIY
FT                   AFAYSFANMMVVVGLFQVRNYQATDINEKYSFSQYLVARLMTCLLMLAITVIYLTLTKT
FT                   DSYKSTIVFLVCFYRSTDAFSDLYQGMFQQHERLDIAGKSLAYRNTLIFMVYTAIILYS
FT                   KNLTLALVAVCIVSLVFIMYYDIGHSKKFQKLMFSELLSNISFQNSLKLLKESFPLFLN
FT                   GFLIIYIYTQPKYAIELMTTLGEVALGSQTIFNILFMPAFVMNLLILFFRPHITQMAIA
FT                   LIRGQIKEFNKIQVQLFAYLGVFSLIALVGSGLFGIPFLSILYGTNLTDYWVDFMLIML
FT                   GGSIGSFATVIDNILTAMRKQQLLLIPYTGGFLISLLITNLFVMKYHILGAALSFLITM
FT                   LVWLGLSIMIYLFIMNRFKKGRVNATIYD"
FT   gene            587848..589344
FT                   /locus_tag="SpyM3_0532"
FT   CDS             587848..589344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK78011.1|AE007516_2
FT                   (AE007516) Membrane protein, related to Actinobacillus
FT                   protein (1944168) [Clostridium acetobutylicum]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79139"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K803"
FT                   /protein_id="AAM79139.1"
FT                   /translation="MQQSMTKVKYLWKENNNYIYSTFLTLFLTVILYANSLNLPLKFIS
FT                   LLFVVSTLLIVFLPKKLEVATIIFILVFGTLSAIISPINDIPDEYVHYSRTVYISEGDI
FT                   NLTNNNKKLRISKDVDKLIKQSGKTFITSNLKATKHSTREYSYPYIKGTNAYYSFSYIP
FT                   QALGILVGNALDLPILLTYYFGRLCNLISYAMLAFIAIKLSGSFKQVIAVVTLLPMNIY
FT                   LAASFNQDGFAIGLVLVTIGLFINLLSSKDKSNYNTKFFLYLVLCGLLVLSKFTYFLLV
FT                   CLPLFIPNEKFGKNTKLVILKKLGGLLLIFLFAAMWFRLYGQVKTPYVADFLKEVNVSQ
FT                   QVKNMLESPIVYSSIIIRHMVINLINMNNIFQFGALSYGITNLFPLYVCFFFFVYISNA
FT                   SKITINIVEKMGIIFVISAIIGATVLAMYLTWTPVGSSTVLGVQSRYLIGIIPLVLLLF
FT                   SSQQQKFKQIEDILSDKLAIHVSLLFILAMLMSTIFRYYH"
FT   gene            589438..590661
FT                   /gene="pepT"
FT                   /locus_tag="SpyM3_0533"
FT   CDS             589438..590661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepT"
FT                   /locus_tag="SpyM3_0533"
FT                   /product="putative tripeptidase"
FT                   /note="best non-GAS blastp hit: gb|AAK75124.1| (AE007404)
FT                   peptidase t [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79140"
FT                   /db_xref="GOA:P0DD00"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD00"
FT                   /protein_id="AAM79140.1"
FT                   /translation="MKYDNLLDRFIKYVKVNTRSDPDSETTPSTESQEAFALTILKPEM
FT                   EAIGLQDVHYNPVNGYLIGTLPANNPTLTRKIGFIAHMDTADFNAENVNPQIIDNYQGG
FT                   DITLGSSNYKLDPKAFPNLNNYIGQTLITTDGTTLLGADDKSGIAEIMTAIEFLTSQPQ
FT                   IEHCDIKVAFGPDEEIGVGADKFEVADFEVDFAYTMDGGPLGELQYETFSAAALEVTFL
FT                   GRNVHPGTAKDQMINALELAIDFHEKLPAKERPEYTDGYQGFYHLTGLTGTVEEARASY
FT                   IIRDFEEASFEARKVKVENIAQSMNAHLGTKRVLVELNDQYYNMKKVIEKDMTAIELAK
FT                   EVMEELAIKPVIEPIRGGTDGSKISFMGIPTPNIFAGGENMHGRFEFVSLQTMERAIDV
FT                   IIGLVCKA"
FT   gene            590702..591190
FT                   /locus_tag="SpyM3_0534"
FT   CDS             590702..591190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0534"
FT                   /product="putative pore-forming peptide"
FT                   /note="best non-GAS blastp hit: gb|AAC36851.1| (L23802)
FT                   pore-forming peptide [Enterococcus faecalis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79141"
FT                   /db_xref="InterPro:IPR020215"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K801"
FT                   /protein_id="AAM79141.1"
FT                   /translation="MIKLFGKIRYHWQPELSWSIIYWSIAFAPIFVGLSLLYERTEIPS
FT                   RVFILFAIFAVLVGIGLHRYFIIENNGILRIVSFELFGPRKLLISTITKIEVTKSTLCL
FT                   HVEDKSYLFYMRKWPKKYFLDALAVNPYFQGEVILSDNFIKLDYFEVYQHDKKALTRG"
FT   gene            complement(591177..591374)
FT                   /locus_tag="SpyM3_0535"
FT   CDS             complement(591177..591374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0535"
FT                   /product="putative ferredoxin"
FT                   /note="best blastp hit: gb|AAK33738.1| (AE006531)
FT                   ferredoxin [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79142"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CF93"
FT                   /protein_id="AAM79142.1"
FT                   /translation="MKVSIIPEKCIACGLCQTYSSLFDYHDNGIVTFSSSSETSQSICP
FT                   SDKDAILAVKSCPTKALTLE"
FT   gene            591424..591900
FT                   /locus_tag="SpyM3_0536"
FT   CDS             591424..591900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75688.1| (AE007454)
FT                   hypothetical protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79143"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K800"
FT                   /protein_id="AAM79143.1"
FT                   /translation="MAKEPWEEKIVDDTIGTRTRKSRNAFISTPWLTALLSVFFVIIVA
FT                   ILFIFFYTSNSGSNRQAETNGFYGASTHKKTRKASNAKKTSSSSTTTDTTPSSEETLAS
FT                   SEVTGETITVLAGEGAASIAARAGISVEQLQALNPEHMTQGYWYANPGDQVIIK"
FT   gene            591915..592595
FT                   /gene="cmk"
FT                   /locus_tag="SpyM3_0537"
FT   CDS             591915..592595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="SpyM3_0537"
FT                   /product="putative cytidylate kinase"
FT                   /note="best blastp hit: gb|AAK33740.1| (AE006531) putative
FT                   cytidylate kinase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79144"
FT                   /db_xref="GOA:P0DA38"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA38"
FT                   /protein_id="AAM79144.1"
FT                   /translation="MKAIKIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIA
FT                   LTHGYTGKEVALILEELEKNPISFKKAKDGSQLVFLGDEDVTLAIRQNDVTNNVSWVSA
FT                   LPEIREELVHQQRRIAQAGGIIMDGRDIGTVVLPDAELKIFLVASVEERAERRYKENLE
FT                   KGIESDFETLKEEIAARDYKDSHRKVSPLKAAEDALIFDTTGVSIDGVVQFIQEKAEKI
FT                   VDMS"
FT   gene            592757..593287
FT                   /gene="infC"
FT                   /locus_tag="SpyM3_0538"
FT   CDS             592757..593287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="SpyM3_0538"
FT                   /product="putative translation initiation factor 3"
FT                   /note="IF3; best blastp hit: sp|P58081|IF3_STRPY
FT                   Translation initiation factor IF-3, and gb|AAK33741.1|
FT                   (AE006531) putative translation initiation factor 3 (IF3)
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79145"
FT                   /db_xref="GOA:P0DB86"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DB86"
FT                   /protein_id="AAM79145.1"
FT                   /translation="MKIIAKKDLFINDEIRVREVRLVGLEGEQLGIKPLSEAQSLADAS
FT                   NVDLVLIQPQAVPPVAKLMDYGKFKFEYQKKQKEQRKKQSVVTVKEVRLSPVIDKGDFE
FT                   TKLRNGRKFLEKGNKVKVSIRFKGRMITHKEIGAKVLADFAEATQDIAIIEQRAKMDGR
FT                   QMFMQLAPISDKK"
FT   gene            593329..593526
FT                   /gene="rpmI"
FT                   /locus_tag="SpyM3_0539"
FT   CDS             593329..593526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="SpyM3_0539"
FT                   /product="50S ribosomal protein L35"
FT                   /note="best blastp hit: gb|AAK33742.1| (AE006531) 50S
FT                   ribosomal protein L35 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79146"
FT                   /db_xref="GOA:P0DE48"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE48"
FT                   /protein_id="AAM79146.1"
FT                   /translation="MPKQKTHRASAKRFKRTGSGGLKRFRAFTSHRFHGKTKKQRRHLR
FT                   KAGLVSSGDFKRIKAMVTGL"
FT   gene            593585..593944
FT                   /gene="rplT"
FT                   /locus_tag="SpyM3_0540"
FT   CDS             593585..593944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="SpyM3_0540"
FT                   /product="50S ribosomal protein L20"
FT                   /note="best blastp hit: gb|AAK33743.1| (AE006531) 50S
FT                   ribosomal protein L20 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79147"
FT                   /db_xref="GOA:P0DE18"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE18"
FT                   /protein_id="AAM79147.1"
FT                   /translation="MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYY
FT                   AYRDRRQKKRDFRKLWITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVADAA
FT                   AFTALADAAKAKLGK"
FT   gene            complement(594235..596445)
FT                   /locus_tag="SpyM3_0541"
FT   CDS             complement(594235..596445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK04903.1|AE006314_1
FT                   (AE006314) conserved hypothetical protein [Lactococcus
FT                   lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79148"
FT                   /db_xref="GOA:Q8K7Z8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7Z8"
FT                   /protein_id="AAM79148.1"
FT                   /translation="MTSLGKNDKEVATVKKFKTLITGFINTRLGFIITLLFCYWIKTLW
FT                   AYHTDFSLDLGNIYQVFLTIINPIPLAFLLLGVALYVKNTRAFYICSWVVYIILNILLI
FT                   SNSIYYREFSDFITVSAMLASSKVSAGLGDSALNLLRIWDIIYILDFIILISLSITKKI
FT                   KNDQRPFNKRAAFAITALSSLLLSINLFLAEIDRPELLTRGFSNTYIVRALGLPAFTLY
FT                   SGNQTYQAQKERNGATAEELIDVKTYVKGHYAAPDPQYFGIGKGKNIIVLHLESFQQFL
FT                   IDYKLKEGDKEYEVTPFINSLYHSNATLAFPNFFHQVKAGKTSDAETMMENSLFGLNSG
FT                   SFMVNYGGENTQFATPSILAQKGGYTSAVFHGNVGTFWNRNNAYKQWGYNYFFDSSYFS
FT                   KQNSKNSFQYGLNDKYMFKDSIKYLEQMQQPFYTKFITVSNHYPYTSLKGESSEEGFPL
FT                   AKTDDETINGYFATANYLDAALKSFFDYLKATGLYDNSIFVLYGDHYGISNSRNSSLAP
FT                   LLGKDSETWSEYDNAMLQRVPYMIHIPGYTNGSIKETFGGEIDALPTLLHILGIDTSQF
FT                   VQLGQDLLSPQNSQIVAQRTSGTYMTPEYTNYSGRLYNTQTGLEITNPDEMTIAKTKEI
FT                   RSAVAQQLAASDAIQTGDLLRFDTQNGLKAIDPNQFIYTKQLKQLKDISAKLGSESTSL
FT                   YSKNGHKSTQKLFKAPSYLELNPVEADAATSELKEDNTKNRE"
FT   gene            596553..597716
FT                   /locus_tag="SpyM3_0542"
FT   CDS             596553..597716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75476.1| (AE007435)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79149"
FT                   /db_xref="GOA:Q8K7Z7"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7Z7"
FT                   /protein_id="AAM79149.1"
FT                   /translation="MNKLYIDSFVEKKLTAGVQLLDEKDFSNIKEKNQLVQLETKSNRP
FT                   IGTAYISKQNKGIGWYLGPEKIDLSISYFVSLFSVAKAKRQDFAQSDETNAYRLFNQEG
FT                   DGFGGVTIDLYKDFAVFSWYNAFVYDKKEMIMEAFQQVFPEVKGAYEKCRFKGPDTETA
FT                   HLYGELAQETFSILENGIAYQVFLNEGLMTGIFLDQHDVRRALVDGLAMGKSLLNLFSY
FT                   TAAFSVAAAMGGAIETTSVDLAKRSRELSLAHFEHNQLNLASHHFVVMDVFEYFKYAKR
FT                   KKLIFDVIVIDPPSFARNKKQTFSVSRDYHKLITEALDILSPKGTIIASTNAANMTVSQ
FT                   FKKQIIKGFGSRRPESMTLQQLPSDFTINKADERSNYLKVFTIKVRE"
FT   gene            597713..598399
FT                   /gene="aroD"
FT                   /locus_tag="SpyM3_0543"
FT   CDS             597713..598399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="SpyM3_0543"
FT                   /product="putative 3-dehydroquinate dehydratase"
FT                   /note="best blastp hit: gb|AAK33746.1| (AE006532) putative
FT                   3-dehydroquinate dehydratase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79150"
FT                   /db_xref="GOA:P0CZ74"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CZ74"
FT                   /protein_id="AAM79150.1"
FT                   /translation="MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVA
FT                   PAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVF
FT                   QEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRG
FT                   FKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVL
FT                   EMDISN"
FT   gene            598637..599659
FT                   /gene="aroF"
FT                   /locus_tag="SpyM3_0544"
FT   CDS             598637..599659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroF"
FT                   /locus_tag="SpyM3_0544"
FT                   /product="putative chorismate synthase"
FT                   /note="best blastp hit: gb|AAK33747.1| (AE006532) putative
FT                   chorismate synthase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79151"
FT                   /db_xref="GOA:P0CZ78"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CZ78"
FT                   /protein_id="AAM79151.1"
FT                   /translation="MSIETDRVQISSGVRHGKTTGAPITLTVINKDHQKWLDVMAVGDI
FT                   EETLKLKRRVKHPRPGHADLVGGIKYHFNDLRDALERSSARETTMRVAVGAVAKRILAE
FT                   LGIDMLHHILIFGGITITIPSKLSFRELQERALHSELSIVNPKQEKEIKTYIDKIKKEG
FT                   DTIGGIIETIVQGVPAGLGSYVQWDKKLDAKLAQAVLSINAFKGVEFGVGFDMGFQKGS
FT                   QVMDEITWTPTQGYGRQTNHLGGFEGGMTTGQPLVVKGVMKPIPTLYKPLMSVDIDSHE
FT                   PYKATVERSDPTALPAAGVIMENVVATVLAKEILETFSSTTMSELQKAFSDYRAYVKQF
FT                   "
FT   gene            599720..600061
FT                   /locus_tag="SpyM3_0545"
FT   CDS             599720..600061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAL00034.1| (AE008495)
FT                   Conserved hypothetical protein [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79152"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DH12"
FT                   /protein_id="AAM79152.1"
FT                   /translation="MSQEIYDYANQLERAVRALPEYQKVLEVKEAIQADASTSQLFDEF
FT                   VAMQEKIQGMMQSGQMPTAEEQTSIQELSQKIEANDQLKAYFEAQQALSVYMSDIERIV
FT                   FAPLKDLVK"
FT   gene            600282..601634
FT                   /gene="gor"
FT                   /locus_tag="SpyM3_0546"
FT   CDS             600282..601634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="SpyM3_0546"
FT                   /product="putative glutathione reductase"
FT                   /note="best blastp hit: gb|AAK33749.1| (AE006532) putative
FT                   glutathione reductase (GR) [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79153"
FT                   /db_xref="GOA:Q8K7Z4"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7Z4"
FT                   /protein_id="AAM79153.1"
FT                   /translation="MVIPYDYIVIGGGSAGIASANRAAMHGAKVLLAEGKEIGGTCVNL
FT                   GCVPKKVMWYGAQVADILGTYAKDYGFDFKEKAFDFKQLKANRQAYIDRIHVSYERGFE
FT                   QNGVNRIYDYAVFKDAHTVEIAGQLYTAPHILIATGGHPVFPDIEGAQYGISSDGFFAL
FT                   DEVPKRTAVVGAGYIAVELAGVLHALGSKTDLFIRHDRPLRSFDKAIVDVLVEEMAVGG
FT                   PCLHPHSEVAKVVKNTDESLTLYLKDGQEVEVDQLIWAIGRKPNLEGFGLDKTGVTLND
FT                   KGYIETDAYENTSVKGIYAVGDVNGKLALTPVAVAAGRRLSERLFNGKTDEKLDYQNVA
FT                   TVIFSHPVIGSVGLSEEAAVKQYGQEAVKTYQSRFTSMFTAITNHRQPCLMKLVTVGDT
FT                   EKIVGLHGIGYGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR"
FT   gene            complement(601714..602991)
FT                   /gene="folC.2"
FT                   /locus_tag="SpyM3_0547"
FT   CDS             complement(601714..602991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC.2"
FT                   /locus_tag="SpyM3_0547"
FT                   /product="putative folyl-polyglutamate synthetase"
FT                   /note="best blastp hit: gb|AAK33750.1| (AE006532) putative
FT                   folyl-polyglutamate synthetase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79154"
FT                   /db_xref="GOA:Q8K7Z3"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7Z3"
FT                   /protein_id="AAM79154.1"
FT                   /translation="MTTYDSISWIHTFKANGRKTDLARMAWLLEALGRPQDKFPAIHVV
FT                   GTNGKGSVTAYLQHILSTSGYQVGTFTSPFIISFHDRICLNGQPISDLELAQCVSVIRP
FT                   ILTKMSLETNWDRPTEFELVTLIMFCYFANLKPVDIAIIEAGIGGKTDATNVFHALAVV
FT                   CPSISFDHQERLGYSLAEIAHQKAEVIKAKEPVIIGQLEQEASQVFQQVTQKAGSRLYQ
FT                   LGKDFLLNPSEKTFSFQHDNLNLTKLRLKLLGQHQKANACLAIMTAQLLRKSFPKISPK
FT                   TIQKGIEATTWPGRSEFIQPNLLLDGAHNPDSIAKLKSLLQEEFPKRPIHILFAGLKRK
FT                   PLADLLAQLDTFEVSVTTFDFPEANLLEDYPDKYPQVKDYRDWLQGSVTSDELFVVTGS
FT                   LYFISEVRQYCLSNANIFKNIFPLIT"
FT   gene            complement(603021..603461)
FT                   /locus_tag="SpyM3_0548"
FT   CDS             complement(603021..603461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75006.1| (AE007393)
FT                   hypothetical protein [Streptococcus pneumoniae TIGR4], and
FT                   gb|AAK99586.1| (AE008454) hypothetical protein
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79155"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7Z2"
FT                   /protein_id="AAM79155.1"
FT                   /translation="MSSHYSRQQKPRKSGGVPTEHIKTGFTAFQKSIALIGSILSIIVA
FT                   TITITRALQPVPDKTSNDTPKESSNTIVKIIEKESSQGNQNHTGTSETTDDNKTTLPSS
FT                   STTPSHNETTPTAPETPSTTEGMQLPNATGAEDANTGLPTNP"
FT   gene            603696..604838
FT                   /gene="nifS"
FT                   /locus_tag="SpyM3_0549"
FT   CDS             603696..604838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS"
FT                   /locus_tag="SpyM3_0549"
FT                   /product="putative iron-sulfur cofactor synthesis protein"
FT                   /note="best blastp hit: gb|AAK33752.1| (AE006532) putative
FT                   iron-sulfur cofactor synthesis protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79156"
FT                   /db_xref="GOA:Q8K7Z1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7Z1"
FT                   /protein_id="AAM79156.1"
FT                   /translation="MIYFDNAATTIPYGEALKTYQEVATKIYGNPSSLHQLGTNASRIL
FT                   EASRKQIAGLLGVKSEEIFFTSGGTESANWAIKGIAFEKTAFGKHIIISAIEHPAVSES
FT                   VKWLLTQGFEVSYAPVTTQGVVDVNALAELIRPDTILISIMAVNNEMGAIQPIRAISNL
FT                   LANQLTITFHVDAVQAIGKIPLCDYMTNRVDLASFSGHKFHSVRGVGFLYKKAGKRLNP
FT                   LLSGGGQEQELRSTTENVAGIASMAKALRIVTEKQVSVLPKLTAMRDVIYKALSAYPDV
FT                   TVFSAQEGFVPNILTFGIRGVRGEVIVHAFEKYEIYISTTSACSSKAGKPAGSLVAMGI
FT                   PVKTAQTAVRISLDDDNDMGQVEQFLTIFKQIYDKTQKVR"
FT   gene            604910..606064
FT                   /gene="thiI"
FT                   /locus_tag="SpyM3_0550"
FT   CDS             604910..606064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="SpyM3_0550"
FT                   /product="putative thiamine biosynthesis protein"
FT                   /note="best blastp hit: gb|AAK33753.1| (AE006532) putative
FT                   thiamine biosynthesis protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79157"
FT                   /db_xref="GOA:P0DF94"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF94"
FT                   /protein_id="AAM79157.1"
FT                   /translation="MRFINKLKNNIQDVLAPFPAITVRSDRDRTHVSLNGTDYQPIVEA
FT                   LKLVFGVQALSPVYKLEKSVPLLVTAVQDIMTSLYRDGLTFKIATKRSDHAFELDSREL
FT                   NSLLGGAVFEVLPNIQAQMKHPDVTLKVEIRDEAAYISYEEIKGAGGLPVGTSGKGMLM
FT                   LSGGIDSPVAGYLALKRGLDIEVVHFASPPYTSPGALAKAQDLTRRLTRFGGNIQFIEV
FT                   PFTEIQEEIKNKAPEAYLMTLTRRFMMRITDAIREQRKGLVIVNGESLGQVASQTLESM
FT                   QAINAVTSTPIIRPVVTMDKLEIIEMAQAIDTFDISIQPFEDCCTIFAPDRPKTNPKLG
FT                   NAEKYEERFDIDGLVQRAVSGIVVTEITPEIVNDEVENLIDALL"
FT   gene            606213..607394
FT                   /locus_tag="SpyM3_0551"
FT   CDS             606213..607394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK75547.1| (AE007441)
FT                   conserved domain protein [Streptococcus pneumoniae TIGR4],
FT                   and gb|AAL00112.1| (AE008501) hypothetical protein
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79158"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7Y9"
FT                   /protein_id="AAM79158.1"
FT                   /translation="MQYKKTMATVVALIVALLLFGLIYDLLGVQKNKLAAQKSAQPKVK
FT                   TARVVANGDILIHDILYMSARKADDTYDFTPYFEYVKDWISGADLAIGDYEGTISPDYP
FT                   LAGYPLFNAPEEIAGALKNTGYDVVDLAHNHILDSQLDGALNTKKVFHQLGIDSIGIYD
FT                   KDRSKESFLIKNVNGIKIAILGYSYGYNGMEATLSQEDYEKHMSDLDEAKIKKELQLAE
FT                   KKADVTIVMPQTGTEYALEPTAEQKELYHKMIDWGADVVLGGHPHVIEPSETVIKGRQK
FT                   KFIIYSMGNFISNQRLETVDDIWTERGLLMDLTFEKKDNKTKIKTVEAHPTMVLAKGKG
FT                   IVGKEGFELYNYRTMVLEDFIKGGKYHDKIDEETKAKVALAYQEINDLVNLKW"
FT   gene            607608..607922
FT                   /gene="rplU"
FT                   /locus_tag="SpyM3_0552"
FT   CDS             607608..607922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="SpyM3_0552"
FT                   /product="50S ribosomal protein L21"
FT                   /note="best blastp hit: gb|AAK33755.1| (AE006533) 50S
FT                   ribosomal protein L21 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79159"
FT                   /db_xref="GOA:P0DE20"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE20"
FT                   /protein_id="AAM79159.1"
FT                   /translation="MSTYAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEVTFNEVVLVGG
FT                   DKTVVGTPVVEGATVVGTVEKQGKQKKVVTFKYKPKKGSHRKQGHRQPYTKVVINAINA
FT                   "
FT   gene            607934..608260
FT                   /locus_tag="SpyM3_0553"
FT   CDS             607934..608260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99817.1| (AE008474)
FT                   Conserved hypothetical protein [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79160"
FT                   /db_xref="InterPro:IPR007422"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CF91"
FT                   /protein_id="AAM79160.1"
FT                   /translation="MIKAIFTRQKNGQLSSVTLTGHAGSGKHGFDIVCASVSTLAINFV
FT                   NSLEVLADCQALVDLNDVEGGYMAITIPPHDNKEEVQLLFESFLLGMTSLAKDSSKFVN
FT                   TQVI"
FT   gene            608288..608581
FT                   /gene="rpmA"
FT                   /locus_tag="SpyM3_0554"
FT   CDS             608288..608581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="SpyM3_0554"
FT                   /product="50S ribosomal protein L27"
FT                   /note="best blastp hit: gb|AAK33757.1| (AE006533) 50S
FT                   ribosomal protein L27 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79161"
FT                   /db_xref="GOA:P0DE28"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE28"
FT                   /protein_id="AAM79161.1"
FT                   /translation="MLKMNLANLQLFAHKKGGGSTSNGRDSQAKRLGAKAADGQTVSGG
FT                   SILYRQRGTHIYPGVNVGRGGDDTLFAKVEGVVRFERKGRDKKQVSVYPVAK"
FT   gene            608939..609853
FT                   /locus_tag="SpyM3_0555"
FT   CDS             608939..609853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0555"
FT                   /product="putative capsular polysaccharide biosynthesis
FT                   regulatory protein"
FT                   /note="best blastp hit: gb|AAK33758.1| (AE006533) putative
FT                   capsular polysaccharide biosynthesis protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79162"
FT                   /db_xref="GOA:Q8K7Y8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7Y8"
FT                   /protein_id="AAM79162.1"
FT                   /translation="MNIQQLRYVVAIANNGTFREAASKLFVSQPSLSVSIKDLEAELGF
FT                   QIFNRTTSGTVLTSQGLVFYEKALEVVKSFDSFEKTFSQADLDQNEFSIASQHYDFLPP
FT                   LITAFSQQYDGHRVFRIFESTTIQILDEVAQGNSEIGIIYLNVDNQKGLFQRMDKLGLE
FT                   YVSLIPFTTHIYLSKTHPLANREALYLSDIQGLPAVRFTQERDEYLYYSENFVDTSECP
FT                   RIYNVSDRATLNGILERTNAFATGSGFLDHRSVNGIKVIPLADHIDNQMIYVKRKDKNL
FT                   SVAGATFVTILKDYFDKRRKALT"
FT   gene            609850..610308
FT                   /gene="lsp"
FT                   /locus_tag="SpyM3_0556"
FT   CDS             609850..610308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lsp"
FT                   /locus_tag="SpyM3_0556"
FT                   /product="putative prolipoprotein signal peptidase"
FT                   /note="best blastp hit: gb|AAK33759.1| (AE006533) putative
FT                   prolipoprotein signal peptidase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79163"
FT                   /db_xref="GOA:P0DC20"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC20"
FT                   /protein_id="AAM79163.1"
FT                   /translation="MKKRLFVLSLILLVALDQLSKFWIVSHIALGEVKPFIPGIVSLTY
FT                   LQNNGAAFSILQDQQWFFVVITVLVIGYAIYYLATHPHLNIWKQLALLLIISGGIGNFI
FT                   DRLRLAYVIDMVHLDFVDFAIFNVADSYLTVGVILLVICLWKEEDYGN"
FT   gene            610298..611188
FT                   /locus_tag="SpyM3_0557"
FT   CDS             610298..611188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0557"
FT                   /product="putative ribosomal large subunit pseudouridine
FT                   synthase"
FT                   /note="best non-GAS blastp hit: gb|AAK75053.1| (AE007398)
FT                   ribosomal large subunit pseudouridine synthase D
FT                   [Streptococcus pneumoniae TIGR4], and gb|AAK99634.1|
FT                   (AE008458) 23S rRNA pseudouridine synthase (supresses
FT                   ftsH(ts) mutants) [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79164"
FT                   /db_xref="GOA:Q8K7Y6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7Y6"
FT                   /protein_id="AAM79164.1"
FT                   /translation="MEINVITSGQRLDKALADLSPLSRGQANDQIKQGLVLVNGQQKKA
FT                   KYTVQAGDVICFELPKEEVLEYQAQNIPLDIIYEDDTLAIINKPQGMVVHPSAGHPSGT
FT                   MVNALMYHIKDLSSINGVVRPGIVHRIDKDTSGLLMVAKTDAAHQALAEELKAKKSLRK
FT                   YLAIVHGNLPNDRGMIEAPIGRSEKDRKKQAVTAKGKEAVTRFTVLERFGDYSLVELQL
FT                   ETGRTHQIRVHMAYIGHPVAGDPLYGPRKTLSGHGQFLHAKTLGLTHPMTGKEMIFTVE
FT                   APEIFQKVLKLLRKK"
FT   gene            611583..612104
FT                   /gene="pyrR"
FT                   /locus_tag="SpyM3_0558"
FT   CDS             611583..612104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrR"
FT                   /locus_tag="SpyM3_0558"
FT                   /product="putative pyrimidine operon regulator"
FT                   /note="best non-GAS blastp hit: gb|AAK05702.1|AE006391_1
FT                   (AE006391) pyrimidine operon regulator [Lactococcus lactis
FT                   subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79165"
FT                   /db_xref="GOA:P0DD74"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DD74"
FT                   /protein_id="AAM79165.1"
FT                   /translation="MKTKEIVDDVTMKRAITRITYEIIERNKQLDNVVLAGIKTRGVFL
FT                   ARRIQERLHQLEGLDLPIGELDIKPFRDDMRVEEDTTLMSVDITGKDVILIDDVLYTGR
FT                   TIRAAIDNLVSLGRPARVSLAVLVDRGHRELPIRADYVGKNIPTSSVEEIVVEVVEVDG
FT                   RDRVSIIDPT"
FT   gene            612165..613379
FT                   /gene="pyrP"
FT                   /locus_tag="SpyM3_0559"
FT   CDS             612165..613379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrP"
FT                   /locus_tag="SpyM3_0559"
FT                   /product="putative uracil permease"
FT                   /note="best non-GAS blastp hit: gb|AAK05701.1|AE006390_11
FT                   (AE006390) uracil permease [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79166"
FT                   /db_xref="GOA:Q8K7Y4"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7Y4"
FT                   /protein_id="AAM79166.1"
FT                   /translation="MLVGLSFQHLFAMFGATVLVPILVGIDPSVALLSSGLGTLAHLSV
FT                   TKFKIPAYMGSSFAYIAAMQLLMKTNGIGAVAQGAMTGGLVYLIVALIVKVIGNDWIDK
FT                   ILPPIVVGPIVMVIGLSLASTAVNDVMLKNGNYNLTYLVIGLVTLLSVIFFNIYGKGIV
FT                   AIVPLLLGLLVGYVVALLVGVLTGQEIVDFTNVAQAKWFSIPSVEIPFLTYGVKFYPSA
FT                   ILTMAPIAFVTMTEHFGHIMVLNSLTKRDYFKDPGLEKTLTGDGFAQIIAGFLGAPPVT
FT                   SYGENIGVMALNKIFSVYVIAGAAVIAALLSFIGKVSALIQSIPTPVIGGISVALFGVI
FT                   ASSGLKILIESKVDMDNKKNLLIASVILVSGIGGLMLQVNGLQISGVAFSTLLGIILYQ
FT                   VLPEK"
FT   gene            613440..614375
FT                   /gene="pyrB"
FT                   /locus_tag="SpyM3_0560"
FT   CDS             613440..614375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="SpyM3_0560"
FT                   /product="putative aspartate transcarbamoylase"
FT                   /note="best blastp hit: gb|AAK33763.1| (AE006533) putative
FT                   aspartate transcarbamoylase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79167"
FT                   /db_xref="GOA:P0DC84"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC84"
FT                   /protein_id="AAM79167.1"
FT                   /translation="MSVVNNRVALTNLVSMEALTTEEVLGLINRGSEYKAGKVVISDHQ
FT                   KDLVANLFFENSTRTHKSFEVAEKKLGLTVLDFNADASAVNKGESLYDTVLTMSALGTD
FT                   ICVIRHPEDDYYKELVESPTITASIVNGGDGSGQHPSQCLLDLLTIYEEFGRFEGLKIA
FT                   IAGDLTHSRVAKSNMQILKRLGAELYFYGPEEWYSEAFNAYGTYIAIDQIIKELDVLML
FT                   LRVQHERHDGHQSFSKEGYHQAFGLTQERYQQLKDSAIIMHPAPVNRDVEIADSLVEAP
FT                   KARIVSQMANGVFVRMAIIEAILNGRNKNS"
FT   gene            614419..615501
FT                   /gene="carA"
FT                   /locus_tag="SpyM3_0561"
FT   CDS             614419..615501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="SpyM3_0561"
FT                   /product="putative carbamoyl phosphate synthetase small
FT                   subunit"
FT                   /note="best blastp hit: gb|AAK33764.1| (AE006533) putative
FT                   carbamoyl phosphate synthetase small subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79168"
FT                   /db_xref="GOA:P0DA12"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA12"
FT                   /protein_id="AAM79168.1"
FT                   /translation="MTKRLLILEDGTIFEGEPFGADIDVTGEIVFNTGMTGYQESITDQ
FT                   SYNGQILTFTYPLIGNYGINRDDYESISPTCKGVVVSEVSRLASNWRKQMTLDAFLKIK
FT                   GIPGISGIDTRALTKIIRQHGTMKATMADDGDSIQHLKDQLRATVLPTNTIEQVSTKTA
FT                   YPAPGIGKNIVLVDFGLKHSILREFSKRQCNITVVPFNITAEEVLQLNPDGLMLSNGPG
FT                   NPEDLPEALDMIRGVQGKIPIFGICMGHQLFSLANGAKTCKMTFGHRGFNHAVREIATG
FT                   RIDFTSQNHGYAVERSSLPDTLMVTHEDINDKTVEGVKHRDFPAFSVQFHPDAAPGPHD
FT                   ASYLFDEFLEMIDSWRCTSK"
FT   gene            615777..618923
FT                   /gene="carB"
FT                   /locus_tag="SpyM3_0562"
FT   CDS             615777..618923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="SpyM3_0562"
FT                   /product="putative carbamoylphosphate synthetase"
FT                   /note="best blastp hit: gb|AAK33765.1| (AE006533) putative
FT                   carbamoylphosphate synthetase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79169"
FT                   /db_xref="GOA:P0DA14"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DA14"
FT                   /protein_id="AAM79169.1"
FT                   /translation="MVIGSGPIIIGQAAEFDYAGTQACLALKEEGYKVILVNSNPATIM
FT                   TDKEIADKVYIEPLTLEFVNRIIRKERPDAILPTLGGQTGLNMAMALSKAGILDDLEIE
FT                   LLGTKLSAIDQAEDRDLFKQLMQELDQPIPESTIVKTVDEAVTFARDIGYPVIVRPAFT
FT                   LGGTGGGICSSEEELCEITENGLKLSPVTQCLIERSIAGFKEIEYEVMRDSADNALVVC
FT                   NMENFDPVGIHTGDSIVFAPTQTLSDIENQMLRDASLKIIRALKIEGGCNVQLALDPYS
FT                   FKYYVIEVNPRVSRSSALASKATGYPIAKLAAKIAVGLTLDEMINPITGTTYAMFEPAL
FT                   DYVVAKIPRFPFDKFEHGERQLGTQMKATGEVMAIGRNLEESLLKACRSLEIGVCHNEM
FT                   TSLSNISDEELVTKVIKAQDDRLFYLSEAIRRGYSIEELESLTKIDLFFLDKLLHIVEI
FT                   EQELQMHVDHLESLKKAKRYGFSDQKIAEIWQKDESDIRAMRHSHSLYPVYKMVDTCAA
FT                   EFDAKTPYFYSTYELENESVQSNKESILVLGSGPIRIGQGVEFDYATVHSVKAIQKAGY
FT                   EAIIMNSNPETVSTDFSVSDKLYFEPLTFEDVMNVIDLEQPKGVIVQFGGQTAINLAQA
FT                   LSEAGVTILGTQVEDLDRAEDRDLFEKALKELGIPQPQGQTATNEEEALEAAKKIGFPV
FT                   LVRPSYVLGGRAMEIVENKEDLIEYIRTAVKASPEHPILVDSYIFGKECEVDAISDGKS
FT                   VLIPGIMEHIERAGVHSGDSMAVYPPQQLSKQIQETIAEYTKRLAIGLNCIGMMNVQFV
FT                   IKNEQVYVIEVNPRASRTVPFLSKVTGIPMAQIATKLILGQTLKDLGYEDGLYPQSQLV
FT                   HIKAPVFSFTKLAQVDSLLGPEMKSTGEVMGSDTSLEKALYKAFEANNSHLSEFGQIVF
FT                   TIADDSKAEALSLARRFKAIGYQIMATQGTAAYFAEQGLSACLVGKIGDAANDIPTLVR
FT                   HGHVQAIVNTVGIKRTADKDGQMIRSSAIEQGVPLFTALDTAKAMLTVLESRCFNIEAI
FT                   "
FT   gene            619129..620400
FT                   /locus_tag="SpyM3_0563"
FT   CDS             619129..620400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74922.1| (AE007385)
FT                   conserved hypothetical protein [Streptococcus pneumoniae
FT                   TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79170"
FT                   /db_xref="GOA:Q8K7Y2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7Y2"
FT                   /protein_id="AAM79170.1"
FT                   /translation="MSKRGKIKITTKTKLITASVITLVLIITGVVLWKQQQNTLTADIA
FT                   KEPYSTVSVTEGSIASSTLFSGTVKALSEEYIYFDANKGNDATVTVKVGDQVTQGQQLV
FT                   QYNTTTAQSAYDTAVRSLNKIGRQINHLKTYGVPAVSTETNKDEATGEETTTTVQPSAQ
FT                   QNANYKQQLQDLNDAYADAQAEVNKAQIALNDTVVISSVSGTVVEVNNDIDPSSKNSQT
FT                   LVHVATEGQLQVKGTLTEYDLANVKVGQSVKIKSKVYSNQEWTGKISYVSNYPTESNAG
FT                   STTPAGSTGAGSSTGAAYDYKIDIISPLNQLKQGFTVSVEVVNEAKQALVPLTAVIKKD
FT                   KKHYVWTYDDATGKAKKVEVTLGNADAQQQEIHKGVTVGDIVIANPDKNIKPDKKLEGV
FT                   ISIGTNTKPEKDSQSKNKKSGVDK"
FT   gene            620424..621110
FT                   /locus_tag="SpyM3_0564"
FT   CDS             620424..621110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0564"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="best blastp hit: gb|AAK33767.1| (AE006534) putative
FT                   ABC transporter (ATP-binding protein) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79171"
FT                   /db_xref="GOA:Q8K7Y1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7Y1"
FT                   /protein_id="AAM79171.1"
FT                   /translation="MQLSNIVKSYQNGDQVLQVLKGINLTVYEGEFLAIMGPSGSGKST
FT                   LMNIIGLLDRPTSGDYTLHNTKIEILNDRELAKVRNDEIGFVFQQFFLLAKLTALQNVE
FT                   LPLIYAGVNVSKRREQAKQFLEKVGLGRRIKHLPSELSGGQKQRVAIARALVNDPSIIL
FT                   ADEPTGALDTKTGQQIMELLTELNKEGKTIIMVTHEPEIADFATRKIIIRDGDITTDTT
FT                   ASVVID"
FT   gene            621122..622342
FT                   /locus_tag="SpyM3_0565"
FT   CDS             621122..622342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99499.1| (AE008446)
FT                   Conserved hypothetical protein [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79172"
FT                   /db_xref="GOA:Q8K7Y0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7Y0"
FT                   /protein_id="AAM79172.1"
FT                   /translation="MENWKFALSSIWGHKMRSILTMLGIIIGVAAVVIIMGLGNAMKNS
FT                   VTSTFSSKQKDIQLYFQEKGEEEDLYAGLHTHENNHEVKPEWLEQIVKDIDGIDSYYFT
FT                   NSATSTISYEKKKVDNASIIGVSKDYFNIKNYDIVAGRTLTDNDYSNFSRIILLDTVLA
FT                   DDLFGEGNYKSALNKVVSLSDKDYLVIGVYKTDQTPVSFDGLSGGAVMANTQVASEFGT
FT                   KEIGSIYIHVNDIQNSMNLGNQAADMLTNISHIKDGQYAVPDNSKIVEEINSQFSIMTT
FT                   VIGSIAAISLLVGGIGVMNIMLVSVTERTREIGLRKALGATRLKILSQFLIESVVLTVL
FT                   GGLIGLLLAQLSVGALGNAMTLKGACISLDVALIAVLFSASIGVFFGMLPANKASKLDP
FT                   IEALRYE"
FT   gene            622596..624329
FT                   /locus_tag="SpyM3_0566"
FT   CDS             622596..624329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0566"
FT                   /product="putative glycerophosphodiester phosphodiesterase"
FT                   /note="best blastp hit: gb|AAK33769.1| (AE006534) putative
FT                   glycerophosphodiester phosphodiesterase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79173"
FT                   /db_xref="GOA:Q8K7X9"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7X9"
FT                   /protein_id="AAM79173.1"
FT                   /translation="MTFLSDLISLMTKIRLSWVIKAGIFQLLFVTIANIVLSEFFYFIL
FT                   DVTGQYHLDKDNVVTFLKNPIALALLGAYLFLLAAFIHLEFFALYRIIADQEISFYLFR
FT                   KQFSYYLRGLWKTFSGYQLLLFLLYILLTIPVLHIGLSSVITQKLYLPEFIVGELSKIT
FT                   STKYLLYGSLILVFYLNLRLVYFLPLIAINHRTVAQAWRESWQKTKKKHVLLWMKLFAI
FT                   NGLTLVVLSLAISMILIFVDMFNPKGNNIIVQLGALTFTWELIFFTTIFFKLCSAMILK
FT                   EAIEPQKQYDEPRRSNKAYVVIFIVVTVGFAYQSLERLTFFDTSHSKTVIAHRGLVSAG
FT                   VENSLEALEGAKKAGSDYVELDLILTKDNHFVVSHDNRLKRLAGVNKTIRNLTLKEVEY
FT                   LTSHQGHFSGRFVSFDTFYQKAKKLNMPLLIELKPIGTEPGNYVDLFLETYHRLGISKD
FT                   NKVMSLDLEVIEAIKKKNPSITTGYIIPIQFGFFGDEFVDFYVIEDFSYRSYLSSQAFW
FT                   NNKEIYVWTINDPKRIEHYLLKPIQGIITDQPALTNQLIKDLKQDNSYFSRLVRIISSL
FT                   Y"
FT   gene            624456..624728
FT                   /gene="rpsP"
FT                   /locus_tag="SpyM3_0567"
FT   CDS             624456..624728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="SpyM3_0567"
FT                   /product="30S ribosomal protein S16"
FT                   /note="best blastp hit: sp|P58124|RS16_STRPY 30S ribosomal
FT                   protein S16, and gb|AAK33770.1| (AE006534) 30S ribosomal
FT                   protein S16 [Streptococcus pyogenes M1GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79174"
FT                   /db_xref="GOA:P0DE76"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DE76"
FT                   /protein_id="AAM79174.1"
FT                   /translation="MAVKIRLTRMGSKKKPFYRINVADSRAPRDGRFIETVGTYNPLVA
FT                   ENQITIKEDRVLEWLSKGAQPSDTVRNILSKAGVMAKFHDQKFSK"
FT   gene            624738..624977
FT                   /locus_tag="SpyM3_0568"
FT   CDS             624738..624977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAK74914.1| (AE007384)
FT                   KH domain protein [Streptococcus pneumoniae TIGR4], and
FT                   gb|AAK99487.1| (AE008445) Conserved hypothetical protein
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79175"
FT                   /db_xref="GOA:Q7CF90"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CF90"
FT                   /protein_id="AAM79175.1"
FT                   /translation="MDTIENLIIAIVKPLISQPDNLTIKIEDTPDFLEYHLDLDAQDIG
FT                   RVIGKKGRTITAIRSIVYSVPTLGKKVRLVIDEK"
FT   gene            625937..628936
FT                   /locus_tag="SpyM3_0569"
FT   CDS             625937..628936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0569"
FT                   /product="putative surface antigen"
FT                   /note="best non-GAS blastp hit: gb|AAC82625.1| (AF054892)
FT                   surface antigen BspA [Bacteroides forsythus]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79176"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7X8"
FT                   /protein_id="AAM79176.1"
FT                   /translation="MTLTTVSVVTHNQEVFSLVKEPILKQTQASSSISGADYAESSGKS
FT                   KLKINETSGPVDDTVTDLFSDKRTTPEKIKDNLAKGPREQELKAVTENTESEKQITSGS
FT                   QLEQSKESLSLNKRVPSTSNWEICDFITKGNTLVGLSKSGVEKLSQTDHLVLPSQAADG
FT                   TQLIQVASFAFTPDKKTAIAEYTSRAGENGEISQLDVDGKEIINEGEVFNSYLLKKVTI
FT                   PTGYKHIGQDAFVDNKNIAEVNLPESLETISDYAFAHLALKQIDLPDNLKAIGELAFFD
FT                   NQITGKLSLPRQLMRLAERAFKSNHIKTIEFRGNSLKVIGEASFQDNDLSQLMLPDGLE
FT                   KIESEAFTGNPGDDHYNNRVVLWTKSGKNPYGLATENTYVNPDKSLWQESPEIDYTKWL
FT                   EEDFTYQKNSVTGFSSKGLQKVKRNKNLEIPKQHNGVTITEIGDNAFRNVDFQNKTLRK
FT                   YDLEEVKLPSTIRKIGAFAFQSNNLKSFEASDDLEEIKEGAFMNNRIETLELKDKLVTI
FT                   GDAAFHINHIYAIVLPESVQEIGRSAFRQNGANNLIFMGSKVKTIGEMAFLSNRLEHLD
FT                   LSEQKQLTEIPVQAFSDNALKEVLLPASLKTIREEAFKKNHLKQLEVASALSHIAFNAL
FT                   DDNDGDEQFDNKVVVKTHHNSYALADGEHFIVDPDKLSSTMVDLEKILKLIEGLDYSTL
FT                   RQTTQTQFRDMTTAGKALLSKSKLRQGEKQKFLQEAQFFLGRVDLDKAIAKAEKALVTK
FT                   KATKNGQLLGRSINKAVLAYNNSAIKKANVKRLEKELDLLTGLVEGKGPLAQATMVQGV
FT                   YLLKTPLPLPEYYIGLNVYFDKSGKLIYALDMSDTIGEGQKDAYGNPILNVDEDNEGYH
FT                   ALAVATLADYEGLDIKTILNSKLSQLTSIRQVPTAAYHRAGIFQAIQNAAAEAEQLLPK
FT                   PGTHSEKSSSSESANSKDRGLQSNPKTNRGRHSAILPRTGSKGSFVYGILGYTSVALLS
FT                   LIAAIKKKKY"
FT   gene            628956..629357
FT                   /locus_tag="SpyM3_0570"
FT   CDS             628956..629357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: pir||G69153 conserved
FT                   hypothetical protein MTH413 - Methanobacterium
FT                   thermoautotrophicum (strain Delta H)"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79177"
FT                   /db_xref="GOA:Q8K7X7"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7X7"
FT                   /protein_id="AAM79177.1"
FT                   /translation="MITQEMKDLINNQLAMVATVDAKGQPNIGPKRSMRLWDDKTFIYN
FT                   ENTDGQTRINIEDNGKIEIAFVDRERLLGYRFVGTAEIQTEGAYYEAAKKWAQGRMGAP
FT                   KAVGIIHVERIFNLQSGANAGKEINSESN"
FT   gene            complement(629537..630412)
FT                   /gene="czcD"
FT                   /locus_tag="SpyM3_0571"
FT   CDS             complement(629537..630412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcD"
FT                   /locus_tag="SpyM3_0571"
FT                   /product="putative cation-efflux system membrane protein"
FT                   /note="best blastp hit: gb|AAK33774.1| (AE006535) putative
FT                   cation-efflux system membrane protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79178"
FT                   /db_xref="GOA:Q8K7X6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7X6"
FT                   /protein_id="AAM79178.1"
FT                   /translation="MPASKKVTIIFILNLSFSLIEFIFGTLFFSGAILADAVHDFGDAI
FT                   AIGISAILERKAVKKESPNFSLGYKRFSLLGALTTNLILISGSLLVMIETIPKLWHPTI
FT                   VNYDGMFVLAIFAIIINGFASFIIHSNQTKNEEILSLHFLEDILGWLAIIILSLILKWK
FT                   PWYILDPLLSIAIASFILSKALPKLVATANIFLDGVPDSIDYCALHHELSQLPHIVSVN
FT                   QLNVWSMDGIDHRATIHCCLRKSTTEKHCKKSIRLICQRYNINSVTVEIDTSLNEHQHH
FT                   CSSLSSIEVN"
FT   gene            630548..631069
FT                   /locus_tag="SpyM3_0572"
FT   CDS             630548..631069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="best non-GAS blastp hit: gb|AAG09969.1|AF248037_4
FT                   (AF248037) unknown [Streptococcus agalactiae]; similar to
FT                   TetR family transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79179"
FT                   /db_xref="GOA:Q8K7X5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7X5"
FT                   /protein_id="AAM79179.1"
FT                   /translation="MTKDRQIKKTKTAIYSAFIALLQKKEYSKITVRDMITLANVGRST
FT                   FYAHYESKEMLQKELCEELFHHLFRQKRNVTFEDYLVHILKHFEQNKDSIATLLLSNDP
FT                   YFLLRFKNELEHDVYPNLRCKYIDKTTIPEVFLKQFVLSSFVETLKWWLHQRQRMSANE
FT                   LLKYYLELIK"
FT   gene            631284..631802
FT                   /gene="rimM"
FT                   /locus_tag="SpyM3_0573"
FT   CDS             631284..631802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="SpyM3_0573"
FT                   /product="putative 16S rRNA processing protein"
FT                   /note="best non-GAS blastp hit: gb|AAK99490.1| (AE008446)
FT                   16S rRNA processing protein RimM [Streptococcus pneumoniae
FT                   R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79180"
FT                   /db_xref="GOA:P0DF04"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DF04"
FT                   /protein_id="AAM79180.1"
FT                   /translation="MEYFNVGKIVNTQGLQGEMRVLSVSDFAEERFKKGSQLALFDDKD
FT                   RFVQEVTIVSHRKQKHFDIIKLKDMYHINAIEKYKGYTLKVSKDNQGDLQEGEFYYHQI
FT                   IGMAVYEKDRLIGYVKEILQPGANDVWVVKRQGKRDLLLPYIPPVVLNVDVPNKRVDVE
FT                   LMEGLDDED"
FT   gene            631792..632523
FT                   /gene="trmD"
FT                   /locus_tag="SpyM3_0574"
FT   CDS             631792..632523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="SpyM3_0574"
FT                   /product="putative tRNA (guanine-N1)-methyltransferase"
FT                   /note="best blastp hit: gb|AAK33777.1| (AE006535) putative
FT                   tRNA (guanine-N1)-methyltransferase [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79181"
FT                   /db_xref="GOA:P0DG20"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DG20"
FT                   /protein_id="AAM79181.1"
FT                   /translation="MKIDILTLFPEMFAPLEHSIVGKAKEKGLLDIHYHNFRDYAEKAR
FT                   HVDDEPYGGGQGMLLRAQPIFDTIEQIEAKKPRIILLDPAGKPFTQAYAEELALEEELI
FT                   FICGHYEGYDERIKTLVTDEISLGDFVLTGGELAAMTMVDATVRLIPQVLGKESSHQDD
FT                   SFSSGLLEYPQYTRPYDYRGMTVPDVLMSGHHERIRLWRLEESLRKTYLRRPDLLERYD
FT                   FSEEERKLLDKIKEALGQGED"
FT   gene            632523..633515
FT                   /locus_tag="SpyM3_0575"
FT   CDS             632523..633515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0575"
FT                   /product="putative thioredoxin reductase"
FT                   /note="best blastp hit: gb|AAK33778.1| (AE006535) putative
FT                   thioredoxin reductase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79182"
FT                   /db_xref="GOA:P0DB06"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DB06"
FT                   /protein_id="AAM79182.1"
FT                   /translation="MKDKAYDITIIGGGPIGLFAAFYAGLRGVTVKIIESLSELGGQPA
FT                   ILYPEKMIYDIPAYPSLTGAELTENLIKQLSRFEDRTTICLKEEVLTFDKVKGGFSIRT
FT                   NKAEHFSKAIIIACGNGAFAPRTLGLESEENFADHNLFYNVHQLDQFAGQKVVICGGGD
FT                   SAVDWALALEDIAESVTVVHRRDAFRAHEHSVELLKASTVNLLTPYVPKALKGIGNLAE
FT                   KLVIQKVKEDEVLELELDSLIVSFGFSTSNKNLKNWNLDYKRSSITVSPLFQTSQEGIF
FT                   AIGDAAAYNGKVDLIATGFGEAPTAVNQAINYIYPDRDNRVVHSTSLID"
FT   gene            633693..634751
FT                   /locus_tag="SpyM3_0576"
FT   CDS             633693..634751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0576"
FT                   /product="probable regulatory protein"
FT                   /note="best blastp hit: gb|AAK33779.1| (AE006535) probable
FT                   regulatory protein [Streptococcus pyogenes M1 GAS], similar
FT                   to regulatory protein (pfoS/R) [Treponema pallidum]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79183"
FT                   /db_xref="GOA:Q7CF89"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CF89"
FT                   /protein_id="AAM79183.1"
FT                   /translation="MTTTDKETFSSFMNKVLAGTAIAIVVALIPNAILATFLKPLLPNM
FT                   AAAEFLHIVQVFQFFTPIMAGFLIGQQFKFNPMQQLAVGGAAYIGSGAWAYTEVIQKGV
FT                   ATGTFQLRGIGDLINMMITASLAVLAVKYFGNKFGSLTIILLPITIGTGVGYIGWKFLP
FT                   YVSYVTTLIGQGINSFTTLQPILMSILIAVAFSLIIVSPISTVAIGLAIGLNGMAAGAA
FT                   SMGIASTAAVLVWATLKVNKSGVPIAIALGAMKMMMPNFLKHPIMAIPMVFTAAISSLT
FT                   VPLFNLVGTPASSGFGLVGAVGPIASLAGGSSILIIILAWIIVPFAVAFAAHKVSKDIL
FT                   KLYKEDIFVFEG"
FT   gene            634764..635687
FT                   /gene="apbA"
FT                   /locus_tag="SpyM3_0577"
FT   CDS             634764..635687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbA"
FT                   /locus_tag="SpyM3_0577"
FT                   /product="putative 2-dehydropantoate 2-reductase"
FT                   /note="best blastp hit: gb|AAK33780.1| (AE006535) putative
FT                   2-dehydropantoate 2-reductase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79184"
FT                   /db_xref="GOA:P0DC92"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DC92"
FT                   /protein_id="AAM79184.1"
FT                   /translation="MLVYIAGSGAMGCRFGYQISKTNNDVILLDNWEDHINAIKENGLV
FT                   VTGDVEETVKLPIMKPTEATQEADLIILFTKAMQLPQMLQDIKGIIGKETKVLCLLNGL
FT                   GHEDVIRQYIPEHNILMGVTVWTAGLEGPGRAHLQGVGALNLQSMDPSNQEAGHQVADL
FT                   LNEANLNATYDENVVPNIWRKACVNGTMNSTCALLDCTIGELFASEDGLKMVKEIIHEF
FT                   VIVGQAEGVELNEEEITQYVMDTSVKAAHHYPSMHQDLVQNHRLTEIDFINGAVNTKGE
FT                   KLGINTPYCRMITELVHAKEAVLNIQ"
FT   gene            635943..636656
FT                   /gene="fruR"
FT                   /locus_tag="SpyM3_0578"
FT   CDS             635943..636656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="SpyM3_0578"
FT                   /product="putative fructose operon transcriptional
FT                   repressor"
FT                   /note="best non-GAS blastp hit: gb|AAK99582.1| (AE008453)
FT                   Transcriptional repressor of the fructose operon
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79185"
FT                   /db_xref="GOA:Q7CF88"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CF88"
FT                   /protein_id="AAM79185.1"
FT                   /translation="MAKITEENYVSLEDLMQLLNSSESTIRRDLGELEQEGRLHRVHGG
FT                   AELFHSLQEELSNQEKSVKNSHIKKAIAQRASQLIYDNDVIFIDAGTTTEFLLPFLQAK
FT                   NLTVVTNSIHHAARLVELSIETIIVGGYVKQTTDASIGNVALEQIRQMNFDKAFLGMNG
FT                   VDDSYLTTPDMEEAVIKKAVLSNAKLAYILVDGTKIGQVSFVKVAPINDVTIITLGGSA
FT                   SILKQIKEKAKVIEL"
FT   gene            636776..637564
FT                   /gene="fruK"
FT                   /locus_tag="SpyM3_0579"
FT   CDS             636776..637564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="SpyM3_0579"
FT                   /product="putative fructose-1-phosphate kinase"
FT                   /note="best blastp hit: gb|AAK33782.1| (AE006535) putative
FT                   fructose-1-phosphate kinase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79186"
FT                   /db_xref="GOA:Q8K7X1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7X1"
FT                   /protein_id="AAM79186.1"
FT                   /translation="MSRILQRLDIASTATGFLGGFTGRFIEESLSAEGVKTDFVKGDQD
FT                   TRINVKIKSQEETELNGQGPIISREQLEELKTKLSQLTAEDTVVFAGSAPANLGNAVYK
FT                   ELLPLVRQSGAQVVCDFEGQTLIDALAYNPLLVKPNNHELEAIFGTILTSLDDVETYAR
FT                   RLLEMGAQNVIISMAGDGALLVTKEATYFAKPIKGEVKNSVGAGDSMVAGFTGEFMKSQ
FT                   NPIEALKWGVACGTATAFSDDLATIAFIKETYHKVEVEKR"
FT   gene            637561..639507
FT                   /gene="fruA"
FT                   /locus_tag="SpyM3_0580"
FT   CDS             637561..639507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruA"
FT                   /locus_tag="SpyM3_0580"
FT                   /product="putative fructose-specific enzyme II"
FT                   /note="PTS system BC component; best blastp hit:
FT                   gb|AAK33783.1| (AE006535) putative fructose-specific enzyme
FT                   II, PTS system BC component [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79187"
FT                   /db_xref="GOA:Q8K7X0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7X0"
FT                   /protein_id="AAM79187.1"
FT                   /translation="MKIQDLLRKDIMILDLQAISKEVAIDEMITKLVEKDIVHDFDVFK
FT                   KSIMTREEQTSTGLGDGIAMPHSKNIVVDKPAVLFAKSNKGVDYKALDGQPTDLFFMIA
FT                   APQGANDTHLAALAELSQYLLKDGFADKLRAAATPEAVIAVFDEASTAKEEVVAPTSGQ
FT                   DFIVAVTACPTGIAHTYMAEEALKKQAAEMGVAIKVETNGASGVANRLTAEDIQRAKGV
FT                   IVAADKAVEMDRFDGKQFIARPVADGIKKSQELISLILNNEGNTYHAKNGKSETAVSTE
FT                   KTSLGGAFYKHLMGGVSQMLPFVIGGGIMIALAFLLDNMLGVPNDQLGGLGSYHEIAAI
FT                   FMNIGGAAFSFMLPVLAGYIAYSIAEKPGLVAGFVAGAIASNGLAFGKVPFAAGGEVSL
FT                   GLTGVPSGFLGALVGGFLAGGVILALRKLLAGLPRSLEGVKSILLYPLLGVLVTGFLML
FT                   FVNIPMAAINTALNDFLQGLSGSSAVLMGLLVGGMMAVDMGGPVNKAAYVFGTGTLAAT
FT                   VANGGSVVMAAVMAGGMVPPLAVFVATLLFKDKFTKEERESGLTNIVMGLSFITEGAIP
FT                   FGAADPARAIPSFIAGSALTGALIGLAGIKLMAPHGGIFVIALTSNPILYLVFVVIGAL
FT                   VSGILFGALRKKA"
FT   gene            639606..640199
FT                   /locus_tag="SpyM3_0581"
FT   CDS             639606..640199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0581"
FT                   /product="putative peptidoglycan hydrolase"
FT                   /note="best blastp hit: gb|AAK33784.1| (AE006536) putative
FT                   peptidoglycan hydrolase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79188"
FT                   /db_xref="GOA:Q7CF87"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CF87"
FT                   /protein_id="AAM79188.1"
FT                   /translation="MKKRRRRAKSSVNRLVLGLVLLNLIVSMWTLKLGNQRLAPYADHE
FT                   TLTFVRKISHAAQSVAQKKQLYSSVMMAQAILESNNGKSQLSQKPYYNFFGIKGSYKER
FT                   SVIFPTLEDDGQGNLYQIDAAFRSYGSLTACFLDYARVLNDPLYDKTHKKFWSHYQDAT
FT                   ATLTGTYATDTTYHTKLNELIEWYQLTNFDGLMK"
FT   gene            640426..641058
FT                   /locus_tag="SpyM3_0582"
FT   CDS             640426..641058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SpyM3_0582"
FT                   /product="putative peptidoglycan hydrolase"
FT                   /note="best blastp hit: gb|AAK33785.1| (AE006536) putative
FT                   peptidoglycan hydrolase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SpyM3_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAM79189"
FT                   /db_xref="GOA:Q8K7W9"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K7W9"
FT                   /protein_id="