spacer

EBI Dbfetch

ID   AE005672; SV 3; circular; genomic DNA; STD; PRO; 2160842 BP.
XX
AC   AE005672; AE007318-AE007511;
XX
PR   Project:PRJNA277;
XX
DT   27-JAN-2006 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Streptococcus pneumoniae TIGR4, complete genome.
XX
KW   .
XX
OS   Streptococcus pneumoniae TIGR4
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RP   1-2160842
RX   DOI; 10.1126/science.1061217.
RX   PUBMED; 11463916.
RA   Tettelin H., Nelson K.E., Paulsen I.T., Eisen J.A., Read T.D., Peterson S.,
RA   Heidelberg J., DeBoy R.T., Haft D.H., Dodson R.J., Durkin A.S., Gwinn M.,
RA   Kolonay J.F., Nelson W.C., Peterson J.D., Umayam L.A., White O.,
RA   Salzberg S.L., Lewis M.R., Radune D., Holtzapple E., Khouri H., Wolf A.M.,
RA   Utterback T.R., Hansen C.L., McDonald L.A., Feldblyum T.V., Angiuoli S.,
RA   Dickinson T., Hickey E.K., Holt I.E., Loftus B.J., Yang F., Smith H.O.,
RA   Venter J.C., Dougherty B.A., Morrison D.A., Hollingshead S.K., Fraser C.M.;
RT   "Complete genome sequence of a virulent isolate of Streptococcus
RT   pneumoniae";
RL   Science 293(5529):498-506(2001).
XX
RN   [2]
RP   1-2160842
RA   Tettelin H., Nelson K.E., Paulsen I.T., Eisen J.A., Read T.D., Peterson S.,
RA   Heidelberg J., DeBoy R.T., Haft D.H., Dodson R.J., Durkin A.S., Gwinn M.,
RA   Kolonay J.F., Nelson W.C., Peterson J.D., Umayam L.A., White O.,
RA   Lewis M.R., Radune D., Holtzapple E., Khouri H., Wolf A.M., Utterback T.R.,
RA   Hansen C.L., McDonald L.A., Feldblyum T.V., Angiuoli S., Gesuwan P.,
RA   Hickey E.K., Holt I.E., Loftus B.J., Ujwal M.L., Yang F., Smith H.O.,
RA   Venter J.C., Dougherty B.A., Morrison D.A., Hollingshead S.K., Fraser C.M.;
RT   ;
RL   Submitted (29-JUN-2001) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-2160842
RA   Shumway M., Schobel S., Koo H., Dodson R., Tettelin H.;
RT   ;
RL   Submitted (26-JAN-2006) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [4]
RC   Sequence update by submitter
RP   1-2160842
RA   Tettelin H.;
RT   ;
RL   Submitted (03-JUL-2008) to the INSDC.
RL   Institute for Genome Sciences, Department of Microbiology and Immunology,
RL   University of Maryland School of Medicine, HSF-II, Room S245, 20 Penn
RL   Street, Rockville, MD 21201, USA
XX
DR   MD5; 50086819690b19b94ce37f1d75a7e539.
DR   BioSample; SAMN02604002.
DR   EnsemblGenomes-Gn; SP_2242.
DR   EnsemblGenomes-Gn; SP_2243.
DR   EnsemblGenomes-Gn; SP_2244.
DR   EnsemblGenomes-Gn; SP_2245.
DR   EnsemblGenomes-Gn; SP_2246.
DR   EnsemblGenomes-Gn; SP_2247.
DR   EnsemblGenomes-Gn; SP_2248.
DR   EnsemblGenomes-Gn; SP_2249.
DR   EnsemblGenomes-Gn; SP_2250.
DR   EnsemblGenomes-Gn; SP_2251.
DR   EnsemblGenomes-Gn; SP_2252.
DR   EnsemblGenomes-Gn; SP_2253.
DR   EnsemblGenomes-Gn; SP_2254.
DR   EnsemblGenomes-Gn; SP_2255.
DR   EnsemblGenomes-Gn; SP_2256.
DR   EnsemblGenomes-Gn; SP_2257.
DR   EnsemblGenomes-Gn; SP_2258.
DR   EnsemblGenomes-Gn; SP_2259.
DR   EnsemblGenomes-Gn; SP_2260.
DR   EnsemblGenomes-Gn; SP_2261.
DR   EnsemblGenomes-Gn; SP_2262.
DR   EnsemblGenomes-Gn; SP_2263.
DR   EnsemblGenomes-Gn; SP_2264.
DR   EnsemblGenomes-Gn; SP_2265.
DR   EnsemblGenomes-Gn; SP_2266.
DR   EnsemblGenomes-Gn; SP_2267.
DR   EnsemblGenomes-Gn; SP_2268.
DR   EnsemblGenomes-Gn; SP_2269.
DR   EnsemblGenomes-Gn; SP_2270.
DR   EnsemblGenomes-Gn; SP_2271.
DR   EnsemblGenomes-Gn; SP_2272.
DR   EnsemblGenomes-Gn; SP_2273.
DR   EnsemblGenomes-Gn; SP_2274.
DR   EnsemblGenomes-Gn; SP_2275.
DR   EnsemblGenomes-Gn; SP_2276.
DR   EnsemblGenomes-Gn; SP_2277.
DR   EnsemblGenomes-Gn; SP_2278.
DR   EnsemblGenomes-Gn; SP_2279.
DR   EnsemblGenomes-Gn; SP_2280.
DR   EnsemblGenomes-Gn; SP_2281.
DR   EnsemblGenomes-Gn; SP_2282.
DR   EnsemblGenomes-Gn; SP_2283.
DR   EnsemblGenomes-Gn; SP_2284.
DR   EnsemblGenomes-Gn; SP_2285.
DR   EnsemblGenomes-Gn; SP_2286.
DR   EnsemblGenomes-Gn; SP_2287.
DR   EnsemblGenomes-Gn; SP_2288.
DR   EnsemblGenomes-Gn; SP_2289.
DR   EnsemblGenomes-Gn; SP_2290.
DR   EnsemblGenomes-Gn; SP_2291.
DR   EnsemblGenomes-Gn; SP_2292.
DR   EnsemblGenomes-Gn; SP_2293.
DR   EnsemblGenomes-Gn; SP_2294.
DR   EnsemblGenomes-Gn; SP_2295.
DR   EnsemblGenomes-Gn; SP_2296.
DR   EnsemblGenomes-Gn; SP_2297.
DR   EnsemblGenomes-Gn; SP_2298.
DR   EnsemblGenomes-Gn; SP_2299.
DR   EnsemblGenomes-Tr; SP_2242.
DR   EnsemblGenomes-Tr; SP_2243.
DR   EnsemblGenomes-Tr; SP_2244.
DR   EnsemblGenomes-Tr; SP_2245.
DR   EnsemblGenomes-Tr; SP_2246.
DR   EnsemblGenomes-Tr; SP_2247.
DR   EnsemblGenomes-Tr; SP_2248.
DR   EnsemblGenomes-Tr; SP_2249.
DR   EnsemblGenomes-Tr; SP_2250.
DR   EnsemblGenomes-Tr; SP_2251.
DR   EnsemblGenomes-Tr; SP_2252.
DR   EnsemblGenomes-Tr; SP_2253.
DR   EnsemblGenomes-Tr; SP_2254.
DR   EnsemblGenomes-Tr; SP_2255.
DR   EnsemblGenomes-Tr; SP_2256.
DR   EnsemblGenomes-Tr; SP_2257.
DR   EnsemblGenomes-Tr; SP_2258.
DR   EnsemblGenomes-Tr; SP_2259.
DR   EnsemblGenomes-Tr; SP_2260.
DR   EnsemblGenomes-Tr; SP_2261.
DR   EnsemblGenomes-Tr; SP_2262.
DR   EnsemblGenomes-Tr; SP_2263.
DR   EnsemblGenomes-Tr; SP_2264.
DR   EnsemblGenomes-Tr; SP_2265.
DR   EnsemblGenomes-Tr; SP_2266.
DR   EnsemblGenomes-Tr; SP_2267.
DR   EnsemblGenomes-Tr; SP_2268.
DR   EnsemblGenomes-Tr; SP_2269.
DR   EnsemblGenomes-Tr; SP_2270.
DR   EnsemblGenomes-Tr; SP_2271.
DR   EnsemblGenomes-Tr; SP_2272.
DR   EnsemblGenomes-Tr; SP_2273.
DR   EnsemblGenomes-Tr; SP_2274.
DR   EnsemblGenomes-Tr; SP_2275.
DR   EnsemblGenomes-Tr; SP_2276.
DR   EnsemblGenomes-Tr; SP_2277.
DR   EnsemblGenomes-Tr; SP_2278.
DR   EnsemblGenomes-Tr; SP_2279.
DR   EnsemblGenomes-Tr; SP_2280.
DR   EnsemblGenomes-Tr; SP_2281.
DR   EnsemblGenomes-Tr; SP_2282.
DR   EnsemblGenomes-Tr; SP_2283.
DR   EnsemblGenomes-Tr; SP_2284.
DR   EnsemblGenomes-Tr; SP_2285.
DR   EnsemblGenomes-Tr; SP_2286.
DR   EnsemblGenomes-Tr; SP_2287.
DR   EnsemblGenomes-Tr; SP_2288.
DR   EnsemblGenomes-Tr; SP_2289.
DR   EnsemblGenomes-Tr; SP_2290.
DR   EnsemblGenomes-Tr; SP_2291.
DR   EnsemblGenomes-Tr; SP_2292.
DR   EnsemblGenomes-Tr; SP_2293.
DR   EnsemblGenomes-Tr; SP_2294.
DR   EnsemblGenomes-Tr; SP_2295.
DR   EnsemblGenomes-Tr; SP_2296.
DR   EnsemblGenomes-Tr; SP_2297.
DR   EnsemblGenomes-Tr; SP_2298.
DR   EnsemblGenomes-Tr; SP_2299.
DR   EuropePMC; PMC1196152; 16109966.
DR   EuropePMC; PMC135229; 12142426.
DR   EuropePMC; PMC141814; 12486041.
DR   EuropePMC; PMC1855836; 17277061.
DR   EuropePMC; PMC187332; 12933834.
DR   EuropePMC; PMC1951257; 17537936.
DR   EuropePMC; PMC1976330; 17941709.
DR   EuropePMC; PMC2168654; 17675389.
DR   EuropePMC; PMC2168755; 17766420.
DR   EuropePMC; PMC2223752; 17981977.
DR   EuropePMC; PMC2446756; 18424523.
DR   EuropePMC; PMC2636762; 19171050.
DR   EuropePMC; PMC2648205; 19114491.
DR   EuropePMC; PMC2657157; 19175920.
DR   EuropePMC; PMC2663135; 19139197.
DR   EuropePMC; PMC2705793; 19603075.
DR   EuropePMC; PMC3018475; 21264340.
DR   EuropePMC; PMC3043496; 21147955.
DR   EuropePMC; PMC3178606; 21966432.
DR   EuropePMC; PMC3187249; 21825065.
DR   EuropePMC; PMC3279804; 22347584.
DR   EuropePMC; PMC3318431; 22311922.
DR   EuropePMC; PMC3318815; 22307284.
DR   EuropePMC; PMC3375284; 22719250.
DR   EuropePMC; PMC3535946; 23114782.
DR   EuropePMC; PMC3571320; 23264576.
DR   EuropePMC; PMC3578082; 23168398.
DR   EuropePMC; PMC3580495; 23158461.
DR   EuropePMC; PMC4097588; 24816604.
DR   EuropePMC; PMC4187955; 25070090.
DR   EuropePMC; PMC4243769; 25163487.
DR   EuropePMC; PMC4380333; 25826208.
DR   EuropePMC; PMC95544; 11717254.
DR   GOA; P0A3R3.
DR   InterPro; IPR005748; DNA_mismatch_repair_MutS-1.
DR   InterPro; IPR007695; DNA_mismatch_repair_MutS-lik_N.
DR   InterPro; IPR007860; DNA_mmatch_repair_MutS_con_dom.
DR   InterPro; IPR007861; DNA_mismatch_repair_MutS_clamp.
DR   InterPro; IPR016151; DNA_mismatch_repair_MutS_N.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01335; CRISPR-DR22.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; AE005672.
DR   SILVA-SSU; AE005672.
DR   StrainInfo; 352345; 0.
DR   UniProtKB/Swiss-Prot; P0A3R3; HEXA_STRPN.
XX
CC   On Jul 3, 2008 this sequence version replaced gi:85720550.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2160842
FT                   /organism="Streptococcus pneumoniae TIGR4"
FT                   /strain="TIGR4; ATCC BAA-334"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:170187"
FT   gene            197..1558
FT                   /gene="dnaA"
FT                   /locus_tag="SP_0001"
FT   CDS             197..1558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SP_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by similarity to SP:P35891; match to
FT                   protein family HMM PF00308; match to protein family HMM
FT                   TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74194"
FT                   /db_xref="GOA:O08397"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08397"
FT                   /protein_id="AAK74194.1"
FT                   /translation="MKEKQFWNRILEFAQERLTRSMYDFYAIQAELIKVEENVATIFLP
FT                   RSEMEMVWEKQLKDIIVVAGFEIYDAEITPHYIFTKPQDTTSSQVEEATNLTLYNYSPK
FT                   LVSIPYSDTGLKEKYTFDNFIQGDGNVWAVSAALAVSEDLALTYNPLFIYGGPGLGKTH
FT                   LLNAIGNEILKNIPNARVKYIPAESFINDFLDHLRLGEMEKFKKTYRSLDLLLIDDIQS
FT                   LSGKKVATQEEFFNTFNALHDKQKQIVLTSDRSPKHLEGLEERLVTRFSWGLTQTITPP
FT                   DFETRIAILQSKTEHLGYNFQSDTLEYLAGQFDSNVRDLEGAINDITLIARVKKIKDIT
FT                   IDIAAEAIRARKQDVSQMLVIPIDKIQTEVGNFYGVSIKEMKGSRRLQNIVLARQVAMY
FT                   LSRELTDNSLPKIGKEFGGKDHTTVIHAHAKIKSLIDQDDNLRLEIESIKKKIK"
FT   gene            1717..2853
FT                   /gene="dnaN"
FT                   /locus_tag="SP_0002"
FT   CDS             1717..2853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SP_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74195"
FT                   /db_xref="GOA:O06672"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="PDB:2AWA"
FT                   /db_xref="UniProtKB/Swiss-Prot:O06672"
FT                   /protein_id="AAK74195.1"
FT                   /translation="MIHFSINKNLFLQALNTTKRAISSKNAIPILSTVKIDVTNEGITL
FT                   IGSNGQISIENFISQKNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQI
FT                   VLTSGKSEITLKGKDSEQYPRIQEISASTPLILETKLLKKIINETAFAASTQESRPILT
FT                   GVHFVLSQHKELKTVATDSHRLSQKKLTLEKNSDDFDVVIPSRSLREFSAVFTDDIETV
FT                   EIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSMERARLL
FT                   SSATQNGTVKLEIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKA
FT                   LNSEKVTISFISAVRPFTLVPADTDEDFMQLITPVRTN"
FT   gene            2864..3112
FT                   /locus_tag="SP_0003"
FT   CDS             2864..3112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0003"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74196"
FT                   /protein_id="AAK74196.1"
FT                   /translation="MSLARLFYDIIEKEKESSMYQVGNFVEMKKSHACTIKSTGKKANR
FT                   WEITRVGADIKIKCSNCEHVVMMGRYDFERKMNKIID"
FT   gene            3196..4311
FT                   /locus_tag="SP_0004"
FT   CDS             3196..4311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0004"
FT                   /product="GTP-binding protein"
FT                   /note="identified by similarity to EGAD:13306; match to
FT                   protein family HMM PF06071; match to protein family HMM
FT                   TIGR00092"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74197"
FT                   /protein_id="AAK74197.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTEMITPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPLADIDTINLELILADLESVNKRYARVEKMARTQKDKES
FT                   VAEFNVLQKIKPVLEDGKSARTIEFTDEEQKVVKGLFLLTTKPVLYVANVDEDVVSEPD
FT                   SIDYVKQIREFAATENAEVVVISARAEEEISELNDEDKKEFLEAIGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGMKAPQAAGIIHSDFEKGFIRAVTMSYEDLVKYGS
FT                   EKAVKEAGRLREEGKEYIVQDGDIMEFRFNV"
FT   gene            4382..4951
FT                   /gene="pth"
FT                   /locus_tag="SP_0005"
FT   CDS             4382..4951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SP_0005"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74198"
FT                   /db_xref="GOA:Q97TD1"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97TD1"
FT                   /protein_id="AAK74198.1"
FT                   /translation="MTKLLVGLGNPGDKYFETKHNVGFMLIDQLAKKQNVTFTHDKIFQ
FT                   ADLASFFLNGEKIYLVKPTTFMNESGKAVHALLTYYGLDIDDLLIIYDDLDMEVGKIRL
FT                   RAKGSAGGHNGIKSIIQHIGTQVFNRVKIGIGRPKNGMSVVHHVLSKFDRDDYIGILQS
FT                   VDKVDDSVNYYLQEKNFEKTMQRYNG"
FT   gene            4952..8461
FT                   /gene="mfd"
FT                   /locus_tag="SP_0006"
FT   CDS             4952..8461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="SP_0006"
FT                   /product="transcription-repair coupling factor"
FT                   /note="identified by similarity to EGAD:8856; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM PF02559; match to
FT                   protein family HMM PF03461; match to protein family HMM
FT                   PF04851; match to protein family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74199"
FT                   /protein_id="AAK74199.1"
FT                   /translation="MVTLLDLFSENDQIKKWHQNLTDKKRQLILGLSTSTKALAIASSL
FT                   EKEDRIVLLTSTYGEAEGLVSDLISILGEELVYPFLVDDAPMVEFLMSSQEKIISRVEA
FT                   LRFLTDSSKKGILVCNIAASRLILPSPNAFKDSIVKISVGEEYDQHAFIHQLKENGYRK
FT                   VTQVQTQGEFSLRGDILDIFEISQLEPCRIEFFGDEIDGIRSFEVETQLSKENKTELTI
FT                   FPASDMLLREKDYQRGQSALEKQISKTLSPILKSYLEEILSSFHQKQSHADSRKFLSLC
FT                   YDKTWTVFDYIEKDTPIFFDDYQKLMNQYEVFERDLAQYFTEELQNSKAFSDMQYFSDI
FT                   EQIYKKQSPVTFFSNLQKGLGNLKFDKIYQFNQYPMQEFFNQFSFLKEEIERYKKMDYT
FT                   IILQSSNSMGSKTLEDMLEEYQIKLDSRDKTNICKESVNLIEGNLRHGFHFVDEKILLI
FT                   TEHEIFQKKLKRRFRRQHVSNAERLKDYNELEKGDYVVHHIHGIGQYLGIETIEIKGIH
FT                   RDYVSVQYQNGDQISIPVEQIHLLSKYISSDGKAPKLNKLNDGHFKKAKQKVKNQVEDI
FT                   ADDLIKLYSERSQLKGFAFSADDDDQDAFDDAFPYVETDDQLRSIEEIKRDMQASQPMD
FT                   RLLVGDVGFGKTEVAMRAAFKAVNDHKQVVILVPTTVLAQQHYTNFKERFQNFAVNIDV
FT                   LSRFRSKKEQTATLEKLKNGQVDILIGTHRVLSKDVVFADLGLMIIDEEQRFGVKHKET
FT                   LKELKKQVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLEKNDSVIRD
FT                   AVLREMERGGQVYYLYNKVDTIVQKVSELQELIPEASIGYVHGRMSEVQLENTLLDFIE
FT                   GQYDILVTTTIIETGVDIPNANTLFIENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRP
FT                   EKSISEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNLLGKSQSGFIDSVGFELYSQ
FT                   LLEEAIAKRNGNANANTRTKGNAELILQIDAYLPDTYISDQRHKIEIYKKIRQIDNRVN
FT                   YEELQEELIDRFGEYPDVVAYLLEIGLVKSYLDKVFVQRVERKDNKITIQFEKVTQRLF
FT                   LAQDYFKALSVTNLKAGIAENKGLMELVFDVQNKKDYEILEGLLIFGESLLEIKESKEE
FT                   NSI"
FT   gene            8519..8785
FT                   /locus_tag="SP_0007"
FT   CDS             8519..8785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0007"
FT                   /product="S4 domain protein"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74200"
FT                   /db_xref="GOA:P64405"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64405"
FT                   /protein_id="AAK74200.1"
FT                   /translation="MRLDKYLKVSRIIKRRTVAKEVADKGRIKVNGILAKSSTDLKVND
FT                   QVEIRFGNKLLLVKVLEMKDSTKKEDAAGMYEIISETRVEENV"
FT   gene            8778..9146
FT                   /locus_tag="SP_0008"
FT   CDS             8778..9146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0008"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74201"
FT                   /protein_id="AAK74201.1"
FT                   /translation="MSKNIVQLNNSFIQNEYQRRRYLMKERQKRNRFMGGVLILIMLLF
FT                   ILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKLKDEDYAAKYTRAKY
FT                   YYSKSREKVYTIPDLLQR"
FT   gene            9151..9273
FT                   /locus_tag="SP_0009"
FT   CDS             9151..9273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0009"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74202"
FT                   /protein_id="AAK74202.1"
FT                   /translation="MENLLDVIEQFLSLSDEKLEELADKNQLLRLQEEKERKNA"
FT   gene            9266..10534
FT                   /locus_tag="SP_0010"
FT   CDS             9266..10534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0010"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to EGAD:137176"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74203"
FT                   /protein_id="AAK74203.1"
FT                   /translation="MRKFLIILLLPSFLTISKVVSTEKEVVYTSKEIYYLSQSDFGIYF
FT                   REKLSSPMVYGEVPVYANEDLVVESGKLTPKTSFQITEWRLNKQGIPVFKLSNHQFIAA
FT                   DKRFLYDQSEVTPTIKKVWLESDFKLYNSPYDLKEVKSSLSAYSQVSIDKTMFVEGREF
FT                   LHIDQAGWVAKESTSEEDNRMSKVQEMLSEKYQKDSFSIYVKQLTTGKEAGINQDEKMY
FT                   AASVLKLSYLYYTQEKINEGLYQLDTTVKYVSAVNDFPGSYKPEGSGSLPKKEDNKEYS
FT                   LKDLITKVSKESDNVAHNLLGYYISNQSDATFKSKMSAIMGDDWDPKEKLISSKMAGKF
FT                   MEAIYNQNGFVLESLTKTDFDSQRIAKGVSVKVAHKIGDADEFKHDTGVVYADSPFILS
FT                   IFTKNSDYDTISKIAKDVYEVLK"
FT   gene            10531..11808
FT                   /gene="tilS"
FT                   /locus_tag="SP_0011"
FT   CDS             10531..11808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="SP_0011"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.-.-.-"
FT                   /note="identified by similarity to EGAD:164925; match to
FT                   protein family HMM PF01171; match to protein family HMM
FT                   TIGR02432; match to protein family HMM TIGR02433"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74204"
FT                   /db_xref="GOA:Q97TC5"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97TC5"
FT                   /protein_id="AAK74204.1"
FT                   /translation="MREPDFLNHFLKKGYFKKHAKAVLALSGGLDSMFLFKVLSTYQKE
FT                   LEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFSEARARNFRYDFFQ
FT                   EVMKKTGATALVTAHHADDQVETIFMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQ
FT                   KKDFPSIFHFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYDLAIA
FT                   ELSNNINVEDLQQLFSYSESTQRVLLQTYLNRFPDLNLTKAQFAEVQQILKSKSQYRHP
FT                   IKNGYELIKEYQQFQICKISPQADEKEDELVLHYQNQVAYQGYLFSFGLPLEGELIQQI
FT                   PVSRETSIHIRHRKTGDVLIKNGHRKKLRRLFIDLKIPMEKRNSALIIEQFGEIVSILG
FT                   IATNNLSKKTKNDIMNTVLYIEKIDR"
FT   gene            11812..12354
FT                   /gene="hpt"
FT                   /locus_tag="SP_0012"
FT   CDS             11812..12354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SP_0012"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="identified by similarity to EGAD:8043; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74205"
FT                   /db_xref="GOA:Q97TC4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97TC4"
FT                   /protein_id="AAK74205.1"
FT                   /translation="MLENDIKKVLVSHDEITEAAKKLGAQLTKDYAGKNPILVGILKGS
FT                   IPFMAELVKHIDTHIEMDFMMVSSYHGGTASSGVINIKQDVTQDIKGRHVLFVEDIIDT
FT                   GQTLKNLRDMFKEREAASVKIATLLDKPEGRVVEIEADYTCFTIPNEFVVGYGLDYKEN
FT                   YRNLPYIGVLKEEVYSN"
FT   gene            12370..14328
FT                   /gene="ftsH"
FT                   /locus_tag="SP_0013"
FT   CDS             12370..14328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="SP_0013"
FT                   /product="cell division protein FtsH"
FT                   /note="identified by similarity to EGAD:13183; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF01434; match to protein family HMM PF06480; match to
FT                   protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74206"
FT                   /db_xref="GOA:O69076"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:O69076"
FT                   /protein_id="AAK74206.1"
FT                   /translation="MKKQNNGLIKNPFLWLLFIFFLVTGFQYFYSGNNSGGSQQINYTE
FT                   LVQEITDGNVKELTYQPNGSVIEVSGVYKNPKTSKEETGIQFFTPSVTKVEKFTSTILP
FT                   ADTTVSELQKLATDHKAEVTVKHESSSGIWINLLVSIVPFGILFFFLFSMMGNMGGGNG
FT                   RNPMSFGRSKAKAANKEDIKVRFSDVAGAEEEKQELVEVVEFLKDPKRFTKLGARIPAG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAAPA
FT                   IIFIDEIDAVGRQRGVGLGGGNDEREQTLNQLLIEMDGFEGNEGIIVIAATNRSDVLDP
FT                   ALLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAEDVDLKLVAQQTPGFVGADLENV
FT                   LNEAALVAARRNKSIIDASDIDEAEDRVIAGPSKKDKTVSQKERELVAYHEAGHTIVGL
FT                   VLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDMKEQLAGLMGGRVAEEIIFNV
FT                   QTTGASNDFEQATQMARAMVTEYGMSEKLGPVQYEGNHAMLGAQSPQKSISEQTAYEID
FT                   EEVRSLLNEARNKAAEIIQSNRETHKLIAEALLKYETLDSTQIKALYETGKMPEAVEEE
FT                   SHALSYDEVKSKMNDEK"
FT   gene            14450..14929
FT                   /gene="comX1"
FT                   /locus_tag="SP_0014"
FT   CDS             14450..14929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comX1"
FT                   /locus_tag="SP_0014"
FT                   /product="transcriptional regulator ComX1"
FT                   /note="identified by similarity to GP:5739312"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74207"
FT                   /protein_id="AAK74207.1"
FT                   /translation="MIKELYEEVQGTVYKCRNEYYLHLWELSDWEQEGMLCLHELISRE
FT                   EGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRRYDKEPYEEVGEISHRISEGGLWLD
FT                   DYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH"
FT   gene            15023..15094
FT                   /locus_tag="SP_2242"
FT   tRNA            15023..15094
FT                   /locus_tag="SP_2242"
FT                   /product="tRNA-Glu"
FT   gene            16945..17017
FT                   /locus_tag="SP_2243"
FT   tRNA            16945..17017
FT                   /locus_tag="SP_2243"
FT                   /product="tRNA-Ala"
FT   gene            20241..20314
FT                   /locus_tag="SP_2244"
FT   tRNA            20241..20314
FT                   /locus_tag="SP_2244"
FT                   /product="tRNA-Asn"
FT   gene            20404..20820
FT                   /locus_tag="SP_0015"
FT   CDS             20404..20820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0015"
FT                   /product="IS630-Spn1, transposase Orf1"
FT                   /note="identified by similarity to GP:4200438; match to
FT                   protein family HMM PF01710"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74208"
FT                   /protein_id="AAK74208.1"
FT                   /translation="MWYNLLMAYSIDFRKKVLSYCERIGSITEASHVFQISRNTIYGWL
FT                   KLKEKTGELNHQVKGTKPRKVDRDRLKNYLTDNPDAYLTEIASEFGCHPTTIHYTLKAM
FT                   GYTRKKNHTYYEQDPEKVALFLKNFNSLKHLAPV"
FT   gene            20929..21267
FT                   /locus_tag="SP_0016"
FT   CDS             20929..21267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0016"
FT                   /product="IS630-Spn1, transposase Orf2"
FT                   /note="identified by similarity to GP:5019553"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74209"
FT                   /protein_id="AAK74209.1"
FT                   /translation="MVAGLTNGELIAPMTYEETMTSDFFEAWFQNFLLPTLNTPSVIIM
FT                   DNVRFHRMGKLELLCEEFGHKLLPLPPYSPEYNPIEKTWAHIKKHLKKVLPSCNTFYEA
FT                   FLSCSCFN"
FT   gene            complement(21302..22048)
FT                   /pseudo
FT                   /locus_tag="SP_0017"
FT                   /note="IS1167, transposase, degenerate; this gene contains
FT                   a frame shift which is not the result of sequencing error;
FT                   identified by similarity to GP:2804700"
FT   gene            22359..22601
FT                   /locus_tag="SP_0018"
FT   CDS             22359..22601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0018"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74210"
FT                   /protein_id="AAK74210.1"
FT                   /translation="MIMLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLV
FT                   RYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC"
FT   gene            22832..24118
FT                   /gene="purA"
FT                   /locus_tag="SP_0019"
FT   CDS             22832..24118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="SP_0019"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="identified by match to protein family HMM PF00709;
FT                   match to protein family HMM TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74211"
FT                   /db_xref="GOA:P65887"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65887"
FT                   /protein_id="AAK74211.1"
FT                   /translation="MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVI
FT                   DGKKFKLHLIPSGIFFPEKISVIGNGMVVNPKSLVKELSYLHEEGVTTDNLRISDRAHV
FT                   ILPYHIELDRLQEEAKGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERN
FT                   LAEKNRLFEKLYDSKAIVFDDIFEEYYEYGQQIKKYVIDTSVILNDALDNGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTEL
FT                   FDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTV
FT                   KICVAYDLDGQRIDYYPASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRR
FT                   VSELVGVRISTFSVGPGREQTNILESVWS"
FT   gene            24319..24786
FT                   /locus_tag="SP_0020"
FT   CDS             24319..24786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0020"
FT                   /product="cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74212"
FT                   /protein_id="AAK74212.1"
FT                   /translation="MYYTLEEKEVFMREALREAEIALEHDEIPIGCVIVKDGEIIGRGH
FT                   NAREELQRAVMHAEIMAIEDANLSEESWRLLDCTLFVTIEPCVMCSGAIGLARIPNVVY
FT                   GAKNQKFGAAGSLYNILTDERLNHRVEVEIGILEDECAAIMQDFFRNRRKK"
FT   gene            24973..25416
FT                   /locus_tag="SP_0021"
FT   CDS             24973..25416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0021"
FT                   /product="putative deoxyuridine 5'triphosphate
FT                   nucleotidohydrolase"
FT                   /note="identified by similarity to EGAD:16349; match to
FT                   protein family HMM PF00692"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74213"
FT                   /protein_id="AAK74213.1"
FT                   /translation="MKIRGFELVSSFTDENLLPKRETAHAAGYDLKVAVRTVVAPGEIV
FT                   LVPTGVKAYMQPTEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPGNEGHIFAQMKN
FT                   ITDQEVVLEVGERIVQAVFATFLIADGDAADGVRTGGFGSTGH"
FT   gene            25418..25933
FT                   /locus_tag="SP_0022"
FT   CDS             25418..25933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:6453629; match to
FT                   protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74214"
FT                   /protein_id="AAK74214.1"
FT                   /translation="MKIIFVRHGEPDYRELEERSYIGFGIDLAPLSEMGRQQVQKLSKN
FT                   PLLSSAEIIVSSAVTRALETASYVVCATGLPLRVEPLLHEWQVYKTGIENFETARRLFL
FT                   ENKGELLPNSPIQYETATEMKSRFLECMSKYREHQTVVVVAHRMLMRQFVPNEKIDFCQ
FT                   VIECELEI"
FT   gene            25917..27308
FT                   /pseudo
FT                   /gene="radA"
FT                   /locus_tag="SP_0023"
FT                   /note="DNA repair protein RadA, authentic point mutation;
FT                   this gene contains a premature stop which is not the result
FT                   of sequencing error"
FT   gene            27381..27878
FT                   /locus_tag="SP_0024"
FT   CDS             27381..27878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:5689965; match to
FT                   protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74215"
FT                   /protein_id="AAK74215.1"
FT                   /translation="MSYFEQFMQANQAYVALHGQLNLPLKPKTRVAIVTCMDSRLHVAQ
FT                   ALGLALGDAHILRNAGGRVTEDMIRSLVISQQQMGTREIVVLHHTDCGAQTFENEPFQE
FT                   YLKEELGVDVSDQDFLPFQDIEESVREDMQLLIESPLIPDDVIISGAIYNVDTGSMTVV
FT                   EL"
FT   gene            27903..28112
FT                   /locus_tag="SP_0025"
FT   CDS             27903..28112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0025"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74216"
FT                   /protein_id="AAK74216.1"
FT                   /translation="MKKSNILFIFILLLCIGLQYETIYYTDGSRSGAEYGLMGVSIFLA
FT                   LFYMIPALYFLFRIGKNGNCQRRF"
FT   gene            28094..28717
FT                   /locus_tag="SP_0026"
FT   CDS             28094..28717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0026"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74217"
FT                   /protein_id="AAK74217.1"
FT                   /translation="MPKKVLILSLLGGMFLSGWLSSFANTYIHDLLGVLFPDSPFLNAF
FT                   ESAIAAPLVEEPLKLLSLVFVLALIPVRKLKSLFLLGIASGLGFQMIKDIGYIRTDLPE
FT                   GFDFTISRILERIISGIASHWTFSGLAVVGVYLLYRAYKGQKVGKKQGLIFLGLALGTH
FT                   FLFNSPFVELETELPLAIPVVTAIALYGFYHAYCFVEKHNELMT"
FT   gene            28862..29830
FT                   /gene="prsA-1"
FT                   /locus_tag="SP_0027"
FT   CDS             28862..29830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA-1"
FT                   /locus_tag="SP_0027"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74218"
FT                   /db_xref="GOA:P65239"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65239"
FT                   /protein_id="AAK74218.1"
FT                   /translation="MSFSDLKLFALSSNKELAERVAQEIGIELGKSSVRQFSDGEIQVN
FT                   IEESIRGKHVFILQSTSSPVNDNLLEILIMVDALKRASAESVNVVMPYYGYARQDRKAR
FT                   AREPITSKLVANMLEVAGVDRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERRGMV
FT                   GSDYVVVSPDHGGVTRARKLAEFLKTSIAIIDKRRSVDKMNTSEVMNIIGKVEGKTCIL
FT                   IDDMIDTAGTICHAADALAEAGAVEVYASCTHPVLSGPATDNIQKSAIKKLVVLDTIYL
FT                   PEERLIDKIEQISIAHLLGDAIVRIHEKRPLSPLFDIEKKI"
FT   gene            complement(29964..30245)
FT                   /pseudo
FT                   /locus_tag="SP_0028"
FT                   /note="IS1167, transposase, truncation; comparison of this
FT                   gene to its homologs suggests this gene has been truncated;
FT                   identified by similarity to GP:2804700"
FT   gene            complement(30372..30605)
FT                   /locus_tag="SP_0029"
FT   CDS             complement(30372..30605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0029"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74219"
FT                   /protein_id="AAK74219.1"
FT                   /translation="MFSQLHMREEQVLLAQDYALETARAEGLEQGLERGKVEGRAERKL
FT                   FAFLDIVRQGLLTSEVASQQLGMSVSEFEALL"
FT   gene            complement(30563..30889)
FT                   /gene="ccs16"
FT                   /locus_tag="SP_0030"
FT   CDS             complement(30563..30889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccs16"
FT                   /locus_tag="SP_0030"
FT                   /product="competence-induced protein Ccs16"
FT                   /note="identified by similarity to GP:1469653"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74220"
FT                   /protein_id="AAK74220.1"
FT                   /translation="MDSNYFSDDLAFHSFSMREDTTGEVLAITNNGQENHLVKMAFLEL
FT                   KNTEKPAKTRFASHGWSFSATSPLPSNRNEPLPKQINCWTTRAGPRRTGKCLVNYICEK
FT                   NKSC"
FT   gene            complement(30929..31243)
FT                   /locus_tag="SP_0031"
FT   CDS             complement(30929..31243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0031"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74221"
FT                   /protein_id="AAK74221.1"
FT                   /translation="MIAKKIFSNPEITCQFIRDMLDLPAKNVTILEGSDIHVLLSMPYS
FT                   VQDFYTSIDVLAELDNGTQVIIEIQVHHQNFFINHLWAYLCSQVNQNLEKIRQREGDTH
FT                   "
FT   gene            31535..34168
FT                   /gene="polA"
FT                   /locus_tag="SP_0032"
FT   CDS             31535..34168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="SP_0032"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to EGAD:14065; match to
FT                   protein family HMM PF00476; match to protein family HMM
FT                   PF01367; match to protein family HMM PF02739; match to
FT                   protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74222"
FT                   /db_xref="GOA:P59199"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59199"
FT                   /protein_id="AAK74222.1"
FT                   /translation="MDKKKLLLIDGSSVAFRAFFALYQQLDRFKNVAGLHTNAIYGFQL
FT                   MLSHLLERVEPSHILVAFDAGKTTFRTEMYADYKGGRAKTPDEFREQFPFIRELLDHMG
FT                   IRHYDLAQYEADDIIGTLDKLAEQDGFDITIVSGDKDLIQLTDEHTVVEISKKGVAEFE
FT                   AFTPDYLMEEMGLTPAQFIDLKALMGDKSDNIPGVTKVGEKTGIKLLLEHGSLEGIYEN
FT                   IDGMKTSKMKENLINDKEQAFLSKTLATIDTKAPIAIGLEDLVYSGPDVENLGKFYDEM
FT                   GFKQLKQALNVSSADVSESLDFTIVDQISQDMLSEESIFHFELFGENYHTDNLVGFVWS
FT                   CGDKLYATDKLELLQDPIFKDFLEKTSLRVYDFKKVKVLLQRFGVDLQAPAFDIRLAKY
FT                   LLSTVEDNEIATIASLYGQTYLVDDETFYGKGVKKAIPEREKFLEHLACKLAVLVETEP
FT                   ILLEKLSENGQLELLYDMEQPLAFVLAKMEIAGIMVKKETLLEMQAENELVIEKLTQEI
FT                   YELAGEEFNVNSPKQLGVLLFEKLGLPLEYTKKTKTGYSTAVDVLERLAPIAPIVKKIL
FT                   DYRQIAKIQSTYVIGLQDWILADGKIHTRYVQDLTQTGRLSSVDPNLQNIPARLEQGRL
FT                   IRKAFVPEWEDSVLLSSDYSQIELRVLAHISKDEHLIKAFQEGADIHTSTAMRVFGIER
FT                   PDDVTANDRRNAKAVNFGVVYGISDFGLSNNLGISRKEAKAYIDTYFERFPGIKNYMDE
FT                   VVREARDKGYVETLFKRRRELPDINSRNFNIRGFAERTAINSPIQGSAADILKIAMIQL
FT                   DKALVAGGYQTKMLLQVHDEIVLEVPKSELVEMKKLVKQTMEEAIQLSVPLIADENEGA
FT                   TWYEAK"
FT   gene            34253..34690
FT                   /locus_tag="SP_0033"
FT   CDS             34253..34690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:109076; match to
FT                   protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74223"
FT                   /protein_id="AAK74223.1"
FT                   /translation="MSQEFINPSDGVIRQYLATSKTLAVVGLSDREETTSNRVTKEMQA
FT                   RGYKIIPVNPKAAGGEILGEKAYASLAEIPFPVDIVNVYRRSEFLPDVARDFLKADAKI
FT                   FWAQLGLESLEAKEILRDGGCDDIVMNRCIKREHTRLIEEA"
FT   gene            complement(35009..36019)
FT                   /locus_tag="SP_0034"
FT   CDS             complement(35009..36019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0034"
FT                   /product="membrane protein"
FT                   /note="identified by similarity to GP:6968434; match to
FT                   protein family HMM PF03601"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74224"
FT                   /db_xref="GOA:Q97TA9"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97TA9"
FT                   /protein_id="AAK74224.1"
FT                   /translation="MSFLSKNGAGILACLLISILSWYLGGFFPVVGAPVFAIFIGMLLH
FT                   PFLSSYKQLDAGLTFSSKKLLQYAVVLLGFGLNISQVFAVGQSSLPVILSTISIALIIA
FT                   YLFQRFFALDTKLATLVGVGSSICGGSAIAATAPVIDAKEKEVAQAISVIFFFNVLAAL
FT                   IFPTLGTWLHLSNEGFALFAGTAVNDTSSVTAAASAWDSLYQSNTLESATIVKLTRTLA
FT                   IIPITLFLSYWQSRQQENKQSLQLKKVFPLFILYFILASLLTTLLTSLGVSSSFFTPLK
FT                   ELSKFLIVMAMSAIGLKTNLVAMVKSSGKSILLGAICWIAIILTTLGMQTLIGIF"
FT   gene            36168..37337
FT                   /gene="araT"
FT                   /locus_tag="SP_0035"
FT   CDS             36168..37337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araT"
FT                   /locus_tag="SP_0035"
FT                   /product="aromatic amino acid aminotransferase"
FT                   /EC_number="2.6.1.57"
FT                   /note="identified by similarity to GP:6318592; match to
FT                   protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74225"
FT                   /protein_id="AAK74225.1"
FT                   /translation="MDLTKRFNKQLDKIQVSLIRQFDQAISEIPGVLRLTLGEPDFTTP
FT                   DHVKEAGKRAIDQNQSYYTGMSGLLTLRQAASDFVKEKYQLDYAPENEILVTIGATEAL
FT                   SATLTAILEEGDKVLLPAPAYPGYEPIVNLVGAEIVEIDTTENGFVLTPEMLEKAILEQ
FT                   GDKLKAVILNYPANPTGITYSREQLEALAAVLRKYEIFVVCDEVYSELTYTGEAHVSLG
FT                   TMLRDQAIIINGLSKSHAMTGWRLGLIFAPATFTAQLIKSHQYLVTAANTMAQHAAVEA
FT                   LTAGKNDAEPMKKEYIQRRDYIIEKMTALGFEIIKPDGAFYIFAKIPAGYNQDSFAFLK
FT                   DFAQKKAVAFIPGAAFGRYGEGYVRLSYAASMETIKEAMKRLEEYMREA"
FT   gene            37334..38104
FT                   /locus_tag="SP_0036"
FT   CDS             37334..38104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:30686; match to
FT                   protein family HMM PF02565; match to protein family HMM
FT                   TIGR00613"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74226"
FT                   /db_xref="GOA:Q97TA7"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97TA7"
FT                   /protein_id="AAK74226.1"
FT                   /translation="MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKRMFFVKHAGQSK
FT                   LAPVIQPLVLARFLLRINDDGLSYIEDYHEVMTFPKINSDLFVMAYATYVAALADASLQ
FT                   DNQQDAPLFAFLQKTLELMEAGLDYQVLTNIFEIQILTRFGISLNFNECVFCHRVGQAF
FT                   DFSFKYGACLCPEHYHEDKRRCHLNPNIPYLLNQFQAIDFETLETISLKPGIKQELRQF
FT                   MDQLYEEYVGIHLKSKKFIDSLADWGQLLKEEKK"
FT   gene            38101..39093
FT                   /gene="plsX"
FT                   /locus_tag="SP_0037"
FT   CDS             38101..39093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SP_0037"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="identified by match to protein family HMM PF02504;
FT                   match to protein family HMM TIGR00182"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74227"
FT                   /db_xref="GOA:Q97TA6"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97TA6"
FT                   /protein_id="AAK74227.1"
FT                   /translation="MKKIAVDAMGGDYAPQAIVEGVNQALSDFSDIEVQLYGDEAKIKQ
FT                   YLTATERVSIIHTDEKIDSDDEPTRAIRNKKNASMVLAAKAVKDGEADAVLSAGNTGAL
FT                   LAAGFFIVGRIKNIDRPGLMSTLPTVDGKGFDMLDLGANAENTAQHLHQYAVLGSFYAK
FT                   NVRGIAQPRVGLLNNGTESSKGDPLRKETYELLAADESLNFIGNVEARDLMNGVADVVV
FT                   ADGFTGNAVLKSIEGTAMGIMGLLKTAITGGGLRAKLGALLLKDSLSGLKKQLNYSDVG
FT                   GAVLFGVKAPVVKTHGSSDAKAVYSTIRQIRTMLETDVVAQTAREFSGE"
FT   gene            39099..39332
FT                   /locus_tag="SP_0038"
FT   CDS             39099..39332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0038"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74228"
FT                   /protein_id="AAK74228.1"
FT                   /translation="MTEKEIFDRIVTIIQERQGEDFVVTESLSLKDDLDADSVDLMEFI
FT                   LTLEDEFSIEISDEEIDQLQNVGDVVKIIQGK"
FT   gene            39375..39668
FT                   /locus_tag="SP_0039"
FT   CDS             39375..39668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0039"
FT                   /product="IS1381, transposase OrfB, truncation"
FT                   /note="identified by similarity to EGAD:33136"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75803"
FT                   /protein_id="ABC75803.1"
FT                   /translation="MRNIGQAGKILADSGYQGLMKIYPQAQTPRKSSKLKPLTVEDKAC
FT                   NHALSKEISKVENIFAKVKTFKMFSTTYRNHRKRFGLRMNLIAGIINHELGF"
FT   gene            complement(39716..39841)
FT                   /locus_tag="SP_0040"
FT   CDS             complement(39716..39841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0040"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74229"
FT                   /protein_id="AAK74229.1"
FT                   /translation="MSCYKLDKFSITVSINFFHPNLELASKRLELAFLFQNHLYF"
FT   gene            39871..40101
FT                   /gene="blpU"
FT                   /locus_tag="SP_0041"
FT   CDS             39871..40101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpU"
FT                   /locus_tag="SP_0041"
FT                   /product="bacteriocin BlpU"
FT                   /note="identified by similarity to GP:9798576; match to
FT                   protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74230"
FT                   /protein_id="AAK74230.1"
FT                   /translation="MNTKTMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAARGLQL
FT                   GIKTRTWQGAATGAVGGAILGGVAYAATCWW"
FT   gene            40816..42969
FT                   /gene="comA"
FT                   /locus_tag="SP_0042"
FT   CDS             40816..42969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comA"
FT                   /locus_tag="SP_0042"
FT                   /product="competence factor transporting
FT                   ATP-binding/permease protein ComA"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM PF03412; match to protein family HMM TIGR01193"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74231"
FT                   /db_xref="GOA:Q03727"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03727"
FT                   /protein_id="AAK74231.1"
FT                   /translation="MKFGKRHYRPQVDQMDCGVASLAMVFGYYGSYYFLAHLRELAKTT
FT                   MDGTTALGLVKVAEEIGFETRAIKADMTLFDLPDLTFPFVAHVLKEGKLLHYYVVTGQD
FT                   KDSIHIADPDPGVKLTKLPRERFEEEWTGVTLFMAPSPDYKPHKEQKNGLLSFIPILVK
FT                   QRGLIANIVLATLLVTVINIVGSYYLQSIIDTYVPDQMRSTLGIISIGLVIVYIFQQIL
FT                   SYAQEYLLLVLGQRLSIDVILSYIKHVFHLPMSFFATRRTGEIVSRFTDANSIIDALAS
FT                   TILSIFLDVSTVVIISLVLFSQNTNLFFMTLLALPIYTVIIFAFMKPFEKMNRDTMEAN
FT                   AVLSSSIIEDINGIETIKSLTSESQRYQKIDKEFVDYLKKSFTYSRAESQQKALKKVAH
FT                   LLLNVGILWMGAVLVMDGKMSLGQLITYNTLLVYFTNPLENIINLQTKLQTAQVANNRL
FT                   NEVYLVASEFEEKKTVEDLSLMKGDMTFKQVHYKYGYGRDVLSDINLTVPQGSKVAFVG
FT                   ISGSGKTTLAKMMVNFYDPSQGEISLGSVNLNQIDKKALRQYINYLSQQPYVFNGTILE
FT                   NLLLGAKEGTTQEDILRAVELAEIREDIERMPLNYQTELTSDGAGISGGQRQRIALARA
FT                   LLTDAPVLILDEATSSLDILTEKRIVDNLIALDKTLIFIAHRLTIAERTEKVVVLDQGK
FT                   IVEEGKHADLLAQGGFYAHLVNS"
FT   gene            42982..44331
FT                   /gene="comB"
FT                   /locus_tag="SP_0043"
FT   CDS             42982..44331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comB"
FT                   /locus_tag="SP_0043"
FT                   /product="competence factor transport protein ComB"
FT                   /note="identified by similarity to EGAD:42454; match to
FT                   protein family HMM TIGR01000"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74232"
FT                   /db_xref="GOA:P36498"
FT                   /db_xref="InterPro:IPR005696"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36498"
FT                   /protein_id="AAK74232.1"
FT                   /translation="MKPEFLESAEFYNRRYHNFSSSVIVPMALLLVFLLGFATVAEKEM
FT                   SLSTRATVEPSRILANIQSTSNNRILVNHLEENKLVKKGDLLVQYQEGAEGVQAESYAS
FT                   QLDMLKDQKKQLEYLQKSLQEGENHFPEEDKFGYQATFRDYISQAGSLRASTSQQNETI
FT                   ASQNAAASQTQAEIGNLISQTEAKIRDYQTAKSAIETGASLAGQNLAYSLYQSYKSQGE
FT                   ENPQTKVQAVAQVEAQISQLESSLATYRVQYAGSGTQQAYASGLSSQLESLKSQHLAKV
FT                   GQELTLLAQKILEAESGKKVQGNLLDKGKVTASEDGVLHLNPETSDSSMVAEGALLAQL
FT                   YPSLEREGKAKLTAYLSSKYVARIKVGDSVRYTTTHDAGNQLFLDSTITSIDATATKTE
FT                   KGNFFKIEAETNLTSEQAEKLRYGVEGRLQMITGKKSYLRYYLDQFLNKE"
FT   gene            44501..45208
FT                   /gene="purC"
FT                   /locus_tag="SP_0044"
FT   CDS             44501..45208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SP_0044"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="identified by match to protein family HMM PF01259;
FT                   match to protein family HMM TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74233"
FT                   /db_xref="GOA:Q07296"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="PDB:4FE2"
FT                   /db_xref="PDB:4FGR"
FT                   /db_xref="PDB:4NYE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07296"
FT                   /protein_id="AAK74233.1"
FT                   /translation="MSKQLIYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGK
FT                   GVLNNQISSFIFEKLNVAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRF
FT                   GVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKV
FT                   WFAEIGLKLIDFKLEFGFDKDGKIILADEFSPDNCRLWDADGNHMDKDVFRRGLGELTD
FT                   VYEIVWEKLQELK"
FT   gene            45410..49135
FT                   /locus_tag="SP_0045"
FT   CDS             45410..49135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0045"
FT                   /product="putative phosphoribosylformylglycinamidine
FT                   synthase"
FT                   /note="identified by similarity to EGAD:18021; match to
FT                   protein family HMM PF02769; match to protein family HMM
FT                   TIGR01857"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74234"
FT                   /protein_id="AAK74234.1"
FT                   /translation="MDKRIFVEKKADFQVKSESLVRELQHNLGLSSLKSIRIVQVYDVF
FT                   DLAEDLFAPAEKHIFSEQVTDHVLDEVSVQADLANYAFFAIESLPGQFDQRAASSQEAL
FT                   LLLGSSSDVTVNTAQLYLVNKDIDATELEAVKNYLLNPVDSRFKDITTGIAKQEFSESD
FT                   KTIPKLTFFESYAAEDFARYKAEQGMAMEVDDLLFIQDYFKSIGRVPTETELKVLDTYW
FT                   SDHCRHTTFETELKHIDFSASKFQKQLQSTYDKYIAMREELGRSEKPQTLMDMATIFGR
FT                   YERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNETHNHPTEIEPFGGAATC
FT                   IGGAIRDPLSGRSYVYQAMRISGAGDITAPISETRAGKLPQQVISKTAAHGYSSYGNQI
FT                   GLATTYVREYFHPGFVAKRMELGAVVGATPKGNVVREKPEAGDVIILLGGKTGRDGVGG
FT                   ATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRNGNVTRLIKKSNDFGAGGVCVAI
FT                   GELADGLEIDLNKVPLKYQGLNGTEIAISESQERMAVVVRPEDVDAFVAECNKENIDAV
FT                   VVATVTEKPNLVMHWNGETIVDLERRFLDTNGVRVVVDAKVVDKDVKLPEERQTSAETL
FT                   ESDTLTVLSDLNHASQKGLQTIFDCSVGRSTVNHPLGGRYQLTPTEASVQKLPVQHGVT
FT                   HTASVIAQGFNPYVAEWSPYHGAAYAVIEATARLVAAGANWFKARFSYQEYFERMDKQA
FT                   ERFGQPVAALLGSIEAQIQLGLPSIGGKDSMSGTFEELTVPPTLAAFGVTTADSRKVLS
FT                   PEFKAVGENIYYIPGQALSAEIDFDLIKKNFAQFEAIQADHKVTSASAVKYGGVVESLA
FT                   LATFGNYIGAEVTLPELETALTAQLGGFVFTSPEEIAGVEKVGQTKADFTLTVNGVKLD
FT                   GHKLDSAFQGTLEEVYPTEFTQAKELEEVPAVASDVVIKAKEKVEKPVVYIPVFPGTNS
FT                   EYDSAKAFEKEGAEVNLVPFVTLNEEAIVKSVETMVDNIDKTNILFFAGGFSAADEPDG
FT                   SAKFIVNILLNEKVRVAIDSFIARGGLIIGICNGFQALVKSGLLPYGNFEAANSTSPTL
FT                   FYNDANQHVAKMVETRIANTNSPWLVGVQVGDIHAIPVSHGEGKFVVTAEEFAELRDNG
FT                   QIFSQYVDFNGKPSMDSKYNPNGSVHAIEGITSKNGQIIGKMGHSERYEDGLFQNIPGN
FT                   KDQHLFASAVKHFTGK"
FT   gene            49228..50670
FT                   /gene="purF"
FT                   /locus_tag="SP_0046"
FT   CDS             49228..50670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SP_0046"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by similarity to EGAD:7984; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   PF00310; match to protein family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74235"
FT                   /protein_id="AAK74235.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPDAAKLTYFGLHSLQHRGQEGAGIL
FT                   SNDQGQLKRHRDMGLLSEVFRNPANLDKLTGAGAIGHVRYATAGEASVDNIQPFLFRFH
FT                   DMQFGLAHNGNLTNAASLKKELEQRGAIFSATSDSEILAHLIRRSHNPSLMGKIKEALS
FT                   LVKGGFAYILLFEDKLIAALDPNGFRPLSIGKMANGAVVVSSETCAFEVIGAEWIRDLK
FT                   PGEIVIIDDEGIQYDSYTDDTQLAVCSMEYIYFARPDSNIHGVNVHTARKRMGAQLARE
FT                   FKHEADIVVGVPNSSLSAAMGFAEESGLPNEMGLIKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSGVVKGKRVVMVDDSIVRGTTSRRIVQLLKEAGATEVHVAIGSPALAYPCFYGID
FT                   IQTRQELIAANHTVEETRQIIGADSLTYLSIDGLIESIGIETDAPNGGLCVAYFDGDYP
FT                   TPLYDYEEDYRRSLEEKTSFYK"
FT   gene            50889..51911
FT                   /gene="purM"
FT                   /locus_tag="SP_0047"
FT   CDS             50889..51911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SP_0047"
FT                   /product="phosphoribosylformylglycinamide cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00878"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74236"
FT                   /db_xref="GOA:Q97TA2"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97TA2"
FT                   /protein_id="AAK74236.1"
FT                   /translation="MANKNAYAQSGVDVEAGYEVVERIKKHVARTERAGVMGALGGFGG
FT                   MFDLSKTGVKEPVLISGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYVATGKNEPAKLEQVVAGVAEGCVQAGAALIGGETAEMPGMYGEDDYDLAGFAVGVA
FT                   EKSQIIDGSKVVEGDVLLGLASSGIHSNGYSLVRRVFADYTGEEVLPELEGKKLKEVLL
FT                   EPTRIYVKAVLPLIKEELVNGIAHITGGGFIENVPRMFADDLAAEIDESKVPVLPIFKT
FT                   LEKYGQIKHEEMFEIFNMGVGLMLAVSPENVERVKELLDEAVYEIGRIVKKENESVIIK
FT                   "
FT   gene            51908..52453
FT                   /gene="purN"
FT                   /locus_tag="SP_0048"
FT   CDS             51908..52453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SP_0048"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="identified by similarity to EGAD:18449; match to
FT                   protein family HMM PF00551; match to protein family HMM
FT                   TIGR00639"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74237"
FT                   /protein_id="AAK74237.1"
FT                   /translation="MKKIAVFASGNGSNFQVIAEEFPVEFVFSDHRDAYVLERAKQLGV
FT                   LSYAFELKEFESKADYEAALVELLEEHQIDLVCLAGYMKIVGPTLLSAYEGRIVNIHPA
FT                   YLPEFPGAHGIEDAWNAGVGQSGVTIHWVDSGVDTGQVIKQVRVPRLADDTIDRFEARI
FT                   HEAEYRLYPEVVKALFTD"
FT   gene            52537..53046
FT                   /locus_tag="SP_0049"
FT   CDS             52537..53046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0049"
FT                   /product="putative vanZ protein"
FT                   /note="identified by similarity to GP:6448500; match to
FT                   protein family HMM PF04892"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74238"
FT                   /protein_id="AAK74238.1"
FT                   /translation="MLESKKTTRYVFYVYLMLLTWGILFKFETNPEFIAFFLAPRYINW
FT                   IPFSEPLIVDGKIVFAEMLFNLIFFIPLGVCFPLIKTNLSSLRIVGTGFLISLLFECLQ
FT                   YILAIGITDITDLTLNTLGVCVGLLIYQIFIRVFKSQTRKWINILGMLSLGFAYLVLLL
FT                   LHLLSV"
FT   gene            53071..54618
FT                   /gene="purH"
FT                   /locus_tag="SP_0050"
FT   CDS             53071..54618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SP_0050"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /note="identified by match to protein family HMM PF01808;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74239"
FT                   /db_xref="GOA:Q97T99"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T99"
FT                   /protein_id="AAK74239.1"
FT                   /translation="MTKRVLISVSDKAGIVEFAQELKKLGWEIISTGGTKVALDNAGVD
FT                   TIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDLDSHLEAAKDNKIELIDLVVVNLYP
FT                   FKETILKPDVTYADAVENIDIGGPSMLRSAAKNHASVTVVVDPADYAVVLDELAANGET
FT                   SYETRQRLAAKVFRHTAAYDALIAEYFTAQVGESKPEKLTLTYDLKQPMRYGENPQQDA
FT                   DFYQKALPTDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKDSPTVVALKHMNPCGI
FT                   GQADDIETAWDYAYESDPVSIFGGIVVLNREVDAATAEKMHGVFLEIIIAPSYTDEALA
FT                   ILINKKKNLRILALPFNAQEASEVEAEYTGVVGGLLVQNQDVVKESPADWQVVTKRQPT
FT                   ETEATALEFAWKAIKYVKSNGIIVTNDHMTLGVGPGQTNRVASVRLAIDQAKDRLDGAV
FT                   LASDAFFPFADNVEEIAKAGIKAIIQPGGSVRDQESIEAADKYGLTMVFTGVRHFRH"
FT   gene            54740..56002
FT                   /gene="purD"
FT                   /locus_tag="SP_0051"
FT   CDS             54740..56002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SP_0051"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="identified by similarity to SP:Q9ZF44; match to
FT                   protein family HMM PF01071; match to protein family HMM
FT                   PF02842; match to protein family HMM PF02843; match to
FT                   protein family HMM PF02844; match to protein family HMM
FT                   TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74240"
FT                   /db_xref="GOA:Q97T98"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T98"
FT                   /protein_id="AAK74240.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLESKDVEKVFVAPGNDGMTLDGLELV
FT                   NISISEHYKLIDFAKTNDVAWTFIGPDDALAAGIVDDFNQAGLKAFGPTRAAAELEWSK
FT                   DFAKEIMVKYGVPTATYGTFSDFEEAKAYIEKHGAPIVVKADGLALGKGVVVAETVEQA
FT                   VEAAHEMLLDNKFGDSGARVVIEEFLEGEEFSLFAFVNGDKFYIMPTAQDHKRAYDGDK
FT                   GPNTGGMGAYAPVPHLPQSVVDTAVDTIVKPVLEGVIKEGRPYLGVLYAGLILTADGPK
FT                   VIEFNARFGDPETQIILPRLTSDFAQNITDILDSKEPNIMWTDKGVTLGVVVASKGYPL
FT                   DYERGVELPAKTEGDVITYYAGAKFAENSRALLSNGGRVYMLVTTADTVKEAQASIYQE
FT                   LYQQKIEGLFYRTDIGSKAIK"
FT   gene            56259..56375
FT                   /locus_tag="SP_0052"
FT   CDS             56259..56375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0052"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74241"
FT                   /protein_id="AAK74241.1"
FT                   /translation="MKERLDDNPIVQGNWKTLGFQFRHETPLVAAAVPHKLR"
FT   gene            56405..56893
FT                   /gene="purE"
FT                   /locus_tag="SP_0053"
FT   CDS             56405..56893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SP_0053"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by similarity to EGAD:19627; match to
FT                   protein family HMM PF00731; match to protein family HMM
FT                   TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74242"
FT                   /protein_id="AAK74242.1"
FT                   /translation="MKPVISIIMGSKSDWATMQKTAEVLDRFGVAYEKKVVSAHRTPDL
FT                   MFKHAEEARSRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRALSGVDSLYSIVQ
FT                   MPGGVPVATMAIGEAGATNAALFALRLLSVEDKSIADALANFAEEQGKIAEESSNELI"
FT   gene            56880..57971
FT                   /gene="purK"
FT                   /locus_tag="SP_0054"
FT   CDS             56880..57971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SP_0054"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by similarity to EGAD:12560; match to
FT                   protein family HMM PF02222; match to protein family HMM
FT                   TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74243"
FT                   /protein_id="AAK74243.1"
FT                   /translation="MSSSKTIGIIGGGQLGQMMAISAIYMGHKVIALDPAADCPVSRVA
FT                   EIIVAPYNDVDALRQLADRCDVLTYEFENVDADGLDAVIKDGQLPQGTDLLRISQNRIF
FT                   EKDFLSNKAQVTVAPYKVVTSSLDLADIDLSKNYVLKTATGGYDGHGQKVIRSEADLEA
FT                   AYALADSADCVLEEFVNFDLEISVIVSGNGKEVTFFPVQENIHRNNILSKTIVPARISE
FT                   SLVDKAKAMAVRIAEQLNLSGTLCVEMFATADDIIVNEIAPRPHNSGHYSIEACDFSQF
FT                   DTHILGVLGAPLPVIKLHAPAVMLNVLGQHVEAAEKYVTENPSAHLHMYGKIEAKHNRK
FT                   MGHVTLFSDVPDSVEEFGEGIDF"
FT   gene            57981..58208
FT                   /locus_tag="SP_0055"
FT   CDS             57981..58208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0055"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74244"
FT                   /protein_id="AAK74244.1"
FT                   /translation="MIQIIVNTFIEKYKTGAVVEVLYASADQDKVQAKYEELAAQYPEN
FT                   YLAIYNVPLDTDLNTLDHYPSVFIGKEEFE"
FT   gene            58271..59569
FT                   /gene="purB"
FT                   /locus_tag="SP_0056"
FT   CDS             58271..59569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SP_0056"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00928"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74245"
FT                   /protein_id="AAK74245.1"
FT                   /translation="MINRYSRPEMANIWSEENKYRAWLEVEILSDEAWAELGEIPKEDV
FT                   ALIRKKADFDIDRILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTNIIADKAKEHKFTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NIERFEHAAAGVEAGKISGAVGNFANIPPFVEEYVCDKLGIRAQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMITAYENVALWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNLTVFPEN
FT                   MIRNMNSTFGLIFSQRAMLTLIEKGMTREQAYDLVQPKTAYSWDNQVDFKPLLEADSEV
FT                   TSRLTQEEIDEIFNPVYYTKRVDDIFERLGLGD"
FT   gene            complement(59624..63562)
FT                   /gene="strH"
FT                   /locus_tag="SP_0057"
FT   CDS             complement(59624..63562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="strH"
FT                   /locus_tag="SP_0057"
FT                   /product="beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="identified by similarity to EGAD:31948; match to
FT                   protein family HMM PF00728; match to protein family HMM
FT                   PF00746; match to protein family HMM PF04650; match to
FT                   protein family HMM PF07501; match to protein family HMM
FT                   TIGR01167; match to protein family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74246"
FT                   /db_xref="GOA:P49610"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="PDB:2LTJ"
FT                   /db_xref="PDB:2YL5"
FT                   /db_xref="PDB:2YL6"
FT                   /db_xref="PDB:2YL8"
FT                   /db_xref="PDB:2YL9"
FT                   /db_xref="PDB:2YLA"
FT                   /db_xref="PDB:2YLL"
FT                   /db_xref="PDB:4AZ5"
FT                   /db_xref="PDB:4AZ6"
FT                   /db_xref="PDB:4AZ7"
FT                   /db_xref="PDB:4AZB"
FT                   /db_xref="PDB:4AZC"
FT                   /db_xref="PDB:4AZG"
FT                   /db_xref="PDB:4AZH"
FT                   /db_xref="PDB:4AZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49610"
FT                   /protein_id="AAK74246.1"
FT                   /translation="MKHEKQQRFSIRKYAVGAASVLIGFAFQAQTVAADGVTPTTTENQ
FT                   PTIHTVSDSPQSSENRTEETPKAVLQPEAPKTVETETPATDKVASLPKTEEKPQEEVSS
FT                   TPSDKAEVVTPTSAEKETANKKAEEASPKKEEAKEVDSKESNTDKTDKDKPAKKDEAKA
FT                   EADKPATEAGKERAATVNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLL
FT                   VGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYA
FT                   KDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKAL
FT                   IDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYAN
FT                   DLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKG
FT                   HQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAW
FT                   ADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKE
FT                   AEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTPEAQKEEEAKREVEKLAKNKVI
FT                   SIDAGRKYFTLNQLKRIVDKASELGYSDVHLLLGNDGLRFLLDDMTITANGKTYASDDV
FT                   KKAIIEGTKAYYDDPNGTALTQAEVTELIEYAKSKDIGLIPAINSPGHMDAMLVAMEKL
FT                   GIKNPQAHFDKVSKTTMDLKNEEAMNFVKALIGKYMDFFAGKTKIFNFGTDEYANDATS
FT                   AQGWYYLKWYQLYGKFAEYANTLAAMAKERGLQPMAFNDGFYYEDKDDVQFDKDVLISY
FT                   WSKGWWGYNLASPQYLASKGYKFLNTNGDWYYILGQKPEDGGGFLKKAIENTGKTPFNQ
FT                   LASTKYPEVDLPTVGSMLSIWADRPSAEYKEEEIFELMTAFADHNKDYFRANYNALREE
FT                   LAKIPTNLEGYSKESLEALDAAKTALNYNLNRNKQAELDTLVANLKAALQGLKPAVTHS
FT                   GSLDENEVAANVETRPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGERTHYISV
FT                   LTENGKTTETVLDSQVTKEVINQVVEVGAPVTHKGDESGLAPTTEVKPRLDIQEEEIPF
FT                   TTVTCENPLLLKGKTQVITKGVNGHRSNFYSVSTSADGKEVKTLVNSVVAQEAVTQIVE
FT                   VGTMVTHVGDENGQAAIAEEKPKLEIPSQPAPSTAPAEESKVLPQDPAPVVTEKKLPET
FT                   GTHDSAGLVVAGLMSTLAAYGLTKRKED"
FT   gene            complement(63890..64606)
FT                   /locus_tag="SP_0058"
FT   CDS             complement(63890..64606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0058"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74247"
FT                   /protein_id="AAK74247.1"
FT                   /translation="MAIPKYQYIKDELKNKIISGQFSSGDKFYTEAELISMYDVSSITV
FT                   VRALNDLAKDGYIVRQQGKGTFVSRARKHKLVEFSDIELFNAKDDKVTVLSIERGNKLV
FT                   YLEKLGLRGDQFYYKIERIRESNGVVYIYHTSYIPEQYINANYPNLEYYSSIYNRFKLD
FT                   YHIHMNDEHFEEINEIVFPTPEHAASVLGVDEQFPTVLQTKITKLESTGQVLEYSETYK
FT                   RSDYYKIKFISCDRDH"
FT   gene            64593..64694
FT                   /locus_tag="SP_0059"
FT   CDS             64593..64694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0059"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74248"
FT                   /protein_id="AAK74248.1"
FT                   /translation="MGIAIFLPLFSFFHRKFYHKSEKNSSLLNKKLE"
FT   gene            64955..66742
FT                   /locus_tag="SP_0060"
FT   CDS             64955..66742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0060"
FT                   /product="glycosyl hydrolase, family 35"
FT                   /note="identified by similarity to EGAD:31916; match to
FT                   protein family HMM PF01301"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74249"
FT                   /protein_id="AAK74249.1"
FT                   /translation="MTRFEIRDDFYLDGKSFKILSGAIHYFRVPPEDWYHSLYNLKALG
FT                   FNTVETYVAWNLHEPCEGEFHFEGDLDLEKFLQIAQDLGLYAIVRPSPFICAEWEFGGL
FT                   PAWLLTKNMRIRSSDPAYIEAVGRYYDQLLPRLVPRLLDNGGNILMMQVENEYGSYGED
FT                   KAYLRAIRQLMEECGVTCPLFTSDGPWRATLKAGTLIEEDLFVTGNFGSKAPYNFSQMQ
FT                   EFFDEHGKKWPLMCMEFWDGWFNRWKEPIITRDPKELADAVREVLEQGSINLYMFHGGT
FT                   NFGFMNGCSARGTLDLPQVTSYDYDALLDEEGNPTAKYLAVKKMMATHFSEYPQLEPLY
FT                   KESMELDAIPLVEKVSLFETLDSLSSPVESLYPQKMEELGQSYGYLLYRTETNWDAEEE
FT                   RLRIIDGRDRAQLYVDGQWVKTQYQTEIGEDIFYQGKKKGLSRLDILIENMGRVNYGHK
FT                   FLADTQRKGIRTGVCKDLHFLLNWKHYPLPLDNPEKIDFSKGWTQGQPAFYAYDFTVEE
FT                   PKDTYLDLSEFGKGVAFVNGQNLGRFWNVGPTLSLYIPHSYLKEGANRIIIFETEGQYK
FT                   EEIHLTRKPTLKHIKGENL"
FT   gene            66739..67215
FT                   /locus_tag="SP_0061"
FT   CDS             66739..67215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0061"
FT                   /product="PTS system, IIB component"
FT                   /note="identified by similarity to EGAD:9092; match to
FT                   protein family HMM PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74250"
FT                   /protein_id="AAK74250.1"
FT                   /translation="MTIVGCRIDGRLIHGQVANLWAGKLNVSRIMVVDDEVVNNDIEKS
FT                   GLKLATPPGVKLSILPVEKAAANILGGKYDSQRLFIVARKPDRFLGLVEAGVPLETLNV
FT                   GNMSQTPETRSITRSINVVDKDVEDFHKLAEKGVKLTAQMVPNDPISDFLSLLK"
FT   gene            67243..68148
FT                   /locus_tag="SP_0062"
FT   CDS             67243..68148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0062"
FT                   /product="PTS system, IIC component"
FT                   /note="identified by similarity to EGAD:14386; match to
FT                   protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74251"
FT                   /protein_id="AAK74251.1"
FT                   /translation="MIQWWQILLLTLYSAYQICDELTIVSSAGSPVFAGFITGLIMGDV
FT                   TTGLLIGGNLQLFVLGVGTFGGASRIDATSGAVLATAFSVSQGIDAPLAITTIAVPVAA
FT                   LLTYFDVLGRMTTTFFAHRVDAAIERFDYKGIERNYLLGAIPWALSRALPVFFALAFGG
FT                   AFVQSVVDFVEAYKWVADGLTLAGRMLPGLGFAILLRYLPVKRNLHYLAMGFGLTAMLT
FT                   VLYSYVTGLGGAVAGIVGTLPAEVAEKIGFVNNFKGLSMIGISIVGIFLAVLHFKNSQK
FT                   VAVAAPSTPSESGEIEDDEF"
FT   gene            68135..68950
FT                   /locus_tag="SP_0063"
FT   CDS             68135..68950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0063"
FT                   /product="PTS system, IID component"
FT                   /note="identified by similarity to EGAD:91568; match to
FT                   protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74252"
FT                   /protein_id="AAK74252.1"
FT                   /translation="MTNSNYKLTKEDFNQINKRSLFTFQLGWNYERMQASGYLYMILPQ
FT                   LRKMYGDGTPELKEMMKVHTQFFNTSPFFHTIIAGFDLAMEEKDGVGSKDAVNGIKTGL
FT                   MGPFAPLGDTIFGSLVPAIMGSVAATMAIAGQPWGIFLWIAVAVAYDIFRWKQLEFAYK
FT                   EGVNLINNMQSTLTALIDAASVLGVFMMGALVATVINFEISYKLPIGEKMIDFQDILNQ
FT                   IFPRLLPAIFTAFIFWLLGKKGMNSTKAIGIIIVLALALSALGHFALGM"
FT   gene            68957..69361
FT                   /locus_tag="SP_0064"
FT   CDS             68957..69361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0064"
FT                   /product="PTS system, IIA component"
FT                   /note="identified by similarity to EGAD:7066; match to
FT                   protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74253"
FT                   /protein_id="AAK74253.1"
FT                   /translation="MTKSLILVSHGRFCEELRGSTEMIMGPQDNIYTVALLPEDGPEEF
FT                   TAKFEAVIEGLDDFLVFADLLGGTPCNVVSRLIMEGRDIDLYAGMNLPMVIEFINASLT
FT                   GADADYKSRAAESIVKVNDLLAGFDDDEDE"
FT   gene            69660..70826
FT                   /gene="agaS"
FT                   /locus_tag="SP_0065"
FT   CDS             69660..70826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaS"
FT                   /locus_tag="SP_0065"
FT                   /product="sugar isomerase domain protein AgaS"
FT                   /note="identified by similarity to EGAD:30961; match to
FT                   protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74254"
FT                   /protein_id="AAK74254.1"
FT                   /translation="MLHYTKEDLLELGAEITTREIYQQPDVWREAFEFYQAKREEIAAF
FT                   LQEIADKHDYIKVILTGAGTSAYVGDTLLPYFKEVYDERKWNFNAIATTDIVANPATYL
FT                   KKDVATVLVSFARSGNSPESLATVDLAKSLVDELYQVTITCAADGKLALQAHGDDRNLL
FT                   LLQPAVSNDAGFAMTSSFTSMMLTTLLVFDPTEFAVKSERFEVVSSLARKVLDKAEDVK
FT                   ELVDLDFNRVIYLGAGPFFGLAHEAQLKILELTAGQVATMYESPVGFRHGPKSLINDNT
FT                   VVLVFGTTTDYTRKYDLDLVREVAGDQIARRVVLLSDQAFGLENVKEVALGCGGVLNDI
FT                   YRVFPYIVYAQLFALLTSLKVENKPDTPSPTGTVNRVVQGVIIHEYQK"
FT   gene            70942..71979
FT                   /gene="galM"
FT                   /locus_tag="SP_0066"
FT   CDS             70942..71979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galM"
FT                   /locus_tag="SP_0066"
FT                   /product="aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /note="identified by similarity to EGAD:7416; match to
FT                   protein family HMM PF01263"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74255"
FT                   /protein_id="AAK74255.1"
FT                   /translation="MKAYTERVFGNVEGEDVLAYRFETDGGYQLEVMTYGATILRYVAP
FT                   DKAGNFANVILGFDDFDSYVGNSPKHGASVGPVAGRIAGATFELNGKTYDLEVNNASNC
FT                   NHSGSTGWDSSLFEVEEVSDHGLTLYTERTDGTGGFPGNLKIWISYHLEETGAYEISYK
FT                   VTTDQDTLVNPTNHSYFNLSGDFTQTIDRHVFQLNTEGIYSIAPDGVPAKTPEANRDVV
FT                   KHVYNGTLLKDIFAEEDEQIQLASGLDHPFALPAGHDNAGFLYDQNSGRFLLFKTEAPC
FT                   FVVYTANFVDESVIIGGQPMLQHNGIALEAQALPDAIHSDLKGQVILKAGQTFTSKTRY
FT                   ELVVK"
FT   gene            72141..72401
FT                   /locus_tag="SP_0067"
FT   CDS             72141..72401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0067"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74256"
FT                   /protein_id="AAK74256.1"
FT                   /translation="MALTLAGAVLTNDVFANDRLVATQTTDGKNENVLTSEVLKPSSGN
FT                   VLVGIKGEFVAPHQQSILDAINAICKEAADEGLVDKYVPIK"
FT   gene            72456..72653
FT                   /locus_tag="SP_0068"
FT   CDS             72456..72653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0068"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74257"
FT                   /protein_id="AAK74257.1"
FT                   /translation="MDHTRLSSKDLWSAFPTSNSIMGENLAWNHDGFLKAIEQWRAEKA
FT                   DYVEKKIVVQTTGNLVTMSR"
FT   gene            72674..73309
FT                   /gene="cbpI"
FT                   /locus_tag="SP_0069"
FT   CDS             72674..73309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbpI"
FT                   /locus_tag="SP_0069"
FT                   /product="choline binding protein I"
FT                   /note="identified by similarity to GP:9454356; match to
FT                   protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74258"
FT                   /protein_id="AAK74258.1"
FT                   /translation="MGMAAFKNPNNQYKAITIAQTLGDDASSEELAGRYGSAVQCTEVT
FT                   ASNLSTVKTKATVVEKPLKDFRASTSDQSGWVESNGKWYFYESGDVKTGWVKTDGKWYY
FT                   LNDLGVMQTGFVKFSGSWYYLSNSGAMFTGWGTDGSRWFYFDGSGAMKTGWYKENGTWY
FT                   YLDEAGIMKTGWFKVGPHWYYAYGSGALAVSTTTPDGYRVNGNGEWVN"
FT   gene            73353..73454
FT                   /locus_tag="SP_0070"
FT   CDS             73353..73454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0070"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74259"
FT                   /protein_id="AAK74259.1"
FT                   /translation="MNDKKEVDGEHWPLLIYKDWILVASISDFSIVS"
FT   gene            73761..79331
FT                   /gene="zmpC"
FT                   /locus_tag="SP_0071"
FT   CDS             73761..79331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zmpC"
FT                   /locus_tag="SP_0071"
FT                   /product="zinc metalloprotease ZmpC"
FT                   /note="identified by similarity to GP:1870145; match to
FT                   protein family HMM PF04650; match to protein family HMM
FT                   PF05342; match to protein family HMM PF07501; match to
FT                   protein family HMM PF07580; match to protein family HMM
FT                   PF07581; match to protein family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74260"
FT                   /db_xref="GOA:Q97T80"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008006"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR011505"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T80"
FT                   /protein_id="AAK74260.1"
FT                   /translation="MSRKSIGEKRHSFSMRKLSVGLVSVTVSSFFLMSQGIQSVSADNM
FT                   ESPIHYKYMTEGKLTDEEKSLLVEALPQLAEESDDTYYLVYRSQQFLPNTGFNPTVGTF
FT                   LFTAGLSLLVLLVSKRENGKKRLVHFLLLTSMGVQLLPASAFGLTSQILSAYNSQLSIG
FT                   VGEHLPEPLKIEGYQYIGYIKTKKQDNTELSRTVDGKYSAQRDSQPNSTKTSDVVHSAD
FT                   LEWNQGQGKVSLQGEASGDDGLSEKSSIAADNLSSNDSFASQVEQNPDHKGESVVRPTV
FT                   PEQGNPVSATTVQSAEEEVLATTNDRPEYKLPLETKGTQEPGHEGEAAVREDLPVYTKP
FT                   LETKGTQGPGHEGEAAVREEEPAYTEPLATKGTQEPGHEGKATVREETLEYTEPVATKG
FT                   TQEPEHEGEAAVEEELPALEVTTRNRTEIQNIPYTTEEIQDPTLLKNRRKIERQGQAGT
FT                   RTIQYEDYIVNGNVVETKEVSRTEVAPVNEVVKVGTLVKVKPTVEITNLTKVENKKSIT
FT                   VSYNLIDTTSAYVSAKTQVFHGDKLVKEVDIENPAKEQVISGLDYYTPYTVKTHLTYNL
FT                   GENNEENTETSTQDFQLEYKKIEIKDIDSVELYGKENDRYRRYLSLSEAPTDTAKYFVK
FT                   VKSDRFKEMYLPVKSITENTDGTYKVTVAVDQLVEEGTDGYKDDYTFTVAKSKAEQPGV
FT                   YTSFKQLVTAMQSNLSGVYTLASDMTADEVSLGDKQTSYLTGAFTGSLIGSDGTKSYAI
FT                   YDLKKPLFDTLNGATVRDLDIKTVSADSKENVAALAKAANSANINNVAVEGKISGAKSV
FT                   AGLVASATNTVIENSSFTGKLIANHQDSNKNDTGGIVGNITGNSSRVNKVRVDALISTN
FT                   ARNNNQTAGGIVGRLENGALISNSVATGEIRNGQGYSRVGGIVGSTWQNGRVNNVVSNV
FT                   DVGDGYVITGDQYAAADVKNASTSVDNRKADRFATKLSKDQIDAKVADYGITVTLDDTG
FT                   QDLKRNLREVDYTRLNKAEAERKVAYSNIEKLMPFYNKDLVVHYGNKVATTDKLYTTEL
FT                   LDVVPMKDDEVVTDINNKKNSINKVMLHFKDNTVEYLDVTFKENFINSQVIEYNVTGKE
FT                   YIFTPEAFVSDYTAITNNVLSDLQNVTLNSEATKKVLGAANDAALDNLYLDRQFEEVKA
FT                   NIAEHLRKVLAMDKSINTTGDGVVEYVSEKIKNNKEAFMLGLTYMNRWYDINYGKMNTK
FT                   DLSTYKFDFNGNNETSTLDTIVALGNSGLDNLRASNTVGLYANKLASVKGEDSVFDFVE
FT                   AYRKLFLPNKTNNEWFKENTKAYIVEMKSDIAEVREKQESPTADRKYSLGVYDRISAPS
FT                   WGHKSMLLPLLTLPEESVYISSNMSTLAFGSYERYRDSVDGVILSGDALRTYVRNRVDI
FT                   AAKRHRDHYDIWYNLLDSASKEKLFRSVIVYDGFNVKDETGRTYWARLTDKNIGSIKEF
FT                   FGPVGKWYEYNSSAGAYANGSLTHFVLDRLLDAYGTSVYTHEMVHNSDSAIYFEGNGRR
FT                   EGLGAELYALGLLQSVDSVNSHILALNTLYKAEKDDLNRLHTYNPVERFDSDEALQSYM
FT                   HGSYDVMYTLDAMEAKAILAQNNDVKKKWFRKIENYYVRDTRHNKDTHAGNKVRPLTDE
FT                   EVANLTSLNSLIDNDIINRRSYDDSREYKRNGYYTISMFSPVYAALSNSKGAPGDIMFR
FT                   KIAYELLAEKGYHKGFLPYVSNQYGAEAFASGSKTFSSWHGRDVALVTDDLVFKKVFNG
FT                   EYSSWADFKKAMFKQRIDKQDNLKPITIQYELGNPNSTKEVTITTAAQMQQLINEAAAK
FT                   DITNIDRATSHTPASWVHLLKQKIYNAYLRTTDDFRNSIYK"
FT   gene            79434..79547
FT                   /locus_tag="SP_0072"
FT   CDS             79434..79547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0072"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74261"
FT                   /protein_id="AAK74261.1"
FT                   /translation="MQIAGIIFNSSTTNGDKVDFNPTENVDLRNNFASLVK"
FT   gene            79687..80541
FT                   /locus_tag="SP_0073"
FT   CDS             79687..80541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:45930; match to
FT                   protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74262"
FT                   /protein_id="AAK74262.1"
FT                   /translation="MTYEYQSHIYLAEAVLNVKDLVSQTVFYQQIIGLEILSQTDTEVV
FT                   LGLGGKALVHLIQAQEGGEVREHYGLYHLAILLPTRKALADVLKHLTDLQIPLVGGADH
FT                   GYSEALYLEDLEGNGIELYRDKPVSTWDIREDGRIIGVTEVLAAQDIYELGERVEPFIL
FT                   AEGTRMGHIHLSVKDSRKSRQFYQTVLGLEDKFSVPSASWIAAGDYHHHLAVNEWGGKG
FT                   LDPRKQVLPGLAYYVIEVAHKEELLTIAQRAQEVDAPIKWMTSIQLEITDSDGIVTRIR
FT                   LAR"
FT   gene            80647..81204
FT                   /locus_tag="SP_0074"
FT   CDS             80647..81204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0074"
FT                   /product="acetyltransferase, CysE/LacA/LpxA/NodL family"
FT                   /note="identified by similarity to SP:P77791"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74263"
FT                   /protein_id="AAK74263.1"
FT                   /translation="MTSEYQKMIAGEFYRPSDPELRALAQASRQKQAAFNKEENPLKGA
FT                   EIIKTWFASTGKNLYINTRLMVDYGVNIHLGENFYSNWNLTMLDICPIRIGDNAMIGPN
FT                   CQFLTPLHPLDPQERNSGIEYGKPITIGDNFWTGGGVIVLPGVTLGNNVVAGAGAVITK
FT                   SFGDNVVLAGNPARVIKEIPVK"
FT   gene            81481..82185
FT                   /locus_tag="SP_0075"
FT   CDS             81481..82185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0075"
FT                   /product="phosphorylase, Pnp/Udp family"
FT                   /note="identified by match to protein family HMM PF01048"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74264"
FT                   /protein_id="AAK74264.1"
FT                   /translation="MPNHEGLDLQLPKKCVYAFLGEEIDRYAREVGANCVGEFVSATKT
FT                   YPVYVVNYKDEEVCLAQAPVGSAPAAQFMDWLIGYGVEQIISTGTCGVLADIEENAFLV
FT                   PVRALRDEGASYHYVAPCRYMEMQPEAIAAIEEVLEDRGIPYEEVMTWTTDGFYRETAE
FT                   KVAYRKEEGCAVVEMECSALAAVAQLRGVLWGELLFTADSLADLDQYDSRDWGSEAFNK
FT                   ALELSLASVHHL"
FT   gene            complement(82590..82682)
FT                   /locus_tag="SP_0076"
FT   CDS             complement(82590..82682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0076"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74265"
FT                   /protein_id="AAK74265.1"
FT                   /translation="MIDVTIGQKSKTGAFNASYSICFSGENFSF"
FT   gene            82659..82817
FT                   /locus_tag="SP_0077"
FT   CDS             82659..82817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0077"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74266"
FT                   /protein_id="AAK74266.1"
FT                   /translation="MTYSHIYQVLFLPKLSIKRWHFLGLVLVDFALSYLSHFELFMVQW
FT                   KHVIQII"
FT   gene            82798..84177
FT                   /locus_tag="SP_0078"
FT   CDS             82798..84177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0078"
FT                   /product="potassium uptake protein, Trk family"
FT                   /note="identified by match to protein family HMM PF02386"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74267"
FT                   /protein_id="AAK74267.1"
FT                   /translation="MLFKLSKEKIELGLSRLSPARRIFLSFALVILLGSLLLSLPFVQV
FT                   ESSRATYFDHLFTAVSAVCVTGLSTLPVAHTYNIWGQIICLLLIQIGGLGLMTFIGVFY
FT                   IQSKQKLSLRSRATIQDSFSYGETRSLRKFVYSIFLTTFLVESLGAILLSFRLIPQLGW
FT                   GRGLFSSIFLAISAFCNAGFDNLGSTSLFAFQTDLLVNLVIAGLIITGGLGFMVWFDLA
FT                   GHVGRKKKGRLHFHTKLVLLLTIGLLLFGTATTLFLEWNNAGTIGNLPVADKVLVSFFQ
FT                   TVTMRTAGFSTIDYTQAHPVTLLIYILQMFLGGAPGGTAGGLKITTFFVLLVFARSELL
FT                   GLPHANVARRTIAPRTVQKSFSVFIIFLMSFLIGLILLGITAKGNPPFIHLVFETISAL
FT                   STVGVTANLTPDLGKLALSVIMPLMFMGRIGPLTLFVSLADYHPEKKDMIHYMKADISI
FT                   G"
FT   gene            84191..84856
FT                   /locus_tag="SP_0079"
FT   CDS             84191..84856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0079"
FT                   /product="potassium uptake protein, Trk family"
FT                   /note="identified by match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74268"
FT                   /protein_id="AAK74268.1"
FT                   /translation="MSDRTIGILGLGIFGSSVLAALAKQDMNIIAIDDHAERINQFEPV
FT                   LARGVIGDITDEELLRSAGIDTCDTVVVATGENLESSVLAVMHCKSLGVPTVIAKVKSQ
FT                   TAKKVLEKIGADSVISPEYEMGQSLAQTILFHNSVDVFQLDKNVSIVEMKIPQSWAGQS
FT                   LSKLDLRGKYNLNILGFREQENSPLDVEFGPDDLLKADTYILAVINNQYLDTLVALNS"
FT   gene            84877..84984
FT                   /locus_tag="SP_0080"
FT   CDS             84877..84984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74269"
FT                   /protein_id="AAK74269.1"
FT                   /translation="MMPKMANRDRSPLSSSKSSSKAGLYGKIERSDKRE"
FT   gene            85166..86182
FT                   /pseudo
FT                   /locus_tag="SP_0081"
FT                   /note="glycosyl transferase, family 2, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GP:3550634"
FT   gene            86298..88871
FT                   /locus_tag="SP_0082"
FT   CDS             86298..88871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0082"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF04650; match to protein
FT                   family HMM TIGR01167; match to protein family HMM
FT                   TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74270"
FT                   /protein_id="AAK74270.1"
FT                   /translation="MKFNPNQRYTRWSIRRLSVGVASVVVASGFFVLVGQPSSVRADGL
FT                   NPTPGQVLPEETSGTKEGDLSEKPGDTVLTQAKPEGVTGNTNSLPTPTERTEVSEETSP
FT                   SSLDTLFEKDEEAQKNPELTDVLKETVDTADVDGTQASPAETTPEQVKGGVKENTKDSI
FT                   DVPAAYLEKAEGKGPFTAGVNQVIPYELFAGDGMLTRLLLKASDNAPWSDNGTAKNPAL
FT                   PPLEGLTKGKYFYEVDLNGNTVGKQGQALIDQLRANGTQTYKATVKVYGNKDGKADLTN
FT                   LVATKNVDININGLVAKETVQKAVADNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYE
FT                   LFAGDGMLTRLLLKASDKAPWSDNGDAKNPALSPLGENVKTKGQYFYQVALDGNVAGKE
FT                   KQALIDQFRANGTQTYSATVNVYGNKDGKPDLDNIVATKKVTININGLISKETVQKAVA
FT                   DNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYELFAGDGMLTRLLLKASDKAPWSDNG
FT                   DAKNPALSPLGENVKTKGQYFYQLALDGNVAGKEKQALIDQFRANGTQTYSATVNVYGN
FT                   KDGKPDLDNIVATKKVTININGLISKETVQKAVADNVKDSIDVPAAYLEKAKGEGPFTA
FT                   GVNHVIPYELFAGDGMLTRLLLKASDKAPWSDNGDAKNPALSPLGENVKTKGQYFYQVA
FT                   LDGNVAGKEKQALIDQFRANGTQTYSATVNVYGNKDGKPDLDNIVATKKVTIKINVKET
FT                   SDTANGSLSPSNSGSGVTPMNHNHATGTTDSMPADTMTSSTNTMAGENMAASANKMSDT
FT                   MMSEDKAMLPNTGETQTSMASIGFLGLALAGLLGGLGLKNKKEEN"
FT   gene            89038..89736
FT                   /locus_tag="SP_0083"
FT   CDS             89038..89736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0083"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74271"
FT                   /protein_id="AAK74271.1"
FT                   /translation="MGKTILLVDDEVEITDIHQRYLIQAGYQVLVAHDGLEALELFKKK
FT                   PIDLIITDVMMPRMDGYDLISEVQYLSPEQPFLFITAKTSEQDKIYGLSLGADDFIAKP
FT                   FSPRELVLRVHNILRRLHRGGETELISLGNLKMNHSSHEVQIGEEMLDLTVKSFELLWI
FT                   LASNPERVFSKTDLYEKIWKEDYVDDTNTLNVHIHALRQELAKYSSDQTPTIKTVWGLG
FT                   YKIEKPRGQT"
FT   gene            89733..90785
FT                   /locus_tag="SP_0084"
FT   CDS             89733..90785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0084"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74272"
FT                   /protein_id="AAK74272.1"
FT                   /translation="MKLKSYILVGYIISTLLTILVVFWAVQKMLIAKGEIYFLLGMTIV
FT                   ASLVGAGISLFLLLPVFTSLGKLKEHAKRVAAKDFPSNLEVQGPVEFQQLGQTFNEMSH
FT                   DLQVSFDSLEESEREKGLMIAQLSHDIKTPITSIQATVEGILDGIIKESEQAHYLATIG
FT                   RQTERLNKLVEELNFLTLNTARNQVETTSKDSIFLDKLLIECMSEFQFLIEQERRDVHL
FT                   QVIPESARIEGDYAKLSRILVNLVDNAFKYSAPGTKLEVVAKLEKDQLSISVTDEGQGI
FT                   APEDLENIFKRLYRVETSRNMKTGGHGLGLAIARELAHQLGGEITVSSQYGLGSTFTLV
FT                   LNLSGSENKA"
FT   gene            90980..91591
FT                   /gene="rpsD"
FT                   /locus_tag="SP_0085"
FT   CDS             90980..91591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="SP_0085"
FT                   /product="ribosomal protein S4"
FT                   /note="identified by similarity to EGAD:13606; match to
FT                   protein family HMM PF00163; match to protein family HMM
FT                   PF01479; match to protein family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74273"
FT                   /db_xref="GOA:P66565"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66565"
FT                   /protein_id="AAK74273.1"
FT                   /translation="MSRYTGPSWKQARRLGLSLTGTGKELARRNYVPGQHGPNNRSKLS
FT                   EYGLQLAEKQKLRFTYGVGEKQFRNLFVQATKIKGGILGFNFMLLLERRLDNVVYRLGL
FT                   ATTRRQARQFVNHGHILVDGKRVDIPSYRVTPGQVISVREKSLKVPAILEAVEATLGRP
FT                   AFVSFDAEKLEGSLTRLPERDEINPEINEALVVEFYNKML"
FT   gene            91751..91927
FT                   /locus_tag="SP_0086"
FT   CDS             91751..91927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0086"
FT                   /product="IS630-Spn1, transposase Orf1, truncation"
FT                   /note="identified by similarity to GP:5019554"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75794"
FT                   /protein_id="ABC75794.1"
FT                   /translation="MWYNPFMAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWL
FT                   KLKEKTGELNHQV"
FT   gene            complement(92025..92165)
FT                   /locus_tag="SP_0087"
FT   CDS             complement(92025..92165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0087"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74274"
FT                   /protein_id="AAK74274.1"
FT                   /translation="MKSTKEEIQTIKTLLKDSRTAKYHKRLQIVLFCLMGKSYKEIIEL
FT                   L"
FT   gene            92236..92505
FT                   /locus_tag="SP_0088"
FT   CDS             92236..92505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0088"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74275"
FT                   /protein_id="AAK74275.1"
FT                   /translation="MRSLTGVSNPTTDSARLVLAEANKAFADDSLTEQGLRDILQTVKD
FT                   AIASLESIKESQSATKDGGQTAGKETAGEDESANQTQEISQGIK"
FT   gene            92585..92680
FT                   /locus_tag="SP_0089"
FT   CDS             92585..92680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0089"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74276"
FT                   /protein_id="AAK74276.1"
FT                   /translation="MFLADEKGSEHTAAELIDNLKEVIAKLKANA"
FT   gene            92969..93928
FT                   /locus_tag="SP_0090"
FT   CDS             92969..93928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0090"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by similarity to GP:9501759; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74277"
FT                   /protein_id="AAK74277.1"
FT                   /translation="MDIKIKREEIMKKFSKTLRDNWIFLLMVLPGALWLILFFYIPVFG
FT                   NVVAFKDYHMTSNGFIDSIINSKWVGLDNFRFLFSSRDAFIITRNTVLYNLGFIFLGLV
FT                   VSVGIAIILSELRSKRMVKIFQTSMLFPYFLSWVIISFFTDAFLNIDKGVFNHLLESLG
FT                   LKEVNFYADLGIWPYLLLFLGIWKGFGYSSVMYYATIMGIDPTYYEAATVDGASKWQRI
FT                   RNVTIPQLTPLVTVLTILAVGNIFRADFGLFYQIPHNAGQLYNVTNVLDVYVFNGLTQT
FT                   ADIGMAAAAGLYQSVVGLILVILSNLLARRVDPNSALF"
FT   gene            93942..94865
FT                   /locus_tag="SP_0091"
FT   CDS             93942..94865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0091"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by similarity to EGAD:45710; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74278"
FT                   /protein_id="AAK74278.1"
FT                   /translation="MAKKKIKKEKIDNVGIHSFSKKADIFFSIISGLIALSCILPFVFV
FT                   IIISVTDEKSLLQYGYSFFPSQFGLDGFEFLAQFKDKILQALFISVFVTVVGTLTNVFI
FT                   TTTYAYAISRTTFKYRRFFTIFVLLSMLFNAGLVPGYIMVTRVLQLGDTVWALIVPMLL
FT                   SPFNIILMRSFFKKTIPEAILESARIDGASEARIFFQICLPLSLPGIATITLLTALGFW
FT                   NDWFNALLYIKSDNLYPLQYLLMQIQQNMDYIAKAVGLIGQLGVALPKETGRMAMVVVA
FT                   TLPIAILYPFFQRYFVKGLTIGGVKE"
FT   gene            95123..96598
FT                   /locus_tag="SP_0092"
FT   CDS             95123..96598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0092"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74279"
FT                   /protein_id="AAK74279.1"
FT                   /translation="MKNWKKYAFASASVVALAAGLAACGNLTGNSKKAADSGDKPVIKM
FT                   YQIGDKPDNLDELLANANKIIEEKVGAKLDIQYLGWGDYGKKMSVITSSGENYDIAFAD
FT                   NYIVNAQKGAYADLTELYKKEGKDLYKALDPAYIKGNTVNGKIYAVPVAANVASSQNFA
FT                   FNGTLLAKYGIDISGVTSYETLEPVLKQIKEKAPDVVPFAIGKVFIPSDNFDYPVANGL
FT                   PFVIDLEGDTTKVVNRYEVPRFKEHLKTLHKFYEAGYIPKDVATSDTSFDLQQDTWFVR
FT                   EETVGPADYGNSLLSRVANKDIQIKPITNFIKKNQTTQVANFVISNNSKNKEKSMEILN
FT                   LLNTNPELLNGLVYGPEGKNWEKIEGKENRVRVLDGYKGNTHMGGWNTGNNWILYINEN
FT                   VTDQQIENSKKELAEAKESPALGFIFNTDNVKSEISAIANTMQQFDTAINTGTVDPDKA
FT                   IPELMEKLKSEGAYEKVLNEMQKQYDEFLKNKK"
FT   gene            complement(96628..96741)
FT                   /locus_tag="SP_0093"
FT   CDS             complement(96628..96741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0093"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74280"
FT                   /protein_id="AAK74280.1"
FT                   /translation="MVKIRTRENMDIYILVPKKPLPSPDQPEESSDSYFRS"
FT   gene            96713..96820
FT                   /locus_tag="SP_0094"
FT   CDS             96713..96820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0094"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74281"
FT                   /protein_id="AAK74281.1"
FT                   /translation="MFSLVLILTIQEISRTLYNFQSNKLHSFSQAGILV"
FT   gene            96870..97856
FT                   /locus_tag="SP_0095"
FT   CDS             96870..97856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74282"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67330"
FT                   /protein_id="AAK74282.1"
FT                   /translation="MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEG
FT                   INGTVSGDYETTQKYMDYVHSLPGMEELWFKIDEENEQAFKKMFVRYKKEIVHLGLEDN
FT                   DFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTRNDYEYDLGHFRGAIRPDIRNFRE
FT                   LPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQ
FT                   GELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEENE
FT                   DKYLRGCSHECRVHPRNRYVSKNELTQAEVIERLAAIGESLDQAATV"
FT   gene            98131..98991
FT                   /locus_tag="SP_0096"
FT   CDS             98131..98991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0096"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74283"
FT                   /protein_id="AAK74283.1"
FT                   /translation="MAKTFFIPNKQSILGEQEILNAKSILALLDGLESHSYDVVYLRQP
FT                   LNRLEYIECAIVGQSQFLFKVSYADGQKAYRVDLPDLLTKTDWQIIKSFLDALLAYTGT
FT                   DIEGLDGFDFEAYFQASIQAYLADPVARFTICQGIFNPIFFSRENLKSFLEADGLAQFE
FT                   ARVRAVQETDAYFARVSFYQDGEGKVHGVYHLAQGVKTVLPREPFVPAAYIEQLVDKEV
FT                   QWEIDLVQITGDGSKPEDYEAIARLDYAKFLEVLPPSFYHQLDANQIEVQPILDKDFKT
FT                   LAQEK"
FT   gene            complement(99169..100233)
FT                   /locus_tag="SP_0097"
FT   CDS             complement(99169..100233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0097"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:8953759"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74284"
FT                   /protein_id="AAK74284.1"
FT                   /translation="MKQEWFESNDFVKTTSKNKPEEQAQEVADKAEETIADLDTPIEKN
FT                   TQLEEEVPQAEVELESQQEEKIEAPEDSEARTEIEEKKASNSTEEEPDLSKETEKVTIA
FT                   EESQEALPQQKATTKEPLLISKSLESPYIPDQAPKSRDKWKEQVLDFWSWLVEAIKSPT
FT                   SKLETSITHSYTAFLLLILFSASSFFFSIYHIKHAYYGHIASINSRFPEQLAPLTLFSI
FT                   ISILVATTLFFFSFLLGSFVVRRFIHQEKDWTLDKVLQQYSQLLAIPIFLTAIASFFAF
FT                   FDSLRFTALLCVISIGIILLASLHIITRPSQASETDSFYQLFLSVLVNGVIILLFFVAE
FT                   VALIGDYLRILAFL"
FT   gene            complement(100296..101207)
FT                   /locus_tag="SP_0098"
FT   CDS             complement(100296..101207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0098"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74285"
FT                   /protein_id="AAK74285.1"
FT                   /translation="MRKWTKGFLIFGVVTTVIGFILLFVGIQSDGIKSLLSMSKEPVYD
FT                   SRTEKLTFGKEVENLEITLHQHTLTITDSFDDQIHISYHPSLSAHHDLITNQNDRTLSL
FT                   TDKKLSETPFLSSGIGGILHIASSYSSRFEEVILRLPKGRTLKGINISANRGQTTIINA
FT                   SLENATLNTNSYILRIEGSRIKNSKLTTPNIVNIFDTVLTDSQLESTENHFHAENIQVH
FT                   GKVELTAKDYLRIILDQKESQRINWDISSNYGSIFQFTREKPESRGTELSNPYKTEKTD
FT                   VKDQLIARSDDNIDLISTPSRR"
FT   gene            complement(101200..101793)
FT                   /locus_tag="SP_0099"
FT   CDS             complement(101200..101793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0099"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74286"
FT                   /protein_id="AAK74286.1"
FT                   /translation="MTRTEYLTQLELYLKKLPEADRIEAMDYFRELFDDAGVEGEEELI
FT                   ASLGTPKEAAHEVLSNLLDKKINEAPAQKNNRQILHIALLALLAAPIGIPLGIAILVTL
FT                   FAILVAALTVILAFFAVSILGIIGGFLFLVESFTVLAQAKSAFILIFGSGLLAIGASSL
FT                   VLLGISYATRFFGLLIVRLVQFVLKKGKRGNQHA"
FT   gene            complement(101780..102106)
FT                   /locus_tag="SP_0100"
FT   CDS             complement(101780..102106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:173361; match to
FT                   protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74287"
FT                   /protein_id="AAK74287.1"
FT                   /translation="MYFPTSSALIEFLILAVLEQGDSYGYEISQTIKLIANIKESTLYP
FT                   ILKKLEGNSFLTTYSREFQGRMRKYYSLTNGGIEQLLTLKDEWALYTDTINGIIEGSIR
FT                   HDKN"
FT   gene            complement(102245..103411)
FT                   /locus_tag="SP_0101"
FT   CDS             complement(102245..103411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0101"
FT                   /product="putative transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74288"
FT                   /protein_id="AAK74288.1"
FT                   /translation="MKKQSLFFVPGIILIGVSLRTPFTVLPIILGNISQGLEVEVSSLG
FT                   VLTSLPLLMFTLFSPFSTQLAQKIGLEHLFTYSLFFLTIGSLIRLINLPLLYLGTLMVG
FT                   ASVAVINVLLPSLIQANQPKKIGFLTTLYVTSMGIATALASYLAVPITQASSWKGLILL
FT                   LTLLCLATFLVWLPNHRYNHRLAPQTKQKSQIKVMRNKQVWAIIIFSGFQSLIFYTVMT
FT                   WLPTMSIHAGLSSHEAGLLTSILSLISIPFSMTIPSLTTSLSTRNRQLMLTLVSLAGVV
FT                   GISMLFFPINNFIYWLAIHLLIGTATSALFPYLMVNFSLKTSAPEKTAQLSGLSQTGGY
FT                   ILAAFGPTLFGYSFDLFHSWVPSVAALLLIDILMTVALFTVDRADKIL"
FT   gene            103562..104626
FT                   /locus_tag="SP_0102"
FT   CDS             103562..104626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0102"
FT                   /product="glycosyl transferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74289"
FT                   /protein_id="AAK74289.1"
FT                   /translation="MTQNVESLLVSIVISAYNEEKYLPGLIEDLKNQTYPKEDIEILFI
FT                   NAMSTDGTTAIIQQFIKEDTEFNSIRLYNNPKKNQASGFNLGVKHSVGDLILKIDAHSK
FT                   VTETFVMNNVAIIQQGEFVCGGPRPTIVEGKGKWAETLHLVEENMFGSSIANYRNSSED
FT                   RYVSSIFHGMYKREVFQKVGLVNEQLGRTEDNDIHYRIREYGYKIRYSPSILSYQYIRP
FT                   TFKKMLHQKYSNGLWIGLTSHVQFKCLSLFHYVPCLFVLSLVFSLALLPITFVFITLLL
FT                   GAYFLLLSLLTLLTLLKHKNGFLIVMPFILFSIHFAYGLGTIVGLIRGFKWKKEYKRTI
FT                   IYLDKISQINQNML"
FT   gene            104668..106518
FT                   /locus_tag="SP_0103"
FT   CDS             104668..106518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0103"
FT                   /product="putative capsular polysaccharide biosynthesis
FT                   protein"
FT                   /note="identified by similarity to GP:6601348; match to
FT                   protein family HMM PF02719; match to protein family HMM
FT                   PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74290"
FT                   /protein_id="AAK74290.1"
FT                   /translation="MNKKLTDYVIDLVEILNKQQKQVFWGIFDIFSMVVSIIVSYILFY
FT                   GLINPAPVDYIIYTSLAFLFYQLMIGFWGLNASISRYSKITDFMKIFFGVTASSVLSYS
FT                   ICYAFLPLFSIRFIILFILLSTFLILLPRITWQLIYSRRKKGSGDGEHRRTFLIGAGDG
FT                   GALFMDSYQHPTSELELVGILDKDSKKKGQKLGGIPVLGSYDNLPELAKRHQIERVIVA
FT                   IPSLDPSEYERILQMCNKLGVKCYKMPKVETVVQGLHQAGTGFQKIDITDLLGRQEIRL
FT                   DESRLGAELTGKTILVTGAGGSIGSEICRQVSRFNPERIVLLGHGENSIYLVYHELIRK
FT                   FQGIDYVPVIADIQDYDRLLQVFEQYKPAIVYHAAAHKHVPMMERNPKEAFKNNIRGTY
FT                   NVAKAVDEAKVSKMVMISTDKAVNPPNVMGATKRVAELIVTGFNQRSQSTYCAVRFGNV
FT                   LGSRGSVIPVFERQIAEGGPVTVTDFRMTRYFMTIPEASRLVIHAGAYAKDGEVFILDM
FT                   GKPVKIYDLAKKMVLLSGHTESEIPIVEVGIRPGEKLYEELLVSTELVDNQVMDKIFVG
FT                   KVNVMPLESINQKIGEFRTLSGDELKQAIIAFANQTTHIE"
FT   gene            complement(106956..107588)
FT                   /locus_tag="SP_0104"
FT   CDS             complement(106956..107588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0104"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74291"
FT                   /protein_id="AAK74291.1"
FT                   /translation="MTSITAIFFDLDGTLVDSSIGIHNAFTYTFKELGVPSPDAKTIRG
FT                   FMGPPLESSFATCLSKDQISEAVQIYRSYYKAKGIYEAQLFPQIIDLLEELSSSYPLYI
FT                   TTTKDTSTAQDMAKNLEIHHFFDGIYGSSPEAPHKADVIHQALQTHQLAPEQAIIIGDT
FT                   KFDMLGARETGIQKLAITWGFGEQADLLNYQPDYIAHKPLEVLAYFQ"
FT   gene            complement(107610..108482)
FT                   /gene="sdhA"
FT                   /locus_tag="SP_0105"
FT   CDS             complement(107610..108482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="SP_0105"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /EC_number="4.3.1.17"
FT                   /note="identified by similarity to EGAD:154938; match to
FT                   protein family HMM PF03313; match to protein family HMM
FT                   TIGR00718"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74292"
FT                   /protein_id="AAK74292.1"
FT                   /translation="MFYSIKELVEQADLDFQGNVAELMITTEFELTGREREEVFLLMER
FT                   NLEVMKASVQLGLNENKSRSGLTGGDAAKLDHYIENGKTLSDYTILSAARNAIAVNEHN
FT                   AKMGLVCATPTAGSAGCLPSVLTAAIEKLDLSHEQQLDFLFAAGAFGLVIANNASISGA
FT                   EGGCQAEVGSASAMSAAALTLAAGGTPYQASQAIAFVIKNMLGLICDPVAGLVEVPCVK
FT                   RNAMGASFAFIAADMALAGIESKIPVDEVIDAMYQVGASMPTAFRETAEGGLATTPTGR
FT                   RLQKEIFGE"
FT   gene            complement(108491..109162)
FT                   /gene="sdhB"
FT                   /locus_tag="SP_0106"
FT   CDS             complement(108491..109162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="SP_0106"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent, beta
FT                   subunit"
FT                   /EC_number="4.3.1.17"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF03315; match to protein
FT                   family HMM TIGR00719"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74293"
FT                   /protein_id="AAK74293.1"
FT                   /translation="MKSLRFQSVFDIIGPVMIGPSSSHTAGAVRIGKIVSSIFDDTPTE
FT                   VEFQLFNSFAKTYRGHGTDLALVAGILGMDTDDPEIPNSLEIAHKRGIKIVWTIQKDSN
FT                   APHPNTTKITVKNAHKTISVTGISIGGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGM
FT                   IALVTEALSRYGINIAQMNVTREKAGEKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFF
FT                   K"
FT   gene            109404..109991
FT                   /locus_tag="SP_0107"
FT   CDS             109404..109991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0107"
FT                   /product="LysM domain protein"
FT                   /note="identified by similarity to EGAD:154417; match to
FT                   protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74294"
FT                   /protein_id="AAK74294.1"
FT                   /translation="MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSE
FT                   IAETHNTTVEKLAENNHIDNIHLIYVDQELVIDGPVAPVATPAPATYAAPAAQDETVSA
FT                   PVAETPVVSETVVSTVSGSEAEAKEWIAQKESGGSYTATNGRYIGRYQLTDSYLNGDYS
FT                   AENQERVADAYVAGRYGSWTAAKNFWLNNGWY"
FT   gene            complement(110043..110363)
FT                   /locus_tag="SP_0108"
FT   CDS             complement(110043..110363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0108"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74295"
FT                   /protein_id="AAK74295.1"
FT                   /translation="MQRLEVYKNYQRLYDLRIAILLNLSTLYLYNQDKNMCKQICYTLL
FT                   EDAKNKKSYDRLAICYVPIGICTDDSKLIQKGFSLLELTEETSMLSHLKKEVEIYYQAK
FT                   ER"
FT   gene            110794..111081
FT                   /locus_tag="SP_0109"
FT   CDS             110794..111081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0109"
FT                   /product="putative bacteriocin"
FT                   /note="identified by similarity to GP:3355782; match to
FT                   protein family HMM TIGR01653"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74296"
FT                   /protein_id="AAK74296.1"
FT                   /translation="MRKLVKIGVASLMVCGILATTNALAVWVEGGQWNYGVGWTGTFGY
FT                   SDYLHSTRYHTATVRHGGRTSKDYAKPEAWARASLTKIPPTGMEYFYGFE"
FT   gene            111157..113241
FT                   /locus_tag="SP_0110"
FT   CDS             111157..113241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0110"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74297"
FT                   /protein_id="AAK74297.1"
FT                   /translation="MLLLLLCTTFFVFNVNYTREVVRIQEMGKTVDSLDLYLKDINEPA
FT                   ASVLRFFEDVSKEYKVSIIKTDSGDEVVKSGVFDKDTFPYQEFGISSLDFTTDGEGVYS
FT                   NKEISNKLGTIPTFLKAKPIQLMTFQTYIKDTSRSLNGRYTITSTQEMDKDRIVQKWSD
FT                   FFKIDQATLLEPTYKSAVEVINRDLLLSAIVFVLAILLLVLVTVYQPMMEMKRVGVQKL
FT                   LGFQDRAVLADVVKGNLYLLLGGALVINLGVFFLLDYKPKDLFPMLWLSHFLLLQLYLF
FT                   ISWLTYLLIQKMTISSLLKGFSSFKFGLIFNYVMKIGTTILLTALLIGVGRSLEQENKE
FT                   LAYQQQWVSQGNYLTLETFKLNDNLWQEELAGSGKSTDYFYRFYQDLVEKTQAGYVQSS
FT                   SLPVKNFVQSEQIQQYQLTDTVDVYYANRNFLKSKGFKLPNTGIKKVILMPASTKGEED
FT                   KNQLLGKLIAFHSMKYEEQQKRTIEEMDVEIAYYEGDWSFFPYSDKRKENLSNPIISLV
FT                   NDSDMMWDEKASLSTTGLNNPIKIENTVQHQKEITELVEKLSDGNYLKFSSIQAIQQEK
FT                   VDSYRDAVRNFNLLFALFGLLSMMISYFLLVTTFLLKRRDIITKKFMGWKLVDRYRPLL
FT                   VLLLLGYSFPLLVLIFFAHAFLPLLLFAGFTCLDILFVLGLASRMEKRSLVELLKGGIL
FT                   "
FT   gene            113238..113879
FT                   /locus_tag="SP_0111"
FT   CDS             113238..113879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0111"
FT                   /product="putative amino acid ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by similarity to EGAD:6883; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74298"
FT                   /protein_id="AAK74298.1"
FT                   /translation="MIELKNITKTIGGKVILDNLSLRIDQGDLVAIVGKSGSGKSTLLN
FT                   LLGLIDGDYSGRYEIFGQTNLAVNSAKSQTIIREHISYLFQNFALIDDETVEYNLMLAL
FT                   KYVKLPKKDKLKKVEEILERVGLSATLHQRVSELSGGEQQRIAVARAILKPSQLILADE
FT                   PTGSLDPENRDLVLKFLLEMNREGKTVIIVTHDAYVAQQCHRIIELGEGK"
FT   gene            114086..114892
FT                   /locus_tag="SP_0112"
FT   CDS             114086..114892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0112"
FT                   /product="putative amino acid ABC transporter, periplasmic
FT                   amino acid-binding protein"
FT                   /note="identified by similarity to EGAD:91736; match to
FT                   protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74299"
FT                   /protein_id="AAK74299.1"
FT                   /translation="MNKMKKVLMTMFGLVMLPLLFACSNNQSAGIEAIKSKGKLVVALN
FT                   PDFAPFEYQKVVDGKNQIVGSDIELAKAIATKLGVELELSPMSFDNVLASVQSGKADLA
FT                   ISGVSKTDERSKVFDFSIPYYTAKNKLIVKKSDLTTYQSVNDLAQKKVGAQKGSIQETM
FT                   AKDLLQNSSLVSLPKNGNLITDLKSGQVDAVIFEEPVSKGFVENNPDLAIADLNFEKEQ
FT                   DDSYAVAMKKDSKKLKEAVDKTIQKLKESGELDKLIEDAFKASIEK"
FT   gene            114909..115328
FT                   /gene="argG"
FT                   /locus_tag="SP_0113"
FT   CDS             114909..115328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="SP_0113"
FT                   /product="argininosuccinate synthase, truncation"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75801"
FT                   /protein_id="ABC75801.1"
FT                   /translation="MSKEKVILAYSGGLDTSVAITWLKKDYDVVSVCMDVGEGKDLDFI
FT                   HDKALKVWAVESYVIDVKDEFATDYVLVAHQSHAYYEQKYLLVSALSRPLISKKLVEIA
FT                   HQIGATTIAHGCTGKGNDQVEYQIAVAKKANEAKK"
FT   gene            complement(115515..115835)
FT                   /locus_tag="SP_0114"
FT   CDS             complement(115515..115835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0114"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74300"
FT                   /protein_id="AAK74300.1"
FT                   /translation="MQRLEVYKNYQHLYDLRIAILLNLSTLYLYNQDKNMCKQICYTLL
FT                   EDAKNKKSYDRLAICYVRIGICTDDSKLIQKGFSLLELTEETSMLSHLKKEVETHYQPK
FT                   KL"
FT   gene            116593..116973
FT                   /locus_tag="SP_0115"
FT   CDS             116593..116973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0115"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74301"
FT                   /protein_id="AAK74301.1"
FT                   /translation="MELVLPNNYVALEQEEMMYLDGGGVGRNWWNSRGSFATVLDVDLA
FT                   IYSGGATIYSAYAIKKAISANRGAITRTLRSLIIKHVGSAAGHLVNTALNVALTVTGFS
FT                   LGGAIAYGADWADGSLDGYIFA"
FT   gene            117625..117870
FT                   /locus_tag="SP_0116"
FT   CDS             117625..117870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0116"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74302"
FT                   /protein_id="AAK74302.1"
FT                   /translation="MSLKLLDCILDYQERFNGKTCQVSTNYKYLEIFKVNFCLTDLHHL
FT                   FDLHKITRDYASQTKPAIQDGVFILEDFRNILCTMM"
FT   gene            118423..120657
FT                   /gene="pspA"
FT                   /locus_tag="SP_0117"
FT   CDS             118423..120657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="SP_0117"
FT                   /product="pneumococcal surface protein A"
FT                   /note="identified by similarity to GP:6752403; match to
FT                   protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74303"
FT                   /protein_id="AAK74303.1"
FT                   /translation="MNKKKMILTSLASVAILGAGFVTSQPTFVRAEESPQVVEKSSLEK
FT                   KYEEAKAKADTAKKDYETAKKKAEDAQKKYEDDQKRTEEKARKEAEASQKLNDVALVVQ
FT                   NAYKEYREVQNQRSKYKSDAEYQKKLTEVDSKIEKARKEQQDLQNKFNEVRAVVVPEPN
FT                   ALAETKKKAEEAKAEEKVAKRKYDYATLKVALAKKEVEAKELEIEKLQYEISTLEQEVA
FT                   TAQHQVDNLKKLLAGADPDDGTEVIEAKLKKGEAELNAKQAELAKKQTELEKLLDSLDP
FT                   EGKTQDELDKEAEEAELDKKADELQNKVADLEKEISNLEILLGGADPEDDTAALQNKLA
FT                   AKKAELAKKQTELEKLLDSLDPEGKTQDELDKEAEEAELDKKADELQNKVADLEKEISN
FT                   LEILLGGADSEDDTAALQNKLATKKAELEKTQKELDAALNELGPDGDEEETPAPAPQPE
FT                   QPAPAPKPEQPAPAPKPEQPAPAPKPEQPAPAPKPEQPAPAPKPEQPAKPEKPAEEPTQ
FT                   PEKPATPKTGWKQENGMWYFYNTDGSMAIGWLQNNGSWYYLNANGAMATGWVKDGDTWY
FT                   YLEASGAMKASQWFKVSDKWYYVNSNGAMATGWLQYNGSWYYLNANGDMATGWLQYNGS
FT                   WYYLNANGDMATGWAKVNGSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWVKDGD
FT                   TWYYLEASGAMKASQWFKVSDKWYYVNGLGALAVNTTVDGYKVNANGEWV"
FT   gene            121058..122179
FT                   /gene="trmU"
FT                   /locus_tag="SP_0118"
FT   CDS             121058..122179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="SP_0118"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="identified by match to protein family HMM PF03054;
FT                   match to protein family HMM TIGR00420"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74304"
FT                   /db_xref="GOA:Q97T38"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="PDB:2HMA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T38"
FT                   /protein_id="AAK74304.1"
FT                   /translation="MSDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDTD
FT                   ENGVCTATEDYKDVVAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCN
FT                   KEIKFKAFLDYAITLGADYVATGHYARVARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQ
FT                   LQKTMFPLGHLEKPEVRRLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLPAQPGRM
FT                   MTVDGRDMGEHAGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHD
FT                   SLMSTSLEASQVHFTREMPEEFTLECTAKFRYRQPDSKVTVHVKGEKTEVIFAEPQRAI
FT                   TPGQAVVFYDGEECLGGGLIDNAYRDGQVCQYI"
FT   gene            122320..122775
FT                   /locus_tag="SP_0119"
FT   CDS             122320..122775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0119"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by similarity to EGAD:16514; match to
FT                   protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74305"
FT                   /protein_id="AAK74305.1"
FT                   /translation="MTQQDFRTKVDNTVFGVRATALIVQNHKLLVTKDKGKYYTIGGAI
FT                   QVNESTEDAVVREVKEELGVKAQAGQLAFVVENRFEVDGVSYHNIEFHYLVDLLEDAPL
FT                   TMQEDEKRQPCEWIDLDKLQNIQLVPVFLKTALPDWEGQLRHIHLEE"
FT   gene            122785..124698
FT                   /gene="gidA"
FT                   /locus_tag="SP_0120"
FT   CDS             122785..124698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="SP_0120"
FT                   /product="glucose-inhibited division protein A"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR00136"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74306"
FT                   /db_xref="GOA:Q97T36"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T36"
FT                   /protein_id="AAK74306.1"
FT                   /translation="MTYHFTEEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLA
FT                   FMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKE
FT                   LYSKEMRKTVENQENLTLRQTMIDEILVEDGKVVGVRTATHQEYAAKAVIVTTGTALRG
FT                   EIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPG
FT                   DEVPNHFSYTSRDEDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCP
FT                   SIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMM
FT                   RTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQ
FT                   GKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREI
FT                   GLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLR
FT                   RPEVSYQDVVAFIGPAAEDLDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPAN
FT                   IDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNRSISKTLQK
FT                   SK"
FT   gene            complement(125051..126730)
FT                   /locus_tag="SP_0121"
FT   CDS             complement(125051..126730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0121"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM PF07521; match to protein
FT                   family HMM TIGR00649"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74307"
FT                   /protein_id="AAK74307.1"
FT                   /translation="MAYTLKPEEVGVFAIGGLGEIGKNTYGIEYQDEIIIVDAGIKFPE
FT                   DDLLGIDYVIPDYSYIVDNIDRVKAVLITHGHEDHIGGIPFLLKQANVPIYAGPLALAL
FT                   IRGKLEEHGLLRNAKLYEINHNTELTFKNLKATFFRTTHSIPEPLGIVIHTPQGKIVCT
FT                   GDFKFDFTPVGEPADLHRMAALGEEGVLCLLSDSTNAEVPTFTNSEKVVGQSIMKIIQG
FT                   IEGRIIFASFASNIFRLQQATEAAVKTGRKIAVFGRSMEKAIVNGIDLGYIKAPKGTFI
FT                   EPNEIKDYPAGEVLILCTGSQGEPMAALSRIANGTHRQVQLQPGDTVIFSSSPIPGNTT
FT                   SVNKLINIISEAGVEVIHGKVNNIHTSGHGGQQEQKLMLCLIKPKYFMPVHGEYRMQKV
FT                   HAGLAVDTGVEKDNIFIMSNGDVLALTADSARIAGHFNAQDIYVDGNRIGEIGAAVLKD
FT                   RRDLSEDGVVLAVATVDFKSQMILSGPDILSRGFVYMRESGDLIRQSQRILFNAIRIAL
FT                   KNKDASVQSVNGAIVNAIRPFLYENTEREPIIIPMILTPDEE"
FT   gene            complement(126732..126965)
FT                   /locus_tag="SP_0122"
FT   CDS             complement(126732..126965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:107894; match to
FT                   protein family HMM PF07288"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74308"
FT                   /db_xref="InterPro:IPR009907"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T34"
FT                   /protein_id="AAK74308.1"
FT                   /translation="MIYKVFYQETKERSPRRETTRTLYLDIDASSELEGRITARQLVEE
FT                   NRPEYNIEYIELLSDKLLDYEKETGAFEITEF"
FT   gene            complement(127291..127536)
FT                   /gene="ccs1"
FT                   /locus_tag="SP_0123"
FT   CDS             complement(127291..127536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccs1"
FT                   /locus_tag="SP_0123"
FT                   /product="competence-induced protein Ccs1"
FT                   /note="identified by similarity to EGAD:50614"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74309"
FT                   /protein_id="AAK74309.1"
FT                   /translation="MGWNFRVVNLLSLHSQTKNPSISRASKHLIQSKIQTKRHRSRGGE
FT                   KASRESQRSFSTRTWFVVVPVWQIEDSPHKRKQQKQ"
FT   gene            complement(127783..127935)
FT                   /locus_tag="SP_0124"
FT   CDS             complement(127783..127935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0124"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74310"
FT                   /protein_id="AAK74310.1"
FT                   /translation="MMKDLNNYREISNKELQEIKGGFGVGVGIALFMAGYTIGKDLRKK
FT                   FGKSC"
FT   gene            complement(127937..128122)
FT                   /locus_tag="SP_0125"
FT   CDS             complement(127937..128122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0125"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74311"
FT                   /protein_id="AAK74311.1"
FT                   /translation="MTNFDILDNQFLSLSENELSDIDGGLAPLVIFGVAVSWKAIAGGT
FT                   ALIGSGLAAGYFLGGD"
FT   gene            128097..128204
FT                   /locus_tag="SP_0126"
FT   CDS             128097..128204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0126"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74312"
FT                   /protein_id="AAK74312.1"
FT                   /translation="MSRMSKFVIELSSFFLVHFYIRKRKGKVSIFLNYF"
FT   gene            128300..128983
FT                   /locus_tag="SP_0127"
FT   CDS             128300..128983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3341437; match to
FT                   protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74313"
FT                   /protein_id="AAK74313.1"
FT                   /translation="MKVLAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDF
FT                   LMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAHTLNIELVGMSSLLALVPHQQ
FT                   EGLFVPLMDARRNNVYAGFYENAKPVMAEAHLSFEEVLEKVKGTSQVTFVGEVGPFVEQ
FT                   IQKHLPRTDYKETLPNAANLALLAWDKEADSLHDFVPNYLKRVEAEENWLKNHTESGES
FT                   YIKRL"
FT   gene            128980..129417
FT                   /locus_tag="SP_0128"
FT   CDS             128980..129417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0128"
FT                   /product="putative ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM TIGR01575"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74314"
FT                   /protein_id="AAK74314.1"
FT                   /translation="MIEIKRIQQQPDLAQAIYAVMAAVYLVSPWTLEQIQADLSQDQTW
FT                   YALAYDGAEVIGFLAVQENLFEAEVLQIAVKGAYQGQGIASALFAQLPTDKEIFLEVRQ
FT                   SNQRAQAFYKKEKMTVIAERKAYYHDPVEDAIIMKREIDEG"
FT   gene            129407..130417
FT                   /locus_tag="SP_0129"
FT   CDS             129407..130417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0129"
FT                   /product="glycoprotease family protein"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74315"
FT                   /db_xref="GOA:Q97T27"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T27"
FT                   /protein_id="AAK74315.1"
FT                   /translation="MKDRYILAFETSCDETSVAVLKNDDELLSNVIASQIESHKRFGGV
FT                   VPEVASRHHVEVITACIEEALAEAGITEEDVTAVAVTYGPGLVGALLVGLSAAKAFAWA
FT                   HGLPLIPVNHMAGHLMAAQSVEPLEFPLLALLVSGGHTELVYVSEAGDYKIVGETRDDA
FT                   VGEAYDKVGRVMGLTYPAGREIDELAHQGQDIYDFPRAMIKEDNLEFSFSGLKSAFINL
FT                   HHNAEQKGESLSTEDLCASFQAAVMDILMAKTKKALEKYPVKILVVAGGVAANKGLRER
FT                   LAAEITDVKVIIPPLRLCGDNAGMIAYASVSEWNKENFAGWDLNAKPSLAFDTME"
FT   gene            complement(130250..131763)
FT                   /pseudo
FT                   /locus_tag="SP_0130"
FT                   /note="Missing the proper stop codon.; IS1167, transposase,
FT                   degenerate; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GP:2804700"
FT   gene            complement(132039..132390)
FT                   /pseudo
FT                   /locus_tag="SP_0131"
FT                   /note="IS630-Spn1, transposase Orf2, degenerate; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:5019553"
FT   gene            complement(132603..132790)
FT                   /pseudo
FT                   /locus_tag="SP_0132"
FT                   /note="IS630-Spn1, transposase Orf1, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing error;
FT                   identified by similarity to GP:4200438"
FT   gene            133024..133587
FT                   /locus_tag="SP_0133"
FT   CDS             133024..133587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0133"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74316"
FT                   /protein_id="AAK74316.1"
FT                   /translation="MVTMQYSCGKININIPDGYGDIKDIVFSAHIIVRYNNGHCGGIDP
FT                   HIIGLCKKQIRRMSLYPILIIVSRDSKVIDDYKNLDIAYVDCTQCSNNFETALHVKNIL
FT                   KLLKIQLIHCHGYSTNYFLYMLKKLDKNGFGKVKTVITCHGWVEYNLKKKFLTYFDFWT
FT                   YSMGDAFICVSETMKKKIGEYNKK"
FT   gene            133565..133771
FT                   /locus_tag="SP_0134"
FT   CDS             133565..133771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74317"
FT                   /protein_id="AAK74317.1"
FT                   /translation="MESIIKNKKIVAINNGINVSNSDLDVVGVQDFKKEFCIPNNKKSF
FT                   VMLEGWIQKKGRIDSLNLQKNYF"
FT   gene            133795..134238
FT                   /locus_tag="SP_0135"
FT   CDS             133795..134238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0135"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74318"
FT                   /protein_id="AAK74318.1"
FT                   /translation="MAGNGSMWAALKEKICHLKCRDNFRLLGEIYPATIVYQISDLLYI
FT                   PSDTEGIPMCVLESMSQGTPVLASNVGGLSEIIEHRVDGFLFEKEDVEGVCACANFLLN
FT                   DSEYLKYIGENSKSKIRKHFSVQKMFVETMRVYDELLEKSSHG"
FT   gene            134231..135106
FT                   /locus_tag="SP_0136"
FT   CDS             134231..135106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0136"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74319"
FT                   /protein_id="AAK74319.1"
FT                   /translation="MDRNIDQELVSIIIPTHNRYESLIRAVKSCLHQSYKNIEVIIIDD
FT                   NYSNVNLRNKIIHQFGYTNHRIKLILSNEDLGATNARNIGIKNSRGKYISFLDDDDEYM
FT                   PDRILKLMACFKKSRMKNLALVCSYGIIIYPNGTREEEKTDFVGNPLFVQMVHNIAGTS
FT                   FWLCKKEVLELINGFEKIDSHQDGVVLLKLLVQGYQIDIVREFLVNYYAHSKENGITGV
FT                   TQKTINADEEYYNYCRKYFNLLSFNERILVTKKYYSLNIKRLLLIGDKCKALKVIKKAR
FT                   EEKIFNEFLF"
FT   gene            135193..136809
FT                   /locus_tag="SP_0137"
FT   CDS             135193..136809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0137"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74320"
FT                   /protein_id="AAK74320.1"
FT                   /translation="MYTIIKSNIKKFSLLTIFIVAGQLLLIYAATINALVLNELIAMNL
FT                   ERFLKLSIYQMIVWCGIIFLDWVVKNYQVEVIQEFNLEIRNRVATDISNSTYQEFHSKS
FT                   SGTYLSWLNNDVQTLNDQAFKQLFLVIKGISGTIFAVVTLNHYHWSLTVATLFSLMIML
FT                   LVPKIFASKMREVSLNLTNQNEAFLKSSETILNGFDVLASLNLLYVLPKKIKEAGILLK
FT                   MVIQRKTTVETLAGAISFFLNIFFQISLVFLTGYLAIKGIVKIGTIEAIGALTGVIFTA
FT                   LGELGGQLSSIIGTKPIFLKLYSINPIESNKMNDIEPNEVNRDFPLYEAKNICYKYGDK
FT                   EILKNLNFCFQRNEKYLILGESGSGKSTLLKLLNGFLRDYSGELRFCGDDIKKTSYLNM
FT                   VSNVLYVDQKAYLFEGTIRDNILLEENYTDEEILQSLEQVGLSVKDFPNNILDYYVGDD
FT                   GRLLSGGQKQKITLARGLIRNKKIVLIDEGTSAIDRRTSLAIERKILDREDLTVIIVTH
FT                   APHPELKQYFTKIYQFPKDFI"
FT   gene            137031..137498
FT                   /locus_tag="SP_0138"
FT   CDS             137031..137498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0138"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74321"
FT                   /protein_id="AAK74321.1"
FT                   /translation="MHSFGIHPRYPYKMSEIVEMSKKISDLNDKKEFHKKNCELRFQDS
FT                   VLDNINSVPGTTHLFSCLNIQTLVKIILYIFRYNSCMKIFNFRDKELIFFNKIVNGLIQ
FT                   NIEENLEDDIERILKYLYICLFNEIFIIKNKVNFFDDVEFNQTLSEFLDKL"
FT   gene            137504..138259
FT                   /locus_tag="SP_0139"
FT   CDS             137504..138259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0139"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:4689219; match to
FT                   protein family HMM PF02585"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74322"
FT                   /protein_id="AAK74322.1"
FT                   /translation="MVMSNNTKYIFLSPHLDDAIFSCGDYISKLTSEGEIVLVITIFSG
FT                   YPLSQQLQPSAKQFHKLCNLGKYPIEERKKEDRLACERLQCDFRHLSYYECLYRKDRNG
FT                   NFLYRHIYSELKNEDTLKNDIIKELLMHLDDKCVVYCPLSLGDHVAHVFVNSIGRALEF
FT                   MRYKVIYYEDFPYVSDSSMVSYMGKTKELKMYQEELDEKNYIDRISSILCYKSQILIIW
FT                   KSVEKLLNNIKELYLRNGAAYSIRFWIKK"
FT   gene            138272..139443
FT                   /pseudo
FT                   /gene="ugd"
FT                   /locus_tag="SP_0140"
FT                   /note="UDP-glucose 6-dehydrogenase, authentic frameshift;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to EGAD:7319"
FT   gene            139839..140702
FT                   /locus_tag="SP_0141"
FT   CDS             139839..140702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0141"
FT                   /product="transcriptional regulator"
FT                   /note="identified by similarity to GP:4102023; match to
FT                   protein family HMM TIGR01716"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74323"
FT                   /protein_id="AAK74323.1"
FT                   /translation="MIERMELGEFYKELRLARKLKQSDVACEGLTASQLSKFELGQSML
FT                   SADKLILAIQGINVTFDEFGHKLNNYQESPHMRIGRKVVNRFAHQDIAALEQLLEEVDQ
FT                   EQMAQTYRRLNAIVIKDAIHSLNKSYPLAEEDSEFLTTYLYAIESWTWFELYLFCNTMP
FT                   FLSNQDLIFLSTSLLEKSKEFKELVHNRLYMKQGLLNILSELMERKLFSYIPIFEAELE
FT                   RMLRPYDVFEKVSWQFLKKMSVFLQTKGSNQKEIERFIQSLQVLENPQLIALFELRFQQ
FT                   YKELID"
FT   gene            140988..141221
FT                   /locus_tag="SP_0142"
FT   CDS             140988..141221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0142"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74324"
FT                   /protein_id="AAK74324.1"
FT                   /translation="MLNLQFAETMELTEAELQDVRGGNLVNSMGGGGRSGISGWGVPGI
FT                   YPGWGNQGMSPNRGAFDWTIDLADGLFGRRRR"
FT   gene            141243..141920
FT                   /locus_tag="SP_0143"
FT   CDS             141243..141920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0143"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to EGAD:107498; match to
FT                   protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74325"
FT                   /protein_id="AAK74325.1"
FT                   /translation="MKKMKEVKFHLATGLLILTYYLIFNVTSDLDFMVALSDNMYYVFQ
FT                   VLLVLILGTIATIAFVKSEHWKECGRFQFRWSYLGVFLLSFFLLFVWANLTTYIFPRTQ
FT                   NGSTVVEVATNLTGISYFVTRILYTSIIAPVSEEVVCRGLLMTSLSKVKRYYLDVLVSA
FT                   AIFGAMHVLQYGWITTDFIKYFGMGLIFCMMFRYTRSIYWAIALHASWNSFLLIVTLLV
FT                   FGY"
FT   gene            141932..142597
FT                   /locus_tag="SP_0144"
FT   CDS             141932..142597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0144"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74326"
FT                   /protein_id="AAK74326.1"
FT                   /translation="MKKIISHRYFIIVFLLVIADQKFSVLVLRSDLVTGLSDFAYYLSD
FT                   MMLNFLVVLFALIAMIWSGKWQKINSRKFKGSYLFYSFLALLAFVVWNFVTFFLFPPTR
FT                   NEISYQHAAPTFTGATAFLMYFFYPVIAGPIFEDMIYRGLVMTALEKGKKWGLDVLGSA
FT                   VLFGVSHISNHGWVLTDFVFYMGGGLIFAVLFRMTKSIYWPIGLHIVYNGIGQLLMLL"
FT   gene            142669..143895
FT                   /locus_tag="SP_0145"
FT   CDS             142669..143895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3582221; match to
FT                   protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74327"
FT                   /protein_id="AAK74327.1"
FT                   /translation="MKVFLQNRDFRQLTINQWISTLGDTIFYLAFLNYVADASFAPLAI
FT                   LLITISETLPQVLQIFLGVLADFQHHRVLKYTVISFAKFLLYSIVSLSLSGQSFSLLLV
FT                   AFICLINLLSDTLSYFSGAMLTPIFIRIIGQDHLAEAIGFKQSTVSLVKTISNILGGVL
FT                   LGILSIQFISLLNALTFLIAFLGILFIKTDLLKVEKTISYQEGLSVKSFCQHLLQSSKL
FT                   IWNMNKVLLVLFIISTSQAVINVTVPISTLFLRNQPFLNLQTGQSLALLATLELSALIV
FT                   GSLVSGYLQHTISIKTALYASLVIQLLLLVGFATVRFDWILIFSTLDAFFAGVLSPRLQ
FT                   ELVFKQIPEESMGAVQSSIGAITVVLPSLFTIALVTIATSFGTLAVSFVLLLFLLVAFV
FT                   MLLNIRESI"
FT   gene            144440..145096
FT                   /locus_tag="SP_0146"
FT   CDS             144440..145096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:166577; match to
FT                   protein family HMM PF03591"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74328"
FT                   /protein_id="AAK74328.1"
FT                   /translation="MPTALGYVSIGLACGIIGAPYVTPVEMGLMSLFVYAGSAQFAMLA
FT                   LIVVQAPVAAIAMTVFLINLRLFLLSLHASTYFRHTSLWYNIGMSSILTDETYGVLMGE
FT                   LAHTDKVNPMWMHGNNLNSYVAWFVGTVVGTALGGLLPNPEIFGLDFALVGMFIGIFAS
FT                   QFQIMQRRIPVRNLLIILAVVAVSFFLLLTVMSQSLAVLFATLLGCSMGVVLDGQ"
FT   gene            145086..145295
FT                   /locus_tag="SP_0147"
FT   CDS             145086..145295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0147"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74329"
FT                   /protein_id="AAK74329.1"
FT                   /translation="MVSKYLLLAVIFSGLVTWIPRMIPFILVKYKGLPAIVERFLKFLP
FT                   VSIIFALILSSVVTGKVGSLPQIK"
FT   gene            145513..146343
FT                   /locus_tag="SP_0148"
FT   CDS             145513..146343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0148"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74330"
FT                   /protein_id="AAK74330.1"
FT                   /translation="MKKIVKYSSLAALALVAAGVLAACSGGAKKEGEAASKKEIIVATN
FT                   GSPKPFIYEENGELTGYEIEVVRAIFKDSDKYDVKFEKTEWSGVFAGLDADRYNMAVNN
FT                   LSYTKERAEKYLYAAPIAQNPNVLVVKKDDSSIKSLDDIGGKSTEVVQATTSAKQLEAY
FT                   NAEHTDNPTILNYTKADLQQIMVRLSDGQFDYKIFDKIGVETVIKNQGLDNLKVIELPS
FT                   DQQPYVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYLPAEADIK"
FT   gene            146497..147351
FT                   /locus_tag="SP_0149"
FT   CDS             146497..147351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0149"
FT                   /product="lipoprotein"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74331"
FT                   /protein_id="AAK74331.1"
FT                   /translation="MKIKKWLGLAALATVAGLALAACGNSEKKADNATTIKIATVNRSG
FT                   SEEKRWDKIQELVKKDGITLEFTEFTDYSQPNKATADGEVDLNAFQHYNFLNNWNKENG
FT                   KDLVAIADTYISPIRLYSGLNGSANKYTKVEDIPANGEIAVPNDATNESRALYLLQSAG
FT                   LIKLDVSGTALATVANIKENPKNLKITELDASQTARSLSSVDAAVVNNTFVTEAKLDYK
FT                   KSLFKEQADENSKQWYNIIVAKKDWETSPKADAIKKVIAAYHTDDVKKVIEESSDGLDQ
FT                   PVW"
FT   gene            147451..148824
FT                   /locus_tag="SP_0150"
FT   CDS             147451..148824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0150"
FT                   /product="peptidase, M20/M25/M40 family"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74332"
FT                   /protein_id="AAK74332.1"
FT                   /translation="MVFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKEV
FT                   ANYLGEIFKRVGAEVEIDESYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVWTE
FT                   DPFTLSVRNGFMYGRGVDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESASTD
FT                   LDKYLEKHADKLRGADLLVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIHSSYG
FT                   GVVESAPWYLLQALQSLRAADGRILVEGLYEEVQEPNEREMALLETYGQRNPEEVSRIY
FT                   GLELPLLQEERMAFLKRFFFDPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLE
FT                   PHDVLEKIRKQLDKNGFDKVELYYTLGEMSYRSDMSAPAILNVIELAKKFYPQGVSVLP
FT                   TTAGTGPMHTVFDALEVPMVAFGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE"
FT   gene            148817..149878
FT                   /locus_tag="SP_0151"
FT   CDS             148817..149878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0151"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74333"
FT                   /db_xref="GOA:Q97T09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T09"
FT                   /protein_id="AAK74333.1"
FT                   /translation="MSRDIIKLDQIDVTFHQKKRTITAVKDVTIHIQEGDIYGIVGYSG
FT                   AGKSTLVRVINLLQKPSAGKITIDDDVIFDGKVTLTAEQLRRKRQDIGMIFQHFNLMSQ
FT                   KTAEENVAFALKHSELSKEEKKAKVAKLLDLVGLADRAENYPSQLSGGQKQRVAIARAL
FT                   ANDPKILISDESTSALDPKTTKQILALLQDLNQKLGLTVVLITHEMQIVKDIANRVAVM
FT                   QDGHLIEEGSVLEIFSNPKQPLTQDFISTATGIDEAMVKIEKQEIVEHLSENSLLVQLK
FT                   YAGASTDEPLLNELYKHYQVMANILYGNIEILDGTPVGELVVVLSGEKAALAGAQEAIR
FT                   QAGVQLKVLKGVQ"
FT   gene            149880..150572
FT                   /locus_tag="SP_0152"
FT   CDS             149880..150572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0152"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by similarity to GP:6165406; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74334"
FT                   /protein_id="AAK74334.1"
FT                   /translation="MESLIQTYLPNVYKMGWAGQAGWGTAIYLTLYMTVLSFIIGGFLG
FT                   LVAGLFLVLTAPGGVLENKVVFWILDKITSIFRAVPFIILLAILSPLSHLIVKTSIGPN
FT                   AALVPLSFAVFAFFARQVQVVLAELDGGVIEAAQASGATFWDIVGVYLSEGLPDLIRVT
FT                   TVTLISLVGETAMAGAVGAGGIGNVAIAYGFNRYNHDVTILATIIIILIIFAIQFLGDF
FT                   LTKKLSHK"
FT   gene            complement(150602..151171)
FT                   /locus_tag="SP_0153"
FT   CDS             complement(150602..151171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0153"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM TIGR02185"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74335"
FT                   /protein_id="AAK74335.1"
FT                   /translation="MKKSILTTLLFAVLYFLCMGIGVLLGNLFDQTGNMFYAPAFTALV
FT                   GGSVYMILVAKVPRFGAITTIGLVIALFFLGTKHGAGSFLPGIICGLLADGVAHLGKYK
FT                   DKTKNFLSFIIFAFSTTGPILLMWIAPKAYMATLLARGKSQEYIDRIMVAPNPGTVLLF
FT                   IASIVIGALVGALIGQALSKKFAQKI"
FT   gene            151306..151920
FT                   /locus_tag="SP_0154"
FT   CDS             151306..151920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0154"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74336"
FT                   /protein_id="AAK74336.1"
FT                   /translation="MGRFLDFVFNRFFLGMIATAFFWLLTLAGGIILGLAPASATLMSL
FT                   YAEHGYSFREYSLKEAWSLYKQNFVSSNLIFYSFLGVGLVLTYGLYLLVQLPHQTIVHL
FT                   IATLLNVLVVALIFLAYTVSLKLQVYFALSYRNSLKLSLIGIFMSLAAVAKVLLGTVLL
FT                   VAIGYYMPALLFFVGIGMWHFFISDMLEPVYEIIHEKLATK"
FT   gene            151922..153568
FT                   /locus_tag="SP_0155"
FT   CDS             151922..153568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0155"
FT                   /product="putative sensor histidine kinase"
FT                   /note="identified by similarity to GP:5830535; match to
FT                   protein family HMM PF00672; match to protein family HMM
FT                   PF02518; match to protein family HMM PF06580"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74337"
FT                   /protein_id="AAK74337.1"
FT                   /translation="MKQFWLHTLLRTYSSVMIIIIASFAILLSYADWDSREKEAQRVAQ
FT                   RVTARTVSEIEYYHRESTQIAQALVENQARIEGIYKYFSLSMPDYFYWQLERKASPYIS
FT                   VSLYENVDDLYVRNDFVTGVAIAFQDYKEVYVSTKDKRSGEKIRAEDFKPAGNSFAIPV
FT                   SDPVSDQDLGVIYISLDPAVLYHAIDNTRGHTPMAVTVTSPFDTEIFHMGETVDKESEN
FT                   WLVGLTSHGYQVQVAVPKNFVLQGTVTSSALIVGLSLLFIVILYLTLRQTFANYQKQVV
FT                   DLVESIQVIAQGEEGRRIDISEKDQELLLIAETTNDMLDRLEKNIHDIYQLELSQKDAN
FT                   MRALQAQINPHFMYNTLEFLRMYAVMQSQDELADIIYEFSSLLRNNISDERETLLKQEL
FT                   EFCRKYSYLCMVRYPKSIAYGFKIDPELENMKIPKFTLQPLVENYFAHGVDHRRTDNVI
FT                   SIKALKQDGFVEILVVDNGRGMSAEKLANIREKLSQRYFEHQASYSDQRQSIGIVNVHE
FT                   RFVLYFGDRYAITIESAEQAGVQYRITIQDE"
FT   gene            153580..154866
FT                   /locus_tag="SP_0156"
FT   CDS             153580..154866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0156"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74338"
FT                   /protein_id="AAK74338.1"
FT                   /translation="MYKVLLVDDEYMVTEGLKRLIPFDKWDMEVVATASHADEALEYVQ
FT                   ENPVDVIISDVNMPDKTGLDMIREMKEILPDAAYILLSGYQEFDYVKRAMNLSVVDYLV
FT                   KPVDKVELGNLLEKIAGQLGERGKKSQTLSQELDEAGFVSYLGDKENWWIGLSKEKQGS
FT                   FTIPYYVLGQDWQIFISGHPLDGLVVTPFEAPYQEHFERWKLNAEKTLFYGSVNLQQSE
FT                   SLFAYYEPIYRVIIQGNLNQIVEELNLLEKVVLENTPRVSITKQLFIQFVMDVFHLFEH
FT                   LKADDMTDIVKTIHAIQSFDELVSYIKETLISFFGQYRMNENVVSVLEVIGRDYQKELS
FT                   LKDISKALFINPVYLGQLIKRETDSTFAELLNKQRIKAAQQLLLSTSDSIEDICYAVGY
FT                   SNLGYFYKVFRKLCGKSPKAYRKQVETIL"
FT   gene            154870..155451
FT                   /locus_tag="SP_0157"
FT   CDS             154870..155451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0157"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74339"
FT                   /protein_id="AAK74339.1"
FT                   /translation="MYSFTKGAIILSGGPIMKKKPIYLWVLLILSALISVPSLFGIVSP
FT                   LPSKEALRAAQKQVAGVNAQQLEDQLNYTYRVAEASHSIFNVALIVLSTILVVVAIVFL
FT                   VRKNLQYANYTYVGYVLLAIIGSIYGYVGLQDAVQLVQDESMRLTVSIGSKAVSIFYIV
FT                   INVLFLALVFYKMWRQQKALAEEEETEELT"
FT   gene            155529..155999
FT                   /locus_tag="SP_0158"
FT   CDS             155529..155999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0158"
FT                   /product="NrdI family protein"
FT                   /note="identified by similarity to EGAD:35947; match to
FT                   protein family HMM PF07972"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74340"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97T03"
FT                   /protein_id="AAK74340.1"
FT                   /translation="MKTISLVYISLSGNTESFVTRLKDYLLSQYKGIEVQKIHIKDLVK
FT                   EGKNFYEMDHPYVAFLPTYLEGGNGVDNGDVEILTTPVGDFIAYGNNASKCFGVVGSGN
FT                   RNFNNQYCLTAKQYSQRFGFPVLADFEMRGMLEDIKHVAAIIADLYELEKEN"
FT   gene            complement(156292..157554)
FT                   /locus_tag="SP_0159"
FT   CDS             complement(156292..157554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:176641"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74341"
FT                   /protein_id="AAK74341.1"
FT                   /translation="MSQAISLNQSTWASKLKAMGPGILMATAAVGGSHIVSSTQAGGSY
FT                   GWSLLLLVILANVFKYPFFRFGAEYTADTGKTLVEGYAEKGKLYLWIFFILNVFSAMVN
FT                   TAGVAILCSAIIASAFPMIGLSITQWSLILVAIIWAMLLFGGYKLLDGMVKWIMSALTI
FT                   ATVLAVIIAAVKHPEYSSDFVEKTPWQMAALPFIVSLLGWMPAPIEISAINSLWSAEKR
FT                   KTVNFNTEDALFDFNTGYIGTAILAVFFVALGALIQYPTGQAVEAASAKYISQFVGMYA
FT                   SVLGEWSRYLITFIAFLCIFGTVITVIDGYSRVNQESLRLLISQKEDNRKSLNIWMTIT
FT                   AIIGIVIIKFFAGQVSTMLRFAMIGSFLTTPFFALLNYALVTRENKNLPSWLKHLAIAG
FT                   LIFLFGFAIFFIYALAIGKAG"
FT   gene            complement(157864..158322)
FT                   /locus_tag="SP_0160"
FT   CDS             complement(157864..158322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0160"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:6690328"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74342"
FT                   /protein_id="AAK74342.1"
FT                   /translation="MKKQVFHDAATGVLIGLILSILFSLIYAPNTYAPLNPYSLIGQVM
FT                   DQHQVHGALVLLYCTLIWATIGMLFNFGNRLFSRDWSMLRATLTHFFLMLAGFVPLATL
FT                   AGWFPFHWIFYLQLIIEFAIVYLIIWAILYKREAKKVDHINQLLEHRK"
FT   gene            complement(158319..158759)
FT                   /locus_tag="SP_0161"
FT   CDS             complement(158319..158759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0161"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74343"
FT                   /protein_id="AAK74343.1"
FT                   /translation="MKVELQISETYEEEKLIVQAPQETEKVQKVIEFAENLDQREKIKG
FT                   KIDDQVYLVEIGKIQRFYIENRKVLAETASQTYSIDLRLYQVLKLLPTNFIQISQSEII
FT                   NIDSISHLKLTPNGLVEIFLKNESFTYSSRRYLKTIKEKLEL"
FT   gene            158849..158944
FT                   /locus_tag="SP_0162"
FT   CDS             158849..158944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0162"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74344"
FT                   /protein_id="AAK74344.1"
FT                   /translation="MSMWRDWAPMWWSFSVLSEIWYNSTNQFLGK"
FT   gene            159192..160058
FT                   /locus_tag="SP_0163"
FT   CDS             159192..160058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0163"
FT                   /product="putative transcriptional regulator PlcR"
FT                   /note="identified by similarity to EGAD:37797; match to
FT                   protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74345"
FT                   /protein_id="AAK74345.1"
FT                   /translation="MGTLLATRLKNRRKELKMSQRELAEGICKQGQISRLESGEFTPGA
FT                   DFLNALAKKLKVSMDYFFDEQVVEKVEELSEFKKLAQTFITNRNYESLKYIYELENVKA
FT                   HRLSLADKIYMEWIKSLIDFYFYGQKEDAIVRLEGVLSQLSVSDLNYLQVSNTLFNFYY
FT                   DIGDLGRFNKIREKLEYQVNHLNLSTIEELELSIKFNYNVCRYLWLQKNIEEAITKITA
FT                   TIKQCKAYRTNYLLADLYLLMGNVSENFSSKSSVKEYFETAYFLYKLEENMSMTLKVEH
FT                   YIADITE"
FT   gene            160211..160339
FT                   /locus_tag="SP_0164"
FT   CDS             160211..160339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0164"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74346"
FT                   /protein_id="AAK74346.1"
FT                   /translation="MRSLFKKIVAVLVIGLILLGIARTPQVHKMARGIDPGPANFI"
FT   gene            160384..160941
FT                   /locus_tag="SP_0165"
FT   CDS             160384..160941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0165"
FT                   /product="flavoprotein"
FT                   /note="identified by similarity to EGAD:10889; match to
FT                   protein family HMM PF02441"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74347"
FT                   /protein_id="AAK74347.1"
FT                   /translation="MDKKNLLVLVTGSVGASNVDTYLYYIKKFYNVKVILSENSKKFIS
FT                   KELISYFCDKVYDEIFVEEVVPHVFLPYESDLLLILPATANVIGKIANGIADDLVTATV
FT                   LNFNKKIIFCPNMNSTMWDNHIVQRNVSILKELGHIFLFESKKTYEVGLRKAIDSTCSM
FT                   LQPQSLVKELIKLENIVLEEGH"
FT   gene            161162..162268
FT                   /locus_tag="SP_0166"
FT   CDS             161162..162268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0166"
FT                   /product="pyridoxal-dependent decarboxylase, Orn/Lys/Arg
FT                   family"
FT                   /note="identified by match to protein family HMM PF02784"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74348"
FT                   /protein_id="AAK74348.1"
FT                   /translation="MINKKIQQVVLESLQNFLNGNFISPCVVYDFGLLETVLDEFKNQI
FT                   PVTFNYQLFYAVKANSNEKILEFLVDKIDGVDVASLSELDVAKKFFPPTQISVNGPAFS
FT                   YETLYNLIKKQYKVDINFLEHLQQFSPKESVGIRVTEPDELNNRMSRFGINICSDNWTS
FT                   NLQNPLITRLHFHFGEKDDKFIVKLDKILFKLQEINKLREVREINLGGGFMKLFMENRL
FT                   KEFFLSLMEIYKKYDIDSTVTTIIEPGSAITSFSAYMITSPVNVSEVNEQQVITLDTSI
FT                   YTNTLWFVPHIITTLNSSSKERYSTILYGNTCYEHDKYKMKVSLPRLTQNSSIVFFPVG
FT                   AYIKSNHSNLHRNDFMREVYLWTKNLTY"
FT   gene            162244..163635
FT                   /locus_tag="SP_0167"
FT   CDS             162244..163635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0167"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74349"
FT                   /protein_id="AAK74349.1"
FT                   /translation="MDKKLDILDKVKEYLGNKTTQILDNQYKEFLKLNDIRRAFGISEK
FT                   VLNNSFNFTSKEFNDLINNENYLFEYACRIREEWRKKCFNHSYRFLCSPIITDDFLNTK
FT                   TLRSSQIEYKYERYLSKSSIGDRAVDGFVSFNTLTANGMSAIKLCLEILNSIFFKKKID
FT                   LLYSTGYYETRFLLNNLAKSGISCYEVSNCELDKDKFYNVFMMEPNRADLTLQKTDFKI
FT                   VEYFVKYKNNSIKVVILDISYQGSNFKLVEFLEKFKFANVIIFVVRSLIKLDQMGLELT
FT                   NGGIIEVFIPNHLRKLKNFIEEEFNKFRNSHGANLSLYEYCLLDNSLTLKNDWNYSDLV
FT                   MKFTSNFYADIKDLFMENSDIEIIHEEGVPFVFLDLIGEGKKEYEMFFQWLNFFYKQLG
FT                   ITLYARNSFGFRNLTVEYFGIIGTERYIFKICPGVYKGLSYYLMKFLLKSFSNEYLKTT
FT                   DEVNR"
FT   gene            163632..164810
FT                   /locus_tag="SP_0168"
FT   CDS             163632..164810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0168"
FT                   /product="putative macrolide efflux protein"
FT                   /note="identified by similarity to GP:1800301; match to
FT                   protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74350"
FT                   /protein_id="AAK74350.1"
FT                   /translation="MKNLIKLLIIRLIVNLADSVFYIVALWHVSNNYSSSMFLGIFIAV
FT                   NYLPDLLLIFFGPVIDRVNPQKILIISILVQLAVAVIFLLLLNQISFWVIMSLVFISVM
FT                   ASSISYVIEDVLIPQVVEYDKIVFANSLFSISYKVLDSIFNSFASFLQVAVGFILLVKI
FT                   DIGIFLLALFILLLLKFRTSNANIENFSFKYYKREVLQGTKFILNNKLLFKTSISLTLI
FT                   NFFYSFQTVVVPIFSIRYFDGPIFYGIFLTIAGLGGILGNMLAPIVIKYLKSNQIVGVF
FT                   LFLNGSSWLVAIVIKDYTLSLILFFVCFMSKGVFNIIFNSLYQQIPPHQLLGRVNTTID
FT                   SIISFGMPIGSLVAGTLIDLNIELVLIAISIPYFLFSYIFYTDNGLKEFSIY"
FT   gene            164991..165128
FT                   /pseudo
FT                   /locus_tag="SP_0169"
FT                   /note="lactose phosphotransferase system repressor,
FT                   degenerate; this region contains one or more premature
FT                   stops and/or frameshifts which are not the result of
FT                   sequencing error; identified by similarity to EGAD:16295"
FT   gene            165095..165211
FT                   /locus_tag="SP_0170"
FT   CDS             165095..165211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0170"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74351"
FT                   /protein_id="AAK74351.1"
FT                   /translation="MGRRFCFICSLKKVTAVITDDSTEQNYEELEIYTQVIV"
FT   gene            165235..165468
FT                   /locus_tag="SP_0171"
FT   CDS             165235..165468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0171"
FT                   /product="ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74352"
FT                   /protein_id="AAK74352.1"
FT                   /translation="MISIDLGGTNIKITVLSNDGEIETLWSITTDTSEKGSQIISDIIS
FT                   SIKNKLTERNIPDSDLLGIGMGSCSSYFPCKS"
FT   gene            165586..165690
FT                   /locus_tag="SP_0172"
FT   CDS             165586..165690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0172"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74353"
FT                   /protein_id="AAK74353.1"
FT                   /translation="MIFIEYTTILLPLARDFVYVEGLGSYVVELFCSF"
FT   gene            165751..167700
FT                   /gene="hexB"
FT                   /locus_tag="SP_0173"
FT   CDS             165751..167700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hexB"
FT                   /locus_tag="SP_0173"
FT                   /product="DNA mismatch repair protein HexB"
FT                   /note="In low GC gram positive bacteria, this gene is
FT                   generally known as hexB; in other prokaryotes the
FT                   functional equivalent is known as mutL.; identified by
FT                   similarity to EGAD:20800; match to protein family HMM
FT                   PF01119; match to protein family HMM PF02518; match to
FT                   protein family HMM TIGR00585"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74354"
FT                   /db_xref="GOA:P0A3R1"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011186"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A3R1"
FT                   /protein_id="AAK74354.1"
FT                   /translation="MSHIIELPEMLANQIAAGEVIERPASVVKELVENAIDAGSSQIII
FT                   EIEEAGLKKVQITDNGHGIAHDEVELALRRHATSKIKNQADLFRIRTLGFRGEALPSIA
FT                   SVSVLTLLTAVDGASHGTKLVARGGEVEEVIPATSPVGTKVCVEDLFFNTPARLKYMKS
FT                   QQAELSHIIDIVNRLGLAHPEISFSLISDGKEMTRTAGTGQLRQAIAGIYGLVSAKKMI
FT                   EIENSDLDFEISGFVSLPELTRANRNYISLFINGRYIKNFLLNRAILDGFGSKLMVGRF
FT                   PLAVIHIHIDPYLADVNVHPTKQEVRISKEKELMTLVSEAIANSLKEQTLIPDALENLA
FT                   KSTVRNREKVEQTILPLKENTLYYEKTEPSRPSQTEVADYQVELTDEGQDLTLFAKETL
FT                   DRLTKPAKLHFAERKPANYDQLDHPELDLASIDKAYDKLEREEASSFPELEFFGQMHGT
FT                   YLFAQGRDGLYIIDQHAAQERVKYEEYRESIGNVDQSQQQLLVPYIFEFPADDALRLKE
FT                   RMPLLEEVGVFLAEYGENQFILREHPIWMAEEEIESGIYEMCDMLLLTKEVSIKKYRAE
FT                   LAIMMSCKRSIKANHRIDDHSARQLLYQLSQCDNPYNCPHGRPVLVHFTKSDMEKMFRR
FT                   IQENHTSLRELGKY"
FT   gene            complement(167836..167928)
FT                   /locus_tag="SP_0174"
FT   CDS             complement(167836..167928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0174"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74355"
FT                   /protein_id="AAK74355.1"
FT                   /translation="MVKHNFDVTDKTGKISSKHCFEITDKTDVV"
FT   gene            complement(168025..168492)
FT                   /locus_tag="SP_0175"
FT   CDS             complement(168025..168492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0175"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /note="identified by similarity to EGAD:18389; match to
FT                   protein family HMM PF00885; match to protein family HMM
FT                   TIGR00114"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74356"
FT                   /db_xref="GOA:P66040"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66040"
FT                   /protein_id="AAK74356.1"
FT                   /translation="MNTYEGNLVANNIKIGIVVARFNEFITSKLLSGALDNLKRENVNE
FT                   KDIEVAWVPGAFEIPLIASKMAKSKKYDAIICLGAVIRGNTSHYDYVCSEVSKGIAQIS
FT                   LNSEIPVMFGVLTTDTIEQAIERAGTKAGNKGSECAQGAIEMVNLIRTLDA"
FT   gene            complement(168493..169698)
FT                   /gene="ribAB"
FT                   /locus_tag="SP_0176"
FT   CDS             complement(168493..169698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribAB"
FT                   /locus_tag="SP_0176"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP
FT                   cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="identified by match to protein family HMM PF00925;
FT                   match to protein family HMM PF00926; match to protein
FT                   family HMM TIGR00505; match to protein family HMM
FT                   TIGR00506"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74357"
FT                   /protein_id="AAK74357.1"
FT                   /translation="MEYRKIQEALEALQKGRLVLVIDDKDRENEGDLICSAQAATTENV
FT                   NFMATYAKGLICMPMSESLANQLMLSPMVENNTDNHKTAFTVSIDYKETTTGISAEERG
FT                   LTARMCVAEDITPSDFRRPGHMFPLIAKKGGVLERNGHTEATVDLLKLAGLKECGLCCE
FT                   IMNHDGKMMRTDDLIQFSKKHNIPLITIKELQEYRKVYDQLVERVSTVNMPTRYGNFKA
FT                   ISYIDKLNGEHHLALIMGNIEDEANVLCRVHSECLTGDVLGSLRCDCGQQFDKAMKMIV
FT                   ENGSGVLLYLRQEGRGIGLINKLKAYHLQDQGMDTLDANLALGFEGDLREYHIGAKMLK
FT                   DLGLQSLHLLTNNPDKVEQLEKYGITISSRISIEIEANPYDSFYLETKKNRMGHILNME
FT                   EK"
FT   gene            complement(169718..170353)
FT                   /gene="ribE"
FT                   /locus_tag="SP_0177"
FT   CDS             complement(169718..170353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="SP_0177"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="identified by similarity to EGAD:14904; match to
FT                   protein family HMM PF00677; match to protein family HMM
FT                   TIGR00187"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74358"
FT                   /protein_id="AAK74358.1"
FT                   /translation="MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNG
FT                   ICLTVTHFNHQSFTVDVMNETWSRTALTLLKHGSEVNLERALSVNGRLGGHVVTGHIDG
FT                   TGKISSIKKDDNAVWYQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVIPHT
FT                   LEQTILKSKQVGSTVNLENDILGKYVQKLMDNSPKSEISKELLYQNGF"
FT   gene            complement(170338..171438)
FT                   /gene="ribD"
FT                   /locus_tag="SP_0178"
FT   CDS             complement(170338..171438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="SP_0178"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="identified by match to protein family HMM PF00383;
FT                   match to protein family HMM PF01872; match to protein
FT                   family HMM TIGR00227; match to protein family HMM
FT                   TIGR00326"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74359"
FT                   /protein_id="AAK74359.1"
FT                   /translation="MSDSKYMKLAIKLAQKGAGYVNPNPMVGAVIVKDNHIIGQGYHEF
FT                   FGGPHAERNALKNCRESPVGATLYVTLEPCCHFGKTPPCIDAIIDSGITRVVIGSLDCN
FT                   PIVSGKGVKILEENNLQVTVGILENECLNLIKSFRKYITQHVPYVFMKYAMSMDGKIAT
FT                   KTNQSKWITEEEARKHVHQLRHHVSAIMVGVNTVIQDDPLLTCRLEEGKNPIRIICDTH
FT                   LRTPLTSKIVKTANDIKTYIATSSEDKNKMKLYQNHGCEILSIKKKGNHIDLSSLMQHL
FT                   GNMQIDSLVLEGGSLMNWSALEQQIVDELKIYIAPKVFGGSAKFPVGGEGISLPNDAIR
FT                   LKPYAFSQIGNDYLIESEVIYPCSQE"
FT   gene            171843..172436
FT                   /gene="ruvA"
FT                   /locus_tag="SP_0179"
FT   CDS             171843..172436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="SP_0179"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="identified by similarity to EGAD:24056; match to
FT                   protein family HMM PF01330; match to protein family HMM
FT                   PF07499; match to protein family HMM TIGR00084"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74360"
FT                   /db_xref="GOA:Q97SY4"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SY4"
FT                   /protein_id="AAK74360.1"
FT                   /translation="MYAYLKGIITKITAKYIVLETNGIGYILHVANPYAYSGQVNQEAQ
FT                   IYVHQVVREDAHLLYGFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIETK
FT                   NITYLTKFPKIGKKTAQQMVLDLEGKVVVAGDDLPAKVAVQASAENQELEEAMEAMLAL
FT                   GYKATELKKIKKFFEGTTDTAENYIKSALKMLVK"
FT   gene            172473..173009
FT                   /gene="tag"
FT                   /locus_tag="SP_0180"
FT   CDS             172473..173009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="SP_0180"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="identified by similarity to EGAD:6433; match to
FT                   protein family HMM PF03352"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74361"
FT                   /protein_id="AAK74361.1"
FT                   /translation="MTNPLYIAYHDEEWGQPLHDDQVLFELLCMETYQAGLSWETVLNK
FT                   RQAFREVFHSYQIHSVAEMTDTELEAMLENPAIIRNRAKLFATRANAQAFLQLQAEYGS
FT                   FDAYLWSFVEGKTVVNDVPDYRQAPAKTPLSEKLAKDLKKRGFKFTGPVAVLSFLQAAG
FT                   LVDDHENDCEWKGLK"
FT   gene            173006..173683
FT                   /locus_tag="SP_0181"
FT   CDS             173006..173683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:6470197; match to
FT                   protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74362"
FT                   /protein_id="AAK74362.1"
FT                   /translation="MMSNKNKEILIFAILYTVLFMFDGVKLLASLMPSAIANYLVYVVL
FT                   ALYGSFLFKDRLIQQWKEIRKTKRKFFFGVLTGWLFLILMTVVFEFVSEMLKQFVGLDG
FT                   QGLNQSNIQSTFQEQPLLIAVFACVIGPLVEELFFRQVLLHYLQERLSGLLSIILVGLV
FT                   FALTHMHSLALSEWIGAVGYLGGGLAFSIIYVKEKENIYYPLLVHMLSNSLSLIILAIS
FT                   IVK"
FT   gene            complement(173820..174851)
FT                   /locus_tag="SP_0182"
FT   CDS             complement(173820..174851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0182"
FT                   /product="MccC family protein"
FT                   /note="identified by similarity to EGAD:135270; match to
FT                   protein family HMM PF02016"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74363"
FT                   /protein_id="AAK74363.1"
FT                   /translation="MVSTIGIVSLSSGIIGEDFVKHEVDLGIQRLKDLGLNPIFLPHSL
FT                   KGLDFIKDHPEARAEDLIHAFSDDSIDMILCAIGGDDTYRLLPYLFENDQLQKVIKQKI
FT                   FLGFSDTTMNHLMLHKLGIKTFYGQSFLADICELDKEMLAYSLHYFKELIETGRISEIR
FT                   PSDVWYEERTDFSPTALGTPRVSHTNTGFDLLQGSAQFEGKILGGCLESLYDIFDNSRY
FT                   ADSTELCQKYKLFPDLSDWEGKILLLETSEEKPKPEDFKKMLLTLKDTGIFAVINGLLV
FT                   GKPMDETFHDDYKEALLDIIDSNIPIVYNLNVGHATPRAIVPFGVHAHVDAQEQVILFD
FT                   YNK"
FT   gene            complement(175039..175134)
FT                   /locus_tag="SP_0183"
FT   CDS             complement(175039..175134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0183"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74364"
FT                   /protein_id="AAK74364.1"
FT                   /translation="MQDQHAIKNKKTIKATAGAVAFSLTFLSYIQ"
FT   gene            complement(175106..175810)
FT                   /locus_tag="SP_0184"
FT   CDS             complement(175106..175810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74365"
FT                   /protein_id="AAK74365.1"
FT                   /translation="MVLRGVPMSQIDLQKLTKKNQEFVHIATQQFIKDGKTDAEIQTIF
FT                   EEVIPQILEEQSKGTTARSLYGAPTHWAHSFTVKEQYEKEHPKENDDPKLMIMDSALFI
FT                   TSLFALVSALTTFFAADQAFGYGLITLLLVGLVGGFAFYLMYYFVYQYYGPDMDRSQRP
FT                   PFWKSVLVILASMFLWLLVFFATSFLPASLNPVLDPLPLAIIGAALLALRFYLKKRLNI
FT                   RSASAGPTRYQE"
FT   gene            complement(175801..176745)
FT                   /locus_tag="SP_0185"
FT   CDS             complement(175801..176745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0185"
FT                   /product="magnesium transporter, CorA family"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74366"
FT                   /protein_id="AAK74366.1"
FT                   /translation="MKQVFLSTTTEFKEIDTLEPGTWINLVNPTQNESLEIANTFDIDI
FT                   ADLRAPLDAEEMSRITIEDEYTLIIVDVPVTEERNNRTYYVTIPLGIIITEETIITTCL
FT                   EPLPVLDVFINRRLRNFYTFMRSRFIFQILYRNAELYLTALRSIDRKSEQIESQLHQST
FT                   RNEELIELMELEKTIVYFKASLKTNERVIKKLTSSTSNIKKYLEDEDLLEDTLIETQQA
FT                   IEMADIYGNVLHSMTETFASIISNNQNNIMKTLALVTIVMSIPTMVFSAYGMNFKDNEI
FT                   PLNGEPNAFWLIVFIAFAMSVSLTLYLIHKKWF"
FT   gene            176877..179708
FT                   /gene="uvrA"
FT                   /locus_tag="SP_0186"
FT   CDS             176877..179708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="SP_0186"
FT                   /product="excinuclease ABC, subunit A"
FT                   /note="identified by similarity to EGAD:6128; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74367"
FT                   /db_xref="GOA:P63384"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63384"
FT                   /protein_id="AAK74367.1"
FT                   /translation="MQDKIVIHGARAHNLKNIDVEIPRDKLVVVTGLSGSGKSSLAFDT
FT                   LYAEGQRRYVESLSAYARQFLGNMEKPDVDAIDGLSPAISIDQKTTSKNPRSTVGTTTE
FT                   INDYLRLLYARVGTPYCINGHGAINASSVEQIVDKVLELPERQRLQILAPVIRKKKGQH
FT                   KSVIEKVQKDGYVRVRVDGEVYDVTEVPELSKSKQHNIDVVVDRIVIKEGIRSRLFDSI
FT                   EAALRIAEGYVIIDTMDDSELLFSEHYACPVCGFTVPELEPRLFSFNAPFGSCSECDGL
FT                   GIKLEVDTDLVVPDASKTLREGALAPWNPISSNYYPNMLEQAMKVFGVAMDKPFEDLSE
FT                   EDKNLILYGSDGKEFHFHYENEFGGVRDIDIPFEGVINNIKRRYHETNSDYTRTQMRLY
FT                   MNELTCGTCQGYRLNDQALSVRVGGQQGPHIGEISDLSIADHLDLVSQLTLSENEAIIA
FT                   RPILKEIKDRLTFLNNVGLNYLTLSRSAGTLSGGESQRIRLATQIGSNLSGVLYILDEP
FT                   SIGLHQRDNDRLIASLKKMRDLGNTLIVVEHDEDTMREADYLIDVGPGAGVFGGEIVAA
FT                   GTPKQVARNSKSITGQYLSGKRVIPVPEERRVGNGRFIEVIGARENNLQNVTARFPLGK
FT                   FIAVTGVSGSGKSTLINSILKKAIAQKLNRNSDKPGKFKTITGIEHVDRLIDIDQSPIG
FT                   RTPRSNPATYTGVFDDIRDLFAQTNEAKIRGYKKGRFSFNVKGGRCEACSGDGIIKIEM
FT                   HFLPDVYVACEVCHGTRYNSETLEVHYKEKNISQVLDMTVNDAVEFFQHIPKIQRKLQT
FT                   IKDVGLGYVTLGQPATTLSGGEAQRMKLASELHKRSTGKSFYILDEPTTGLHTEDIARL
FT                   LKVLARFVDDGNTVLVIEHNLDVIKTADHIIDLGPEGGVGGGTIIVTGTPEEVAANEAS
FT                   YTGHYLKGKLHHE"
FT   gene            179701..180762
FT                   /locus_tag="SP_0187"
FT   CDS             179701..180762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0187"
FT                   /product="peptidase M24 family protein"
FT                   /note="identified by match to protein family HMM PF00557"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74368"
FT                   /protein_id="AAK74368.1"
FT                   /translation="MNKRVQAFLAKMQEKELDGIIINNLKNVYYLTGFWGSNGTVFISR
FT                   DRQVLVTDSRYIIAAKQETSGFEIVADRDELAVIAGIVKDMGLTRIGFEDEISVSYYHR
FT                   MQAAFAGLNLLPQTQFVEGLRMIKDEAEIAAIRKACSISDQAFRDALDFIKPGKTEIEI
FT                   ANFLDFRMRELGASGLSFDTILASGINSSKPHAHPMHKPVELGEAITMDFGCLYDHYVS
FT                   DMTRTIYLGHVSDEQAEIYNTVLKANQALIDQAKAGLGFRDFDKIPRDIIIEAGYGDYF
FT                   THGIGHGIGLDIHEEPYFSQTSTETIKTGMALTDEPGIYIEGKYGVRIEDDILITETGC
FT                   ELLTLAPKELIVI"
FT   gene            180767..180859
FT                   /locus_tag="SP_0188"
FT   CDS             180767..180859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0188"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74369"
FT                   /protein_id="AAK74369.1"
FT                   /translation="MSRKKYENDEKSQKKLKIGRKSDVFYGIID"
FT   gene            180894..181292
FT                   /locus_tag="SP_0189"
FT   CDS             180894..181292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:6650536; match to
FT                   protein family HMM PF03960; match to protein family HMM
FT                   TIGR01617"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74370"
FT                   /protein_id="AAK74370.1"
FT                   /translation="MIKIYTVSSCTSCKKAKTWLNAHQLSYKEQNLGKEGITREELLDI
FT                   LTKTDNGIASIVSSKNRYAKALGVDIEDLSVNEVLNLIMETPRILKSPILVDEKRLQVG
FT                   YKEDDIRAFLPRSVRNVENAEARLRAAL"
FT   gene            181261..181380
FT                   /locus_tag="SP_0190"
FT   CDS             181261..181380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0190"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74371"
FT                   /protein_id="AAK74371.1"
FT                   /translation="MQKHVCVQLYKHQGWEHFPVLFYFNFKKKEERNEKNSSC"
FT   gene            181358..181927
FT                   /locus_tag="SP_0191"
FT   CDS             181358..181927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0191"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74372"
FT                   /protein_id="AAK74372.1"
FT                   /translation="MKKIVLVSLAFLFVLVGCGQKKETGPATKTEKDTLQSALPVIENA
FT                   EKNTVVTKTLVLPKSDDGSQQTQTITYKDKTFLSLAIQQKRPVSDELKTYIDQHGVEET
FT                   QKALLEAEEKDKSIIEARKLAGFKLETKLLSATELQTTTSFDFQVLDVKKASQLEHLKN
FT                   IGLENLLKNEPSKYISDRLANGATEQ"
FT   gene            182014..182280
FT                   /locus_tag="SP_0192"
FT   CDS             182014..182280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NT01BS3187; match
FT                   to protein family HMM PF06135"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74373"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SX1"
FT                   /protein_id="AAK74373.1"
FT                   /translation="MGFTEETVRFKLDDSNKKEISETLTDVYASLNDKGYNPINQIVGY
FT                   VLSGDPAYVPRYNNARNQIRKYERDEIVEELVRYYLKGQGVDL"
FT   gene            182284..182703
FT                   /pseudo
FT                   /locus_tag="SP_0193"
FT                   /note="putative Holliday junction resolvase; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to EGAD:110019;
FT                   match to protein family HMM PF03652; match to protein
FT                   family HMM TIGR00250"
FT   gene            182719..183024
FT                   /locus_tag="SP_0194"
FT   CDS             182719..183024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:110017; match to
FT                   protein family HMM PF06949"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74374"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SX0"
FT                   /protein_id="AAK74374.1"
FT                   /translation="MSHDHNHDHEERELITLVDEQGNETLFEILLTIDGKEEFGKNYVL
FT                   LVPVNAEEDEDGQVEIQAYSFIENEDGTEGELQPIPEDSEDEWNMIEEVFNSFMEE"
FT   gene            182990..183088
FT                   /locus_tag="SP_0195"
FT   CDS             182990..183088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0195"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74375"
FT                   /protein_id="AAK74375.1"
FT                   /translation="MKKSSTALWRSDTVWETVSAQLPEMGKSWNVQ"
FT   gene            183073..183168
FT                   /locus_tag="SP_0196"
FT   CDS             183073..183168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0196"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74376"
FT                   /protein_id="AAK74376.1"
FT                   /translation="MERPVNIFTPTPRNGEELERPVDVFSPYSHS"
FT   gene            183283..184533
FT                   /locus_tag="SP_0197"
FT   CDS             183283..184533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0197"
FT                   /product="putative dihydrofolate synthetase"
FT                   /note="identified by similarity to EGAD:42028; match to
FT                   protein family HMM PF01225; match to protein family HMM
FT                   PF02875; match to protein family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74377"
FT                   /protein_id="AAK74377.1"
FT                   /translation="MFEVEEWLHSRIGLNFRSGLGRMQQAVDLLGNPEQSYPIIHVTGT
FT                   NGKGSTIAFMRELFMGHGKKVATFTSPHIVSINDRICINGQPIADADFIRLTDQVKEME
FT                   KTLLQTPAQLSFFELLTLVAFLYFREQEVDLVLLEVGIGGLLDTTNVVTGEFAVITSIG
FT                   LDHQETLGDSLEAIAEQKAGIFKAGKKAVIAKLPPEARLACQKKAESLAVNLYQAGQDF
FT                   LMLNGDFSSSLLNLSQLNIGLEGVYQQENAALALQTFLLFMRERKEAVDEQAVRKALEQ
FT                   THWAGRLERIRPQIYLDGAHNLPALTRLAEFIKEKEQEGYRPQILFGSLKRKDYQGMLG
FT                   YLTEKLPQVELKVTGFDYQGALDERDVTGYDIVSSYREFISDFEERADAQDLLFVTGSL
FT                   YFISEVRGYLLDREQIN"
FT   gene            184617..185075
FT                   /locus_tag="SP_0198"
FT   CDS             184617..185075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0198"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74378"
FT                   /protein_id="AAK74378.1"
FT                   /translation="MKLKRFTLSLASLASFSLLVACSQRAQQVQQPVAQQQVQQPAQQN
FT                   TNTANAGGNQNQAAPVQNQPVAQPTDIDGTYTGQDDGDRITLVVTGTTGTWTELESDGD
FT                   QKVKQVTLDSANQRMIIGDDVKIYTVNGNQIVVDDMDRDPSDQIVLTK"
FT   gene            185329..186753
FT                   /gene="cls"
FT                   /locus_tag="SP_0199"
FT   CDS             185329..186753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="SP_0199"
FT                   /product="cardiolipin synthetase"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by similarity to SP:O66043; match to
FT                   protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74379"
FT                   /protein_id="AAK74379.1"
FT                   /translation="MAPILWITVLILLSIITIISIVNRNTTPENKVTWLLVAFVPVFGP
FT                   LLYLMFGERRLSKKEIKQLKKLGSMHFQEANSQLLKEKLKESDKAAYGVIKSLLSMDTN
FT                   ADIYDQTASTFFPNGEAMWKKMVEDLKKAEKFIFLEYYIIEEGLMWNRILDILEQKVAQ
FT                   GVEVKMLYDDIGCMATLTGDYAHRLRQLGIEAHKFNKVIPRLTVAYNNRDHRKILIVDG
FT                   QIAYTGGVNLADEYINHVERFGYWKDSGIRLDGLAVKALTRLFLTTWYINRGEISDFDQ
FT                   YHLENHSIPSDGLTIPYGSGPKPIFRAQVGKKVYQSLINQATESVYITTPYLIIDYDLT
FT                   ETIKNAAMRGVDVRIITPYIPDKKFIQLVTRGAYPDLLSAGVRIYEYSPGFIHSKQMLV
FT                   DEDFAVVGTINLDYRSLVHHYENAVLLYKTPSIREIARDFRNIFADSQEVYPHSIKTSW
FT                   YQKLVKEIAQLFAPIL"
FT   gene            187011..188306
FT                   /gene="ccs4"
FT                   /locus_tag="SP_0200"
FT   CDS             187011..188306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccs4"
FT                   /locus_tag="SP_0200"
FT                   /product="competence-induced protein Ccs4"
FT                   /note="identified by similarity to EGAD:158150"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74380"
FT                   /protein_id="AAK74380.1"
FT                   /translation="MSVYGRVEEVHKENREPLEYQIEQESHHRESSRLPLVKILLWSTL
FT                   VTGITLGVPLLLDLMSAQEVQDFYAGWALHQTGKIYSDYYGSQGLLYYLLTYVSQGGFF
FT                   FAIFEWLALVAGGFFLFRSADTLTEQGDQAGHLVTIFYMLVTGLAFGGGYATLLALPFL
FT                   FAAFSLVAAYLSNPSHDKGFVRIGLALAGGFFFAPLSSLLFIAVVSLGLLVFNLGHRRF
FT                   AHGFYQFLAVALGFSLVFYPTAYYSAATGSFGDAISGIRYPIDSIRFDFTSKILENMFF
FT                   YGLLSLGLGFVVCIFLGLFQSKPFKLYVISVPASLVVILGLILLFFSQEPLHASYLMVV
FT                   FPVFLLLLVTNIKSQQRGRSARRSRRETPVSLWSRFFKGNLYLLVFGFVYLLSVPFLMK
FT                   FVLYPVPYQERNRLADLVKEETNTEDAISCMG"
FT   gene            188284..188550
FT                   /locus_tag="SP_0201"
FT   CDS             188284..188550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0201"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74381"
FT                   /protein_id="AAK74381.1"
FT                   /translation="MLSHAWDDTATLYRKSERLSPSAILSPLHYTATEENRNKLLNDLK
FT                   EKQPKVIVVNDKVVVWSEVETLLKENYQQVKTDYSEFKVYKIK"
FT   gene            188670..190877
FT                   /gene="nrdD"
FT                   /locus_tag="SP_0202"
FT   CDS             188670..190877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="SP_0202"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="identified by similarity to GP:4098081; match to
FT                   protein family HMM PF01228; match to protein family HMM
FT                   PF03477; match to protein family HMM TIGR02487"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74382"
FT                   /protein_id="AAK74382.1"
FT                   /translation="MIALEEKITILPTLFVEKRDGRRVVFDVDKIDKALHKAADKVMDV
FT                   TPLVEKCLNDLTERIITEIHSRFPQGIKIYEIQNIVEHELLEAKEYALAEEYITYRTQR
FT                   DFERSKATDINFSIHKLLNKDQTVVNENANKDSDVFNTQRDLTAGIVGKSIGLQMLPKH
FT                   VANAHQKGDIHYHDLDYSPYTPMTNCCLIDFKGMLENGFKIGNAEVESPKSIQTATAQI
FT                   SQIIANVASSQYGGCSADRIDEILAPYAEKNYQKHLKDAEEWVLPEKQEDYAWKKAQKD
FT                   IYDAMQSLEYEINTLFTSNGQTPFTSLGFGLGTSRFEREIQKAILNIRIKGLGSEHRTA
FT                   IFPKLIFTLKRGLNLEEGTPNYDIKQLALECATKRMYPDVLSYDKIVDLTGSFKVPMGC
FT                   RSFLQGWKDENGVEVNSGRMNLGVVTVNLPRIALESEGDMNKFWEIFNERMNIAEDALV
FT                   YRVERTKEATPANAPILYQYGAFGHRLGKEESVDQLFKNRRATVSLGYIGLYEVATVFF
FT                   GNSWESNPDAKEFTLDIIHDMKRRVEEWSDQYGYHFSIYSTPSESLTDRFCRLDIDKFG
FT                   SIPDITDKEYYTNSFHYDVRKNPTPFEKLDFEKVYPEAGASGGFIHYCEYPVLQQNPKA
FT                   LEAVWDYAYDRVGYLGTNTPIDRCYKCDFEGDFEPTERGFACPNCGNSDPKTVDVVKRT
FT                   CGYLGNPQARPMVNGRHKEIAARVKHMNGSTIKIAGHQVTN"
FT   gene            190889..191029
FT                   /locus_tag="SP_0203"
FT   CDS             190889..191029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0203"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74383"
FT                   /protein_id="AAK74383.1"
FT                   /translation="MGKYQLDDKGRAQVTRYHEKHSKGGAGKKERLLSFREQFLNKNKK
FT                   K"
FT   gene            191073..191579
FT                   /locus_tag="SP_0204"
FT   CDS             191073..191579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0204"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74384"
FT                   /protein_id="AAK74384.1"
FT                   /translation="MELRRPRLADKKAVLDMMTEFEKFQSPHDGGFWDTENFVYEDWLE
FT                   SNQEQEMGINLPEGWVSAIQLVAFSEKGQAVGFLNLRLRLSNFLLEEGGHIGYSIRPSE
FT                   RGKGYAKETLRQGLQVAKEKNIKKALVTCSVNNPASRAVILANGGIFEDARNGVERYWI
FT                   EVANE"
FT   gene            191572..192162
FT                   /gene="nrdG"
FT                   /locus_tag="SP_0205"
FT   CDS             191572..192162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="SP_0205"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="identified by similarity to GP:4098082; match to
FT                   protein family HMM PF04055; match to protein family HMM
FT                   TIGR02491"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74385"
FT                   /protein_id="AAK74385.1"
FT                   /translation="MNNPKPQEWKSEELSQGRIIDYKAFNFVDGEGVRNSLYVSGCMFH
FT                   CEGCYNVATWSFNAGIPYTAELEEQIMADLAQPYVQGLTLLGGEPFLNTGILLPLVKRI
FT                   RKELPDKDIWSWTGYTWEEMMLETPDKLEFLSLIDILVDGRYDRTKRNLMLQFRGSSNQ
FT                   RIIDVQKSLKSGQVVIWDKLNDGKESYEQVKRE"
FT   gene            192159..192461
FT                   /locus_tag="SP_0206"
FT   CDS             192159..192461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0206"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74386"
FT                   /protein_id="AAK74386.1"
FT                   /translation="MKKKDLVDQLVSEIETGKVRTLGIYGHGASGKSTFAQELYQALDS
FT                   TTVNLLETDPYITSGRHLVVPKDAPNQKVTASLPVAHELESLQRDILACRRVWMS"
FT   gene            192437..192775
FT                   /locus_tag="SP_0207"
FT   CDS             192437..192775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0207"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74387"
FT                   /protein_id="AAK74387.1"
FT                   /translation="MQAGMDVLTIEEPWKASEVLSGAKPILIVEGMSVGFLPKELFEKT
FT                   ICFYTDEETELKRRLARDTTVRNRDASFILASHQMRREQYLRYYKETESKADILVDQSE
FT                   DKFDVKRT"
FT   gene            193042..193350
FT                   /gene="rpsJ"
FT                   /locus_tag="SP_0208"
FT   CDS             193042..193350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SP_0208"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by similarity to EGAD:9141; match to
FT                   protein family HMM PF00338; match to protein family HMM
FT                   TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74388"
FT                   /db_xref="GOA:P66339"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66339"
FT                   /protein_id="AAK74388.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL"
FT   gene            193567..194193
FT                   /gene="rplC"
FT                   /locus_tag="SP_0209"
FT   CDS             193567..194193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SP_0209"
FT                   /product="ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74389"
FT                   /db_xref="GOA:Q97SV5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SV5"
FT                   /protein_id="AAK74389.1"
FT                   /translation="MTKGILGKKVGMTQIFTEAGELIPVTVIEATPNVVLQVKTVETDG
FT                   YNAIQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNVEGLEVGAEITVETFAAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLAGRMG
FT                   GDRVTIQNLEVVQVVPEKNVILIKGNVPGAKKSLITIKSAVKAGK"
FT   gene            194218..194841
FT                   /gene="rplD"
FT                   /locus_tag="SP_0210"
FT   CDS             194218..194841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="SP_0210"
FT                   /product="ribosomal protein L4"
FT                   /note="identified by match to protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74390"
FT                   /db_xref="GOA:Q97SV4"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SV4"
FT                   /protein_id="AAK74390.1"
FT                   /translation="MANVTLFDQTGKEAGQVVLSDAVFGIEPNESVVFDVIISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSEKVAENKFVAVDALSFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFA
FT                   ALSARNLPNVKVATATTASVLDIANSDKLLVTQAAISKIEEVLA"
FT   gene            194841..195137
FT                   /gene="rplW"
FT                   /locus_tag="SP_0211"
FT   CDS             194841..195137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SP_0211"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74391"
FT                   /db_xref="GOA:Q97SV3"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SV3"
FT                   /protein_id="AAK74391.1"
FT                   /translation="MNLYDVIKKPVITESSMAQLEAGKYVFEVDTRAHKLLIKQAVEAA
FT                   FEGVKVANVNTINVKPKAKRVGRYTGFTNKTKKAIITLTADSKAIELFAAEAE"
FT   gene            195155..195988
FT                   /gene="rplB"
FT                   /locus_tag="SP_0212"
FT   CDS             195155..195988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SP_0212"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74392"
FT                   /db_xref="GOA:Q97SV2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SV2"
FT                   /protein_id="AAK74392.1"
FT                   /translation="MGIRVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVALKSKAGRNN
FT                   NGRITVRHQGGGHKRFYRLVDFKRNKDNVEAVVKTIEYDPNRSANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTLIHNIELKPGRGGELVRAAGASAQ
FT                   VLGSEGKYVLVRLQSGEVRMILGTCRATVGVVGNEQHGLVNLGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK"
FT   gene            196092..196373
FT                   /gene="rpsS"
FT                   /locus_tag="SP_0213"
FT   CDS             196092..196373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SP_0213"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by similarity to EGAD:19290; match to
FT                   protein family HMM PF00203; match to protein family HMM
FT                   TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74393"
FT                   /db_xref="GOA:P0A4B5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4B5"
FT                   /protein_id="AAK74393.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRRK"
FT   gene            196385..196729
FT                   /gene="rplV"
FT                   /locus_tag="SP_0214"
FT   CDS             196385..196729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SP_0214"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74394"
FT                   /db_xref="GOA:P61182"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61182"
FT                   /protein_id="AAK74394.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPN
FT                   KAAEIILKVLNSAVANAENNFGLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRT
FT                   AHITVAVAEK"
FT   gene            196742..197395
FT                   /gene="rpsC"
FT                   /locus_tag="SP_0215"
FT   CDS             196742..197395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SP_0215"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by similarity to EGAD:15155; match to
FT                   protein family HMM PF00189; match to protein family HMM
FT                   PF00417; match to protein family HMM PF07650; match to
FT                   protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74395"
FT                   /db_xref="GOA:P0A4C3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4C3"
FT                   /protein_id="AAK74395.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFVQKE
FT                   LADAAVSTIEIERAVNKVNVSLHTAKPGMVIGKGGANVDALRAKLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGEGIARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   gene            197399..197812
FT                   /gene="rplP"
FT                   /locus_tag="SP_0216"
FT   CDS             197399..197812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SP_0216"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74396"
FT                   /db_xref="GOA:P0A475"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A475"
FT                   /protein_id="AAK74396.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   gene            197822..198028
FT                   /gene="rpmC"
FT                   /locus_tag="SP_0217"
FT   CDS             197822..198028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SP_0217"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by similarity to EGAD:7111; match to
FT                   protein family HMM PF00831; match to protein family HMM
FT                   TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74397"
FT                   /db_xref="GOA:P0A483"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A483"
FT                   /protein_id="AAK74397.1"
FT                   /translation="MKLNEVKEFVKELRGLSQEELAKRENELKKELFELRFQAATGQLE
FT                   QTARLKEVKKQIARIKTVQSEAK"
FT   gene            198053..198313
FT                   /gene="rpsQ"
FT                   /locus_tag="SP_0218"
FT   CDS             198053..198313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SP_0218"
FT                   /product="ribosomal protein S17"
FT                   /note="identified by match to protein family HMM PF00366"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74398"
FT                   /db_xref="GOA:P0A4B3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4B3"
FT                   /protein_id="AAK74398.1"
FT                   /translation="MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
FT   gene            198339..198707
FT                   /gene="rplN"
FT                   /locus_tag="SP_0219"
FT   CDS             198339..198707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SP_0219"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74399"
FT                   /db_xref="GOA:P0A473"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR023571"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A473"
FT                   /protein_id="AAK74399.1"
FT                   /translation="MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKSGARRADGSYIKFDENAAVIIREDKTPRGTRIFGPVAR
FT                   ELREGGFMKIVSLAPEVL"
FT   gene            198785..199090
FT                   /gene="rplX"
FT                   /locus_tag="SP_0220"
FT   CDS             198785..199090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SP_0220"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by similarity to EGAD:12689; match to
FT                   protein family HMM PF00467; match to protein family HMM
FT                   TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74400"
FT                   /db_xref="GOA:P60629"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60629"
FT                   /protein_id="AAK74400.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLTALPKVNKVIVEGVNIVKKHQ
FT                   RPTNELPQGGIIEKEAAIHVSNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD"
FT   gene            199114..199656
FT                   /gene="rplE"
FT                   /locus_tag="SP_0221"
FT   CDS             199114..199656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="SP_0221"
FT                   /product="ribosomal protein L5"
FT                   /note="identified by similarity to EGAD:13166; match to
FT                   protein family HMM PF00281; match to protein family HMM
FT                   PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74401"
FT                   /db_xref="GOA:Q97SV1"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SV1"
FT                   /protein_id="AAK74401.1"
FT                   /translation="MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAV
FT                   SNAKSLEKAAEELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGLDIVIVTTANT
FT                   DEESRALLTGLGMPFAK"
FT   gene            199674..199943
FT                   /gene="rpsN"
FT                   /locus_tag="SP_0222"
FT   CDS             199674..199943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SP_0222"
FT                   /product="ribosomal protein S14"
FT                   /note="identified by similarity to EGAD:13201; match to
FT                   protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74402"
FT                   /db_xref="GOA:P66419"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66419"
FT                   /protein_id="AAK74402.1"
FT                   /translation="MAKKSMVAREAKRQKIVDRYAEKRAALKAAGDYEGLSKLPRNASP
FT                   TRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW"
FT   gene            complement(199910..200032)
FT                   /locus_tag="SP_0223"
FT   CDS             complement(199910..200032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0223"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74403"
FT                   /protein_id="AAK74403.1"
FT                   /translation="MKKINFPRNFSFFVKFPIFTWSFDALDILNYQDAFVTPGI"
FT   gene            200228..200626
FT                   /gene="rpsH"
FT                   /locus_tag="SP_0224"
FT   CDS             200228..200626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SP_0224"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74404"
FT                   /db_xref="GOA:P66632"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66632"
FT                   /protein_id="AAK74404.1"
FT                   /translation="MVMTDPIADFLTRIRNANQAKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEIIEDDKQGVIRVFLKYGPNGEKVITNLKRVSKPGLRVYKKREDLPKVLNGLGIA
FT                   ILSTSEGLLTDKEARQKNVGGEVIAYVW"
FT   gene            200818..201354
FT                   /gene="rplF"
FT                   /locus_tag="SP_0225"
FT   CDS             200818..201354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SP_0225"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74405"
FT                   /db_xref="GOA:Q97SU7"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SU7"
FT                   /protein_id="AAK74405.1"
FT                   /translation="MSRIGNKVIVLPAGVELANNDNVVTVKGSKGELTREFSKDIEIRV
FT                   EGTEITLHRPNDSKEMKTIHGTTRALLNNMVVGVSEGFKKELEMRGVGYRAQLQGSKLV
FT                   LAVGKSHPDEVEAPEGITFELPNPTTIVVSGISKEVVGQTAAYVRSLRSPEPYKGKGIR
FT                   YVGEFVRRKEGKTGK"
FT   gene            201438..201794
FT                   /gene="rplR"
FT                   /locus_tag="SP_0226"
FT   CDS             201438..201794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SP_0226"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74406"
FT                   /db_xref="GOA:Q97SU6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SU6"
FT                   /protein_id="AAK74406.1"
FT                   /translation="MISKPDKNKLRQKRHRRVRGKLSGTADRPRLNVFRSNTGIYAQVI
FT                   DDVAGVTLASASTLDKEVSKGTKTEQAVAVGKLVAERANAKGISEVVFDRGGYLYHGRV
FT                   KALADAARENGLKF"
FT   gene            201812..202306
FT                   /gene="rpsE"
FT                   /locus_tag="SP_0227"
FT   CDS             201812..202306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SP_0227"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by similarity to EGAD:12973; match to
FT                   protein family HMM PF00333; match to protein family HMM
FT                   PF03719; match to protein family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74407"
FT                   /db_xref="GOA:P66581"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66581"
FT                   /protein_id="AAK74407.1"
FT                   /translation="MAFKDNAVELEERVVAVNRVTKVVKGGRRLRFAALVVVGDHNGRV
FT                   GFGTGKAQEVPEAIRKAVDDAKKNLIEVPMVGTTIPHEVLSEFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVVELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEIAALRGISVSDL
FT                   A"
FT   gene            202320..202502
FT                   /gene="rpmD"
FT                   /locus_tag="SP_0228"
FT   CDS             202320..202502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SP_0228"
FT                   /product="ribosomal protein L30"
FT                   /note="identified by similarity to EGAD:13217; match to
FT                   protein family HMM PF00327; match to protein family HMM
FT                   TIGR01308"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74408"
FT                   /db_xref="GOA:Q97SU4"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SU4"
FT                   /protein_id="AAK74408.1"
FT                   /translation="MAQIKITLTKSPIGRIPSQRKTVVALGLGKLNSSVIKEDNAAIRG
FT                   MITAVSHLVTVEEVN"
FT   gene            202647..203087
FT                   /gene="rplO"
FT                   /locus_tag="SP_0229"
FT   CDS             202647..203087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SP_0229"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by similarity to EGAD:9380; match to
FT                   protein family HMM PF00256; match to protein family HMM
FT                   PF01305; match to protein family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74409"
FT                   /db_xref="GOA:Q97SU3"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SU3"
FT                   /protein_id="AAK74409.1"
FT                   /translation="MKLHELKPAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINAKEYAIVNLDQLNVFEDGAEVTPVVLIEAGIVKA
FT                   EKSGIKILGNGELTKKLTVKAAKFSKSAEEAITAKGGSVEVI"
FT   gene            203100..204410
FT                   /gene="secY"
FT                   /locus_tag="SP_0230"
FT   CDS             203100..204410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SP_0230"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by match to protein family HMM PF00344;
FT                   match to protein family HMM TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74410"
FT                   /protein_id="AAK74410.1"
FT                   /translation="MFFKLLREALKVKQVRSKILFTIFIVLVFRIGTSITVPGVNANSL
FT                   NALSGLSFLNMLSLVSGNALKNFSIFALGVSPYITASIVVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYIALVLAFVQSIGITAGFNTLAGAQLIKTALTPQVFLTIGIILTAGSM
FT                   IVTWLGEQITDKGYGNGVSMIIFAGIVSSIPEMIQGIYVDYFVNVPSSRITSSIIFVII
FT                   LIITVLLIIYFTTYVQQAEYKIPIQYTKVAQGAPSSSYLPLKVNPAGVIPVIFASSITA
FT                   APAAILQFLSATGHDWAWVRVAQEMLATTSPTGIAMYALLIILFTFFYTFVQINPEKAA
FT                   ESLQKSGAYIHGVRPGKGTEEYMSKLLRRLATVGSLFLGVISILPIAAKDVFGLSDVVA
FT                   FGGTSLLIIISTGIEGIKQLEGYLLKRKYVGFMDRTE"
FT   gene            204561..205199
FT                   /gene="adk"
FT                   /locus_tag="SP_0231"
FT   CDS             204561..205199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SP_0231"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by similarity to EGAD:18646; match to
FT                   protein family HMM PF00406; match to protein family HMM
FT                   TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74411"
FT                   /db_xref="GOA:Q97SU1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SU1"
FT                   /protein_id="AAK74411.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEQFHVAHISTGDMFRAAMANQTEM
FT                   GVLAKSYIDKGELVPDEVTNGIVKERLSQDDIKETGFLLDGYPRTIEQAHALDKTLAEL
FT                   GIELEGVINIEVNPDSLLERLSGRIIHRVTGETFHKVFNPPVDYKEEDYYQREDDKPET
FT                   VKRRLDVNIAQGEPIIAHYRAKGLVHDIEGNQDINDVFSDIEKVLTNLK"
FT   gene            205316..205534
FT                   /gene="infA"
FT                   /locus_tag="SP_0232"
FT   CDS             205316..205534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SP_0232"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74412"
FT                   /db_xref="GOA:P65121"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="PDB:4QL5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65121"
FT                   /protein_id="AAK74412.1"
FT                   /translation="MAKDDVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNYI
FT                   RILAGDRVTVEMSPYDLTRGRITYRFK"
FT   gene            205559..205675
FT                   /gene="rpmJ"
FT                   /locus_tag="SP_0233"
FT   CDS             205559..205675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="SP_0233"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by similarity to EGAD:7945; match to
FT                   protein family HMM PF00444; match to protein family HMM
FT                   TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74413"
FT                   /db_xref="GOA:P0A495"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A495"
FT                   /protein_id="AAK74413.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG"
FT   gene            205693..206058
FT                   /gene="rpsM"
FT                   /locus_tag="SP_0234"
FT   CDS             205693..206058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SP_0234"
FT                   /product="ribosomal protein S13"
FT                   /note="identified by similarity to EGAD:23759; match to
FT                   protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74414"
FT                   /db_xref="GOA:P66392"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66392"
FT                   /protein_id="AAK74414.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDVRV
FT                   RDLTSDQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   gene            206076..206459
FT                   /gene="rpsK"
FT                   /locus_tag="SP_0235"
FT   CDS             206076..206459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SP_0235"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by similarity to EGAD:13090; match to
FT                   protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74415"
FT                   /db_xref="GOA:P66359"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66359"
FT                   /protein_id="AAK74415.1"
FT                   /translation="MAKPTRKRRVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSSA
FT                   GALGFKGSRKSTPFAAQMASEAAAKSAQEHGLKSVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   gene            206502..207437
FT                   /gene="rpoA"
FT                   /locus_tag="SP_0236"
FT   CDS             206502..207437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SP_0236"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF01193; match to protein
FT                   family HMM PF03118; match to protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74416"
FT                   /db_xref="GOA:P66708"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66708"
FT                   /protein_id="AAK74416.1"
FT                   /translation="MIEFEKPNITKIDENKDYGKFVIEPLERGYGTTLGNSLRRVLLAS
FT                   LPGAAVTSINIDGVLHEFDTVPGVREDVMQIILNIKGIAVKSYVEDEKIIELDVEGPAE
FT                   VTAGDILTDSDIEIVNPDHYLFTIGEGSSLKATMTVNSGRGYVPADENKKDNAPVGTLA
FT                   VDSIYTPVTKVNYQVEPARVGSNDGFDKLTLEILTNGTIIPEDALGLSARILTEHLDLF
FT                   TNLTEIAKSTEVMKEADTESDDRILDRTIEELDLSVRSYNCLKRAGINTVHDLTEKSEA
FT                   EMMKVRNLGRKSLEEVKLKLIDLGLGLKDK"
FT   gene            207449..207835
FT                   /gene="rplQ"
FT                   /locus_tag="SP_0237"
FT   CDS             207449..207835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SP_0237"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by similarity to EGAD:19865; match to
FT                   protein family HMM PF01196; match to protein family HMM
FT                   TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74417"
FT                   /db_xref="GOA:Q97ST6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ST6"
FT                   /protein_id="AAK74417.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAFVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNG
FT                   GYTRILKTESRRGDAAPMAIIELV"
FT   gene            208100..208366
FT                   /locus_tag="SP_0238"
FT   CDS             208100..208366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0238"
FT                   /product="ACT domain protein"
FT                   /note="identified by similarity to PIR:E64494; match to
FT                   protein family HMM PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74418"
FT                   /db_xref="GOA:P67382"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="PDB:1ZPV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67382"
FT                   /protein_id="AAK74418.1"
FT                   /translation="MKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTMM
FT                   AVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFEAMYNI"
FT   gene            208376..209713
FT                   /locus_tag="SP_0239"
FT   CDS             208376..209713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:7226903; match to
FT                   protein family HMM PF05167"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74419"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="PDB:2HA9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ST4"
FT                   /protein_id="AAK74419.1"
FT                   /translation="MDIRQVTETIAMIEEQNFDIRTITMGISLLDCIDPDINRAAEKIY
FT                   QKITTKAANLVAVGDEIAAELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAK
FT                   EIGVDFIGGFSALVQKGYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTAVAD
FT                   MGRIIKETANLSDMGVAKLVVFANAVEDNPFMAGAFHGVGEADVIINVGVSGPGVVKRA
FT                   LEKVRGQSFDVVAETVKKTAFKITRIGQLVGQMASERLGVEFGIVDLSLAPTPAVGDSV
FT                   ARVLEEMGLETVGTHGTTAALALLNDQVKKGGVMACNQVGGLSGAFIPVSEDEGMIAAV
FT                   QNGSLNLEKLEAMTAICSVGLDMIAIPEDTPAETIAAMIADEAAIGVINMKTTAVRIIP
FT                   KGKEGDMIEFGGLLGTAPVMKVNGASSVDFISRGGQIPAPIHSFKN"
FT   gene            209957..210649
FT                   /locus_tag="SP_0240"
FT   CDS             209957..210649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0240"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /EC_number="5.4.2.-"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74420"
FT                   /protein_id="AAK74420.1"
FT                   /translation="MVKVRLYLVRHGKTMFNTIGRAQGWSDTPLTAEGERGIQELGIGL
FT                   RESDLQFERAYSSDSGRTIQTMGIILEELGLQGEIPYRMDKRIREWCFGSFDGAYDGDL
FT                   FMGIIPRIFNVDHVHQLSYAELAEGLVEVDTAGWAEGWEKLSGRIKEGFEMIAKEMEDQ
FT                   GGGNALVVSHGMTIGTIVYLINGMHPHGLDNGSVTILEYEDGQFRVEVVGDRSYRELGR
FT                   EKMEEGSI"
FT   gene            complement(210752..212397)
FT                   /pseudo
FT                   /locus_tag="SP_0241"
FT                   /note="iron ABC transporter, permease protein, degenerate;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:2766195"
FT   gene            complement(212387..213478)
FT                   /locus_tag="SP_0242"
FT   CDS             complement(212387..213478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0242"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to GP:2766194; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74421"
FT                   /protein_id="AAK74421.1"
FT                   /translation="MSEIKIINAKKIYHDVPVIENLNITIPKGSLFTLLGASGCGKTTL
FT                   LRMIAGFNSIEGGEFYFDDTKINNMEPSKRNIGMVFQNYAIFPHLTVRDNVAFGLMQKK
FT                   VPKEELIQQTNKYLELMQIAQYADRKPDKLSGGQQQRVTLACALAVNPSVLLMDEPLSN
FT                   LEAKLRLDMRQAIREIQHEVGITTVYVTHDQEEAMAISDQIAVMKDGVIQQIGRPKELY
FT                   HKPANEFVATFIGRTNIIPANLEKRSDGAYIVFSDGYALRMPALDQVEEQAIHVSIRPE
FT                   EFIKDESGDIEGTIRDSVYLGLNTDYFIETGFASKIQVSEESTFEEDLQKGNRIRLRIN
FT                   TQKLNIFSADGSQNLIKGVNHGT"
FT   gene            complement(213491..214507)
FT                   /locus_tag="SP_0243"
FT   CDS             complement(213491..214507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0243"
FT                   /product="iron ABC transporter, iron-binding protein"
FT                   /note="identified by similarity to GP:6127225; match to
FT                   protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74422"
FT                   /protein_id="AAK74422.1"
FT                   /translation="MKKKWMYYAACSSNESADDSSSDKGDGGSLVVYSPNSEGLIGATI
FT                   PAFEEKYGIKVELIQAGTGELFKKLESEKEVPVADVIFGGSYTQYTTHGELFENYTSKE
FT                   NDNVIKEYQNTTGYSTPYTLDGSVLIVNPDLTKGMNIEGYNDLFKPELKGKIATADPAN
FT                   SSSAFAQLTNMLQAQGGYKDDKAWSYVKDLFTLIDGKIGSSSSSVYKVVADGEMAVGLS
FT                   YEDPAVKLLNDGANIKVVYPKEGTVFLPASAAIVKKSKNMENAKKFIDFIISQEVQDTL
FT                   GTTTTNRPVRKNAKTSENMKPIDKIKTLTEDYDYVIKNKSDIVKKYNEVFTDIQSKQ"
FT   gene            complement(214812..214919)
FT                   /locus_tag="SP_0244"
FT   CDS             complement(214812..214919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0244"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74423"
FT                   /protein_id="AAK74423.1"
FT                   /translation="MSHSFKKSLQKEILHRSSIAAFVTSRAFSDTVSPI"
FT   gene            complement(215094..215870)
FT                   /locus_tag="SP_0245"
FT   CDS             complement(215094..215870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0245"
FT                   /product="putative pyruvate formate-lyase-activating
FT                   enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="identified by similarity to EGAD:38340; match to
FT                   protein family HMM PF04055; match to protein family HMM
FT                   TIGR02494"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74424"
FT                   /protein_id="AAK74424.1"
FT                   /translation="MEISKGIIFNIQHFSIHDGPGIRTTVFLKGCPLRCPWCSNPESQR
FT                   MKPEKMKDAQREKFTLVGEEKTVEEIITEVLKDKEFYEESGGGLTLSGGEIFAQFEFAK
FT                   AILKSAKEHHIHTAIETTAFVDHEKFIDLIQYVDFIYTDLKHYNSIKHKKVTGVFNQMI
FT                   IKNIHYAFSQNKTIVLRIPVIPNFNNSLEDAEKFATLFNSLNIDQVQLLPFHQFGENKY
FT                   RLLNRKYEMDGINALHPEDLIDYQKVFLNHHINCYF"
FT   gene            215992..216738
FT                   /locus_tag="SP_0246"
FT   CDS             215992..216738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0246"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74425"
FT                   /protein_id="AAK74425.1"
FT                   /translation="MKRLEQIIKLVSEYEKIDVNTLSEKLNVSKVTIRKDLDKLESKGL
FT                   LHREHGYAVLNSGDDLNVRLSINYETKRKIVQEAVKLVSDNETIMIESGSTCALLAEEI
FT                   CKQKRNVTIVTNSFFIANFVRAYDSCRVIVLGGEFQKDSQVTVGPLLKEMIQTFHVCQA
FT                   FVGTDGYDKEMGFTGKDLMRSEVVQYISAVSDKVIVLTDSSKFDKRGTVRRFALSQVYE
FT                   VITDEKLSKQNIATLENAGIMVKVVS"
FT   gene            216751..217731
FT                   /locus_tag="SP_0247"
FT   CDS             216751..217731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0247"
FT                   /product="transcriptional regulator"
FT                   /note="identified by similarity to EGAD:6416; match to
FT                   protein family HMM PF04198"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74426"
FT                   /protein_id="AAK74426.1"
FT                   /translation="MNQDRNKLLSKIAYLYYIENLNQSQIAAKLGIYRTSISRMLTEAR
FT                   NVGIVKIEIENFDTNMFKLENYVKEKYSLESLEIIPNEFDDTPTILSERISQVAAGVLR
FT                   NLIDDNMKIGFSWGKSLSNLVDLIHSKSVRNVHFYPLAGGPSHIHAKYHVNTLIYEMSR
FT                   KFHGECTFMNATIVQENKLLADGILQSRYFENLKNSWKDLDIAVVGIGDFSNKGKHQWL
FT                   DMLTEDDFKELTKVKTVGEICCRFFDSKGKEVYENLQERTIAISLEDLKNIPQSLAVAY
FT                   GDTKVSSILSVLRANLVNHLITDKNTILKVLEEDGDLTFREILGE"
FT   gene            217926..218246
FT                   /locus_tag="SP_0248"
FT   CDS             217926..218246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0248"
FT                   /product="PTS system, IIA component"
FT                   /note="identified by match to protein family HMM PF02255"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74427"
FT                   /protein_id="AAK74427.1"
FT                   /translation="MEMIVPDQIIMGLILYAGDAKQHIYKALDYIKNGTCERCEEEIQL
FT                   ADAALLEAHNLQTKFLAQEASGTKTEITALFVHSQDHLMTSMTEINLIKEIISLRKELH
FT                   KK"
FT   gene            218292..218600
FT                   /locus_tag="SP_0249"
FT   CDS             218292..218600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0249"
FT                   /product="PTS system, IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by similarity to EGAD:18420; match to
FT                   protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74428"
FT                   /protein_id="AAK74428.1"
FT                   /translation="MVKIGLFCAAGFSTGMLVNNMKIAAQSSGVEAEIEAFSQSKLADY
FT                   APNIDVALLGPQVAYTLDKSKEICDKCDVPIAVIPMMDYGMLDGKKVLDLALSLISG"
FT   gene            218593..219915
FT                   /locus_tag="SP_0250"
FT   CDS             218593..219915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0250"
FT                   /product="PTS system, IIC component"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74429"
FT                   /protein_id="AAK74429.1"
FT                   /translation="MGKKRRFIMSKMDVQKIIAPMMKFVNMRGIIALKDGMLAILPLTV
FT                   VGSLFLIMGQLPFEGLNKSIASVFGANWTEPFMQVYSGTFAIMGLISCFSIAYSYAKNS
FT                   GVEALPAGVLSVSAFFILLRSSYIPKQGEAIGDAISKVWFGGQGIIGAIIIGLVVGSIY
FT                   TFFIKRKIVIKMPEQVPQAIAKQFEAMIPAFVIFLSSMIVYILAKSLTNGGTFIEMIYS
FT                   AIQVPLQGLTGSLYGAIGIAFFISFLWWFGVHGQSVVNGVVTALLLSNLDANKAMLASA
FT                   NLSLENGAHIVTQQFLDSFLILSGSGITFGLVVAMLFAAKSKQYQALGKVAAFPAIFNV
FT                   NEPVVFGFPIVMNPVMFVPFILVPVLAAVIVYGAIATGFMQPFSGVTLPWSTPAILSGF
FT                   LVGGWQGVITQLVILAMSTLVYFPFFKVQDRLAYQNEIKQS"
FT   gene            220066..222504
FT                   /locus_tag="SP_0251"
FT   CDS             220066..222504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0251"
FT                   /product="putative formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="identified by similarity to EGAD:20598; match to
FT                   protein family HMM PF01228; match to protein family HMM
FT                   PF02901; match to protein family HMM TIGR01774"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74430"
FT                   /protein_id="AAK74430.1"
FT                   /translation="MVNTEVARTTIKTEYFGSLTERMNKYREDVLNKKPYIDAERAVLA
FT                   TRAYERYKEQPNVLKRAYMLKEILENMTIYIEEESMIAGNQASSNKDAPIFPEYTLEFV
FT                   LNELDLFEKRDGDVFYITEETKEQLRSIAPFWENNNLRARAGALLPEEVSVYMETGFFG
FT                   MEGKMNSGDAHLAVNYQKLLQFGLRGFEERARKAKVALDLTDPASIDKYHFYDSIFIVI
FT                   DAIKVYAKRFVALAKSLAENANPKRKKELLEIADICSRVPYEPATTFAEAIQSVWFIQC
FT                   ILQIESNGHSLSYGRFDQYMYPYMKADLESGKETEDSIVERLTNLWIKTITINKVRSQS
FT                   HTFSSAGSPLYQNVTIGGQTRDKKDAVNPLSYLVLKSVAQTHLPQPNLTVRYHAGLDAR
FT                   FMNECIEVMKLGFGMPAFNNDEIIIPSFIAKGVLEDDAYDYSAIGCVETAVPGKWGYRC
FT                   TGMSYMNFPKVLLITMNDGIDPASGKRFAPSFGRFKDMKNFSELENAWDKTLRYLTRMS
FT                   VIVENSIDLSLEREVPDILCSALTDDCIGRGKHLKEGGAVYDYISGLQVGIANLSDSLA
FT                   AIKKLVFEEERISPSQLWHALETDYAGEEGKVIQEMLIHDAPKYGNDDDYADKLVTAAY
FT                   DIYVDEIAKYPNTRYGRGPIGGIRYSGTSSISANVGQGRGTLATPDGRNAGTPLAEGCS
FT                   PSHNMDQHGPTSVLKSVSKLPTDEIVGGVLLNQKVNPQTLAKEEDKLKLIALLRTFFNR
FT                   LHGYHIQYNVVSRETLIDAQKHPEKHRDLIVRVAGYSAFFNVLSKATQDDIIGRTEHTL
FT                   "
FT   gene            222523..223191
FT                   /locus_tag="SP_0252"
FT   CDS             222523..223191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0252"
FT                   /product="transaldolase family protein"
FT                   /note="identified by match to protein family HMM PF00923"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74431"
FT                   /db_xref="GOA:Q97SS2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR023001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SS2"
FT                   /protein_id="AAK74431.1"
FT                   /translation="MEFMLDTLNLDEIKKWSEILPLAGVTSNPTIAKREGSINFFERIK
FT                   DVRELIGSTPSIHVQVISQDFEGILKDAHKIRRQAGDDIFIKVPVTPAGLRAIKALKKE
FT                   GYHITATAIYTVIQGLLAIEAGADYLAPYYNRMENLNIDSNSVIRQLALAIDRQNSPSK
FT                   ILAASFKNVAQVNNALAAGAHAVTAGADVFESAFAMPSIQKAVDDFSDDWFVIQNSRSI
FT                   "
FT   gene            223209..224297
FT                   /gene="gldA"
FT                   /locus_tag="SP_0253"
FT   CDS             223209..224297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gldA"
FT                   /locus_tag="SP_0253"
FT                   /product="glycerol dehydrogenase"
FT                   /EC_number="1.1.1.6"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74432"
FT                   /protein_id="AAK74432.1"
FT                   /translation="MRIFASPSRYIQGENALFENAKSILDLGNCPILLCDQLVYDIVGK
FT                   RFEDYLHRYGFHIVLALFNGEASDNEINRVVALAEKENCDSIIGLGGGKTIDSAKAIAD
FT                   LIEKPVIIAPTIASTDAPVSALSVIYTDEGAFDHYLFYSKNPDLVLVDTKVISQAPKRL
FT                   LASGIADGLATWVEARAVMQANGKTMLGQQQTLAGVAIAKKCEETLFADGLQAMAACEA
FT                   KVVTPALENIVEANTLLSGLGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTLV
FT                   QLLLENRPKEELDKYIEFYKKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMP
FT                   FKISPSDVAQAIIAVDAYVNSK"
FT   gene            224752..227253
FT                   /gene="leuS"
FT                   /locus_tag="SP_0254"
FT   CDS             224752..227253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="SP_0254"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM TIGR00396"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74433"
FT                   /db_xref="GOA:Q97SS0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SS0"
FT                   /protein_id="AAK74433.1"
FT                   /translation="MSFYNHKEIEPKWQGYWAEHHTFKTGTDTSKPKFYALDMFPYPSG
FT                   AGLHVGHPEGYTATDILSRYKRAQGYNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAEN
FT                   IANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELG
FT                   TAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLNDLDELDWSESIKDMQRN
FT                   WIGKSTGANVTFKVKGTDKEFTVFTTRPDTLFGATFTVLAPEHELVDAITSSEQAEAVA
FT                   DYKHQASLKSDLARTDLAKEKTGVWTGAYAINPVNGKEMPIWIADYVLASYGTGAVMAV
FT                   PAHDQRDWEFAKQFDLPIVEVLEGGNVEEAAYTEDGLHVNSDFLDGLNKEDAIAKIVAW
FT                   LEEKGCGQEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPETELPLVLPVTKDIR
FT                   PSGTGESPLANLTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADED
FT                   LLKQWLPVDIYVGGAEHAVLHLLYARFWHKFLYDLGVVPTKEPFQKLFNQGMILGTSYR
FT                   DHRGALVATDKVEKRDGSFFHVETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRV
FT                   YEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLITSKEILAENNGALDKVYNETVKAVTE
FT                   QIESLKFNTAIAQLMVFVNAANKEDKLYVDYAKGFIQLIAPFAPHLAEELWQTVAETGE
FT                   SISYVAWPTWDESKLVEDEIEIVVQIKGKVRAKLMVAKDLSREELQEIALADEKVKAEI
FT                   DGKEIVKVIAVPNKLVNIVVK"
FT   gene            227448..228143
FT                   /locus_tag="SP_0255"
FT   CDS             227448..228143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0255"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74434"
FT                   /protein_id="AAK74434.1"
FT                   /translation="MPVNEYGQMIGESMEAYTPGELPSFDFLEGRYARIEALSVEKHAE
FT                   DLLAVYGPDTPREMWTYLFQESVADMEELVSLLNQMLARKDRFYYAIIDKATGKALGTF
FT                   SLMRIDQNNRVIEVGAVTFSPELRGTRIGTEAQYLLACYVFEELNYRRYEWKCDALNLP
FT                   SRRAAERLGFIYEGTFRQAVVYKGRTRDTDWLSMIDKDWPQVKARLEIWLRPENFDKNG
FT                   RQHKSLREL"
FT   gene            228155..228571
FT                   /locus_tag="SP_0256"
FT   CDS             228155..228571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0256"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74435"
FT                   /protein_id="AAK74435.1"
FT                   /translation="MITIKKQEIVKLEDVLHLYQAVGWTNYTHQTEMLEQALSHSLVIY
FT                   LALDGDAVVGLIRLVGDGFSSVFVQDLIVLPSYQRQGIGSSLMKEALGNFKEAYQVQLA
FT                   TEETEKNVGFYRSMGFEILSTYDCTGMIWINREK"
FT   gene            229365..230621
FT                   /pseudo
FT                   /locus_tag="SP_0257"
FT                   /note="2 full length (1974 bp) copies fold into the
FT                   secondary structures expected for a group II intron. Left
FT                   end = TTTTTTGCGGTACGACGGGC. Right end =
FT                   GAGATTATCCCCTACTCGAT.; group II intron, maturase,
FT                   degenerate; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   EGAD:135254"
FT   gene            complement(231373..231465)
FT                   /locus_tag="SP_0258"
FT   CDS             complement(231373..231465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0258"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74436"
FT                   /protein_id="AAK74436.1"
FT                   /translation="MMELVLKTIIGPIVVGVVLRIVDKWLNKDK"
FT   gene            231600..232598
FT                   /gene="ruvB"
FT                   /locus_tag="SP_0259"
FT   CDS             231600..232598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SP_0259"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="identified by similarity to EGAD:15420; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF05491; match to protein family HMM PF05496; match to
FT                   protein family HMM TIGR00635"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74437"
FT                   /db_xref="GOA:Q97SR6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SR6"
FT                   /protein_id="AAK74437.1"
FT                   /translation="MSRILDNEMMGDEELVERTLRPQYLREYIGQDKVKDQLQIFIEAA
FT                   KMRDEALDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSGPVIEKAGDLVAILNDLEPG
FT                   DVLFIDEIHRLPMSVEEVLYSAMEDFYIDIMIGAGEGSRSVHLELPPFTLIGATTRAGM
FT                   LSNPLRARFGITGHMEYYAHADLTEIVERTADIFEMEITHEAASELALRSRGTPRIANR
FT                   LLKRVRDFAQIMGNGVIDDVITDKALTMLDVDHEGLDYVDQKILRTMIEMYSGGPVGLG
FT                   TLSVNIAEERETVEDMYEPYLIQKGFIMRTRSGRVATAKAYEHLGYEYSEK"
FT   gene            232579..233151
FT                   /locus_tag="SP_0260"
FT   CDS             232579..233151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:173606; match to
FT                   protein family HMM PF06042"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74438"
FT                   /protein_id="AAK74438.1"
FT                   /translation="MNTVKNKQEILEAFRESPDMMAILTIIRDLGLKDSWLAAGSVRNF
FT                   IWNLLSDKSPFDHETDIDVIFFDPDFSYEETLLLEKKLREDFPQYQWELKNQVYMHQHS
FT                   PHTASYTSSRDAMSKYPERCTAVGLRLNEELDFELYVPYGLEDILNFQVRPTPHFLENE
FT                   DRMELYQTRLSKKNWQEKWKNLIFKNT"
FT   gene            233382..234140
FT                   /gene="uppS"
FT                   /locus_tag="SP_0261"
FT   CDS             233382..234140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="SP_0261"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="identified by similarity to SP:O82827; match to
FT                   protein family HMM PF01255; match to protein family HMM
FT                   TIGR00055"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74439"
FT                   /db_xref="GOA:Q97SR4"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SR4"
FT                   /protein_id="AAK74439.1"
FT                   /translation="MFGFFKKDKAVEVEVPTQVPAHIGIIMDGNGRWAKKRMQPRVFGH
FT                   KAGMEALQTVTKAANKLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFYDNYVPELHA
FT                   NNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQALKLISQD
FT                   VLDAKINPGDITEELIGNYLFTQHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYSELYF
FT                   TDTLWPDFDEAALQEAILAYNRRHRRFGGV"
FT   gene            234149..234952
FT                   /locus_tag="SP_0262"
FT   CDS             234149..234952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0262"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="identified by similarity to EGAD:108469; match to
FT                   protein family HMM PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74440"
FT                   /protein_id="AAK74440.1"
FT                   /translation="MTQDLQKRTLFAGIALAIFLPILMIGGLLLQIAIGIIAMLAMHEL
FT                   LKMRGLETMTMEGLLTLFATFALTIPLENYLTFLPVDGNVVAYSVLISIMLGTTVFSKS
FT                   YTIEDAVFPLAMSFYVGFGFNALLDARVAGLDKALLALCIVWATDSGAYLVGMNYGKRK
FT                   LAPRVSPNKTLEGALGGILGAILVTIILMIVDSTVALPYGIYKMSVFAIFFSIAGQFGD
FT                   LLESSIKRHFGVKDSGKFIPGHGGVLDRFDSMLLVFPIMHLFGLF"
FT   gene            234974..236233
FT                   /gene="eep"
FT                   /locus_tag="SP_0263"
FT   CDS             234974..236233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eep"
FT                   /locus_tag="SP_0263"
FT                   /product="eep protein"
FT                   /note="identified by similarity to GP:5714510; match to
FT                   protein family HMM PF02163; match to protein family HMM
FT                   TIGR00054"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74441"
FT                   /db_xref="GOA:Q97SR2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SR2"
FT                   /protein_id="AAK74441.1"
FT                   /translation="MLGILTFILVFGIIVVVHEFGHFYFAKKSGILVREFAIGMGPKIF
FT                   AHIGKDGTAYTIRILPLGGYVRMAGWGDDTTEIKTGTPVSLTLADDGKVKRINLSGKKL
FT                   DQTALPMQVTQFDFEDKLFIKGLVLEEEKTFAVDHDATVVEADGTEVRIAPLDVQYQNA
FT                   TIWGKLITNFAGPMNNFILGVVVFWVLIFMQGGVRDVDTNQFHIMPQGALAKVGVPEMA
FT                   QITKIGSHEVSNWESLIQAVETETKDKTAPTLDVTISEKGSDKQVTVTPKDSQGRYLLG
FT                   VQPGVKSDFLSMFVGGFTTAADSALRILSALKNLIFQPDLNKLGGPVAIFKASSDAAKN
FT                   GIENILYFLAMISINIGIFNLIPIPALDGGKIVLNILEAIRRKPLKQEIETYVTLAGVV
FT                   IMVVLMIAVTWNDIMRLFFR"
FT   gene            236246..238099
FT                   /gene="proS"
FT                   /locus_tag="SP_0264"
FT   CDS             236246..238099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="SP_0264"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF04073; match to protein family HMM TIGR00409"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74442"
FT                   /db_xref="GOA:Q97SR1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SR1"
FT                   /protein_id="AAK74442.1"
FT                   /translation="MKQSKMPIPTLREMPSDAQVISHALMLRAGYVRQVSAGVYSYLPL
FT                   ANRVIEKAKNIMRQEFEKIGAVEMLAPALLSAELWRESGRYETYGEDLYKLKNREKSDF
FT                   ILGPTHEETFTAIVRDSVKSYKQLPLNLYQIQPKYRDEKRPRNGLLRTREFIMKDAYSF
FT                   HANYDSLDSVYDEYKAAYERIFTRSGLDFKAIIGDGGAMGGKDSQEFMAITSARTDLDR
FT                   WVVLDKSVASFDEIPAEVQEEIKAELLKWIVSGEDTIAYSSESSYAANLEMATNEYKPS
FT                   NRVVAEEEVTRVATPDVKSIDEVAAFLNVPEEQTIKTLFYIADGELVAALLVGNDQLNE
FT                   VKLKNHLGADFFDVASEEEVANVVQAGFGSLGPVGLPENIKIIADRKVQDVRNAVVGAN
FT                   EDDYHLTGVNPGRDFTAEYVDIREVREGEISPDGQGVLNFARGIEIGHIFKLGTRYSAS
FT                   MGADVLDENGRAVPIIMGCYGIGVSRLLSAVMEQHARLFVNKTPKGEYRYAWGINFPKE
FT                   LAPFDVHLITVNVKDEEAQALTEKLEASLMGAGYEVLTDDRNERVGVKFSDSDLIGLPI
FT                   RITVGKKAADGIVEVKIKATGDTIEVHADNVLETLEILSKK"
FT   gene            238198..239577
FT                   /locus_tag="SP_0265"
FT   CDS             238198..239577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0265"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74443"
FT                   /protein_id="AAK74443.1"
FT                   /translation="MLRFPKDFVWGSSTSGPQTEGRVAGDGKGDNLWDYWFQVEPNRYY
FT                   NGIGSDKTSTFYENWERDIELLLETGHTAFRTSIQWSRIFPQGCGKVNTQGVDFYRKVF
FT                   EAIKAKGIRLLVNLYHFDLPFALQEDGDGWENKATVSAYEDYARFCFETYGDLVDQWIT
FT                   FNEPIVPVEFGYFYDAHYPHKVDAEAAVKVAYHTQLASSRAVKACHELLPDSKIGIVLN
FT                   LTPAYPRSQHPADVKAARIAALFQAQSFLDPSVLGTYPQELVEILHEHGLLPDATEEEL
FT                   ELIRDNTVDFLGVNYYQPLRVMAPRFAKHPESPLLPEHFYEPYVMPGRKINSHRGWEIY
FT                   EQGIYDIAQNIKENYGNIEWMLTENGMGVEGEEKFRQDGMIQDDYRIDFVKGHLRELHR
FT                   AIEDGANCKGYLIWTFIDCWSWLNSYKNRYGLVELDLETQERRLKKSGHWFKELSDNNG
FT                   F"
FT   gene            239770..241578
FT                   /gene="glmS"
FT                   /locus_tag="SP_0266"
FT   CDS             239770..241578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="SP_0266"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by similarity to SP:P39754; match to
FT                   protein family HMM PF00310; match to protein family HMM
FT                   PF01380; match to protein family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74444"
FT                   /db_xref="GOA:Q97SQ9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SQ9"
FT                   /protein_id="AAK74444.1"
FT                   /translation="MCGIVGVVGNTNATDILIQGLEKLEYRGYDSAGIFVLDGADNHLV
FT                   KAVGRIAELSAKTAGVEGTTGIGHTRWATHGKPTEDNAHPHRSETERFVLVHNGVIENY
FT                   LEIKEEYLAGHHFKGQTDTEIAVHLIGKFAEEEGLSVLEAFKKALHIIRGSYAFALVDS
FT                   QDPEVIYVAKNKSPLLIGLGEGYNMVCSDAMAMIRETNQYMEIHDQELVIVKADSVEVQ
FT                   DYDGNRRERASYTAELDLSDIGKGTYPYYMLKEIDEQPTVMRKLIQAYTDEAGQVVVDP
FT                   DIIKAVQDADRIYILAAGTSYHAGFASKKMLEELTDTPVELGISSEWGYGMPLLSKKPL
FT                   FIFISQSGETADSRQVLVKANEMGIPSLTVTNVPGSTLSREANYTMLLHAGPEIAVAST
FT                   KAYTAQIAALAFLAKAVGEANGNAKAQAFDLVHELSIVAQSIESTLSEKETIEVKVREL
FT                   LETTRNAFYIGRGQDYYVAMEASLKLKEISYIQCEGFAAGELKHGTIALIEEGTPVLAL
FT                   LSDPVLANHTRGNIQEVAARGAKVLTIAEENVAKDTDDIVLTTVHPYLSPISMVVPTQL
FT                   VAYFATLHRGLDVDKPRNLAKSVTVE"
FT   gene            241697..242746
FT                   /locus_tag="SP_0267"
FT   CDS             241697..242746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0267"
FT                   /product="putative oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74445"
FT                   /protein_id="AAK74445.1"
FT                   /translation="MVELGISTFGEITELEGTGQTYSHAERIRQLVAEIELADKVGLDV
FT                   YGIGEHHRADFAVSAPEIVLAAGAVNTKKIRLTSAVSILSSMDPIRLFQQYATIDALSN
FT                   GRSEIMAGRGSFTESFPLFGYDLKDYDSLFDEKLDLLQLVNEKTKLDWQGRLTQTIAGK
FT                   EVYPRPVQDKLPLWIATGGHVESTVKIAQAGLPIVYAIIGGNPRYFKKLIQAYREIGSE
FT                   AGHADKDLKVGAHSWGWIAEDGEQAVKDYFHPTKQVVDAISKDRPHWQELRYEQYLEQV
FT                   GPNGAMFVGNPDQVAEKLIRMIEDLGLDRFMLHLPLGSMPHDQVLRAIELFGTQVAPKV
FT                   RAYFAMKEA"
FT   gene            complement(242846..246688)
FT                   /locus_tag="SP_0268"
FT   CDS             complement(242846..246688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0268"
FT                   /product="putative alkaline amylopullulanase"
FT                   /note="identified by similarity to EGAD:154567; match to
FT                   protein family HMM PF00128; match to protein family HMM
FT                   PF00746; match to protein family HMM PF02922; match to
FT                   protein family HMM PF03714; match to protein family HMM
FT                   PF04650; match to protein family HMM TIGR01167; match to
FT                   protein family HMM TIGR01168; match to protein family HMM
FT                   TIGR02102"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74446"
FT                   /protein_id="AAK74446.1"
FT                   /translation="MRKTPSHTEKKMVYSIRSLKNGTGSVLIGASLVLLAMATPTISSD
FT                   ESTPTTNEPNNRNTTTLAQPLTDTAAGSGKNESDISSPGNANASLEKTEEKPAASPADP
FT                   APQTGQDRSSEPTTSTSPVTTETKAEEPIEDNYFRIHVKKLPEENKDAQGLWTWDDVEK
FT                   PSENWPNGALSFKDAKKDDYGYYLDVKLKGEQAKKISFLINNTAGKNLTGDKSVEKLVP
FT                   KMNEAWLDQDYKVFSYEPQPAGTVRVNYYRTDGNYDKKSLWYWGDVKNPSSAQWPDGTD
FT                   FTATGKYGRYIDIPLNEAAREFGFLLLDESKQGDDVKIRKENYKFTDLKNHSQIFLKDD
FT                   DESIYTNPYYVHDIRMTGAQHVGTSSIESSFSTLVGAKKEDILKHSNITNHLGNKVTIT
FT                   DVAIDEAGKKVTYSGDFSDTKHPYTVSYNSDQFTTKTSWRLKDETYSYDGKLGADLKEE
FT                   GKQVDLTLWSPSADKVSVVVYDKNDPDKVVGTVALEKGERGTWKQTLDSTNKLGITDFT
FT                   GYYYQYQIERQGKTVLALDPYAKSLAAWNSDDSKIDDAHKVAKAAFVDPAKLGPQDLTY
FT                   GKIHNFKTREDAVIYEAHVRDFTSDPAIAKDLTKPFGTFEAFIEKLDYLKDLGVTHIQL
FT                   LPVLSYYFVNELKNHERLSDYASSNSNYNWGYDPQNYFSLTGMYSSDPKNPEKRIAEFK
FT                   NLINEIHKRGMGAILDVVYNHTAKVDLFEDLEPNYYHFMDADGTPRTSFGGGRLGTTHH
FT                   MTKRLLIDSIKYLVDTYKVDGFRFDMMGDHDAASIEEAYKAARALNPNLIMLGEGWRTY
FT                   AGDENMPTKAADQDWMKHTDTVAVFSDDIRNNLKSGYPNEGQPAFITGGKRDVNTIFKN
FT                   LIAQPTNFEADSPGDVIQYIAAHDNLTLFDIIAQSIKKDPSKAENYAEIHRRLRLGNLM
FT                   VLTAQGTPFIHSGQEYGRTKQFRDPAYKTPVAEDKVPNKSHLLRDKDGNPFDYPYFIHD
FT                   SYDSSDAVNKFDWTKATDGKAYPENVKSRDYMKGLIALRQSTDAFRLKSLQDIKDRVHL
FT                   ITVPGQNGVEKEDVVIGYQITAPNGDIYAVFVNADEKAREFNLGTAFAHLRNAEVLADE
FT                   NQAGPVGIANPKGLEWTEKGLKLNALTATVLRVSQNGTSHESTAEEKPDSTPSKPEHQN
FT                   EASHPAHQDPAPEARPDSTKPDAKVADAENKPSQATADSQAEQPAQEAQASSVKEAVRN
FT                   ESVENSSKENIPATPDKQAELPNTGIKNENKLLFAGISLLALLGLGFLLKNKKEN"
FT   gene            246875..246970
FT                   /locus_tag="SP_0269"
FT   CDS             246875..246970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0269"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74447"
FT                   /protein_id="AAK74447.1"
FT                   /translation="MFSAIFIQKLISNITNKKEKYLDKQGKILLQ"
FT   gene            247026..247118
FT                   /locus_tag="SP_0270"
FT   CDS             247026..247118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0270"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74448"
FT                   /protein_id="AAK74448.1"
FT                   /translation="MLQKYTQMISVTKCIITKNKKTQENVDAYN"
FT   gene            247105..247518
FT                   /gene="rpsL"
FT                   /locus_tag="SP_0271"
FT   CDS             247105..247518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SP_0271"
FT                   /product="ribosomal protein S12"
FT                   /note="identified by match to protein family HMM PF00164;
FT                   match to protein family HMM TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74449"
FT                   /db_xref="GOA:P0A4A7"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4A7"
FT                   /protein_id="AAK74449.1"
FT                   /translation="MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLP
FT                   GVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA"
FT   gene            247538..248008
FT                   /gene="rpsG"
FT                   /locus_tag="SP_0272"
FT   CDS             247538..248008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SP_0272"
FT                   /product="ribosomal protein S7"
FT                   /note="identified by match to protein family HMM PF00177;
FT                   match to protein family HMM TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74450"
FT                   /db_xref="GOA:Q97SQ4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SQ4"
FT                   /protein_id="AAK74450.1"
FT                   /translation="MSRKNRAPKRDVLPDPLYNSQLVTRLINRVMLDGKRGTAASIVYG
FT                   AFEQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVKVRPERRTTLGLRWL
FT                   VTIARLRGEHTMQDRLAKEILDAANNTGAAVKKREDTHRMAEANRAFAHFRW"
FT   gene            248433..250514
FT                   /gene="fusA"
FT                   /locus_tag="SP_0273"
FT   CDS             248433..250514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="SP_0273"
FT                   /product="translation elongation factor G"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF03764;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74451"
FT                   /db_xref="GOA:P64022"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64022"
FT                   /protein_id="AAK74451.1"
FT                   /translation="MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAHPIQ
FT                   LPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLDQAQEYREKLIEAVAETD
FT                   EELMMKYLEGEEITNEELKAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSP
FT                   LDIPAIKGINPDTDAEEIRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLQSGSYV
FT                   LNTSKGKRERIGRILQMHANSRQEIDTVYSGDIAAAVGLKDTTTGDSLTDEKAKIILES
FT                   INVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVISGMGELHLD
FT                   VLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPMVDVKAKLYDGSYHDVDSS
FT                   ETAFKIAASLSLKEAAKSAQPAILEPMMLVTITVPEENLGDVMGHVTARRGRVDGMEAH
FT                   GNSQIVRAYVPLAEMFGYATVLRSASQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGED"
FT   gene            250618..255009
FT                   /locus_tag="SP_0274"
FT   CDS             250618..255009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0274"
FT                   /product="DNA polymerase III, alpha subunit, Gram-positive
FT                   type"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to EGAD:14601; match to
FT                   protein family HMM PF00929; match to protein family HMM
FT                   PF01336; match to protein family HMM PF02231; match to
FT                   protein family HMM PF02811; match to protein family HMM
FT                   PF07733; match to protein family HMM TIGR00573; match to
FT                   protein family HMM TIGR01405"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74452"
FT                   /db_xref="GOA:Q97SQ2"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR006308"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR024754"
FT                   /db_xref="InterPro:IPR028112"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SQ2"
FT                   /protein_id="AAK74452.1"
FT                   /translation="MSNSFEILMNQLGMPAEMRQAPALAQANIERVVVHKISKVWEFHF
FT                   VFSNILPIEIFLELKKGLSEEFSKTGNKAVFEIKARSQEFSNQLLQSYYREAFSEGPCA
FT                   SQGFKSLYQNLQVRAEGNQLFIEGSEAIDKEHFKKNHLPNLAKQLEKFGFPTFNCQVEK
FT                   NDVLTQEQEEAFHAENEQIVQAANEEALRAMEQLEQMAPPPAEEKPAFDFQAKKAAAKP
FT                   KLDKAEITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVK
FT                   NEEEAQKFDLIKKNSWLRVRGNVEMNNFTRDLTMNVQDLQEVVHYERKDLMPEGERRVE
FT                   FHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKKAGIQLIYG
FT                   MEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAE
FT                   FDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNATFDVGF
FT                   MNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALEHHHMANYDAEA
FT                   TGRLLFIFIKEVAEKHGVTDLARLNIDLISPDSYKKARIKHATIYVKNQVGLKNIFKLV
FT                   SLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAKYYDFI
FT                   EVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYRE
FT                   IIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEELARKLVIENTN
FT                   ALAEIFESVEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSI
FT                   LGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQ
FT                   YSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGED
FT                   QPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKFYRDAEVERLAQGAA
FT                   GVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVL
FT                   GHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGTPTGMLGIPEFG
FT                   TNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMV
FT                   YLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMF
FT                   PKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISE
FT                   KRKNNEASNVEIDLYTTLEIVNEMWERGFKFGKLDLYCSQATEFLIDGDTLIPPFVAMD
FT                   GLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFDE
FT                   LF"
FT   gene            255111..255374
FT                   /locus_tag="SP_0275"
FT   CDS             255111..255374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:29477; match to
FT                   protein family HMM PF04221; match to protein family HMM
FT                   TIGR02384"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74453"
FT                   /protein_id="AAK74453.1"
FT                   /translation="MSKMSISIRLDSEVKEQAQQVFSNLGMDMTTAINIFLRQAIQYQG
FT                   LPFDVRLDENRKLLQALTDLDQNRNMSQSFESVSDLMEDLRA"
FT   gene            255367..255645
FT                   /locus_tag="SP_0276"
FT   CDS             255367..255645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:166151; match to
FT                   protein family HMM PF05016; match to protein family HMM
FT                   TIGR02385"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74454"
FT                   /protein_id="AAK74454.1"
FT                   /translation="MLKIRYHKQFKKDFKLAMKRGLKAELLEEVLNFLVQEKEHPARNR
FT                   DHSLTASKHFQGVRECHTQPDWLLVYKVDKSELILNLLRTGSHSDLF"
FT   gene            255666..255818
FT                   /locus_tag="SP_0277"
FT   CDS             255666..255818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0277"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74455"
FT                   /protein_id="AAK74455.1"
FT                   /translation="MKLRIFAEDKPAKKVFEYQLELADRTILLSTALLSGAIALAGIFS
FT                   ALKEK"
FT   gene            255840..257081
FT                   /gene="pepS"
FT                   /locus_tag="SP_0278"
FT   CDS             255840..257081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepS"
FT                   /locus_tag="SP_0278"
FT                   /product="aminopeptidase PepS"
FT                   /EC_number="3.4.11.-"
FT                   /note="identified by similarity to SP:Q9X4A7; match to
FT                   protein family HMM PF02073"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74456"
FT                   /protein_id="AAK74456.1"
FT                   /translation="MVLPNFKENLEKYAKLLVANGINVQPGHTLALSIDVEQRELAHLI
FT                   VKEAYALGAHEVIVQWTDDVINREKFLHAPMERLDNVPEYKIAEMNYLLENKASRLGVR
FT                   SSDPGALNGVDADKLSASAKAMGLAMKPMRIATQSNKVSWTVAAAAGLEWAKKVFPNAA
FT                   SDEEAVDFLWDQIFKTCRVYEADPVKAWEEHAAILKSKADMLNKEQFSALHYTAPGTDL
FT                   TLGLPKNHVWESAGAVNAQGEEFLPNMPTEEVFTAPDFRRADGYVTSTKPLSYNGNIIE
FT                   GIKVTFKDGQIVDITAEKGDQVMKDLVFENAGARALGECALVPDPSPISQSGITFFNTL
FT                   FDENASNHLAIGAAYATSVVDGAEMSEEELEAAGLNRSDVHVDFMIGSNQMDIDGIRED
FT                   GTRVPLFRNGNWAN"
FT   gene            257091..257321
FT                   /locus_tag="SP_0279"
FT   CDS             257091..257321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108076; match to
FT                   protein family HMM PF04226"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74457"
FT                   /protein_id="AAK74457.1"
FT                   /translation="MLGSMFVGLLVGFLAGAMTNRGERMGCFGKMFLGWIGAFLGHLLF
FT                   GTWGPVLSGTAIIPAILGAMIVLAIFWRRGS"
FT   gene            257589..258311
FT                   /gene="rsuA-1"
FT                   /locus_tag="SP_0280"
FT   CDS             257589..258311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA-1"
FT                   /locus_tag="SP_0280"
FT                   /product="ribosomal small subunit pseudouridine synthase A"
FT                   /note="identified by similarity to EGAD:9371; match to
FT                   protein family HMM PF00849; match to protein family HMM
FT                   PF01479; match to protein family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74458"
FT                   /protein_id="AAK74458.1"
FT                   /translation="MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKI
FT                   DEIRFDGQVLEYEEFVYYMMNKPKGVISATEDPKHRTVLDLLDDLARSKEVFPVGRLDI
FT                   DTHGLLLLTNDGQLAHVLLSPKRHVDKTYLAQVKGIMTQEDVETFAEGIPLKDFTCQPA
FT                   ILELVSIDTEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTMGTLVLDENLERG
FT                   EWRRLTKEELEILRANII"
FT   gene            258529..259863
FT                   /gene="pepC"
FT                   /locus_tag="SP_0281"
FT   CDS             258529..259863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC"
FT                   /locus_tag="SP_0281"
FT                   /product="aminopeptidase C"
FT                   /EC_number="3.4.22.-"
FT                   /note="identified by similarity to EGAD:22583; match to
FT                   protein family HMM PF03051"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74459"
FT                   /protein_id="AAK74459.1"
FT                   /translation="MNAIQESFTDKLFANYEANVKYQAIENAASHNGIFAALERRQSHV
FT                   DNTPVFSLDLTKDKVTNQKASGRCWMFAALNTFRHKLISQYKLENFELSQAHTFFWDKY
FT                   EKSNWFLEQVIATSDQELTSRKVSFLLQTPQQDGGQWDMVVSLFEKYGVVPKSVYPESV
FT                   SSSSSRELNAILNKLLRQDAQILRDLLVSGADQATVQAKKEDLLQEIFNFLAMSLGLPP
FT                   RKFDFAYRDKDNNYKSEKGITPQEFYKKYVNLPLEDYVSVINAPTADKPYGKSYTVEML
FT                   GNVVGSRAVRYINVPMERLKELAIAQMQAGETVWFGSDVGQLSNRKAGILATDVYDFES
FT                   SMDIKLTQDKAGRLDYSESLMTHAMVLTGVDLDENGKSTKWKVENSWGDKVGTDGYFVA
FT                   SDAWMDEYTYQIVVRKELLTAEEQAAYGAEPIVLAPWDPMGALAE"
FT   gene            complement(259919..260830)
FT                   /locus_tag="SP_0282"
FT   CDS             complement(259919..260830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0282"
FT                   /product="PTS system, mannose-specific IID component"
FT                   /note="identified by similarity to EGAD:91568; match to
FT                   protein family HMM PF03613; match to protein family HMM
FT                   TIGR00828"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74460"
FT                   /protein_id="AAK74460.1"
FT                   /translation="MTEKLQLTKSDRKKVWWRSTFLQGSWNFERMQNLGWAYTLIPAIK
FT                   KLYTKKEDQIAALERHLEFFNTHPYVAAPVMGVTLALEEERANGVEIDDAAIQGVKIGM
FT                   MGPLAGIGDPVFWFTVRPILGSLGASLALTGNILGPLLFFVAWNLIRMSFLWYVQEIGY
FT                   KAGSEITKDMSGGILQDITKGASILGMFILAVLVQRWVNIKFAFDVSKVQLDEKAYIHW
FT                   DKLPEGSKGIQEAFAQVGQGLSQTPEKVTTFQQNLDMLIPGLSGLLLTLLCMYLLKKKV
FT                   SPITIILALFAVGIVAHVLHIM"
FT   gene            complement(260854..261657)
FT                   /gene="manM"
FT                   /locus_tag="SP_0283"
FT   CDS             complement(260854..261657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manM"
FT                   /locus_tag="SP_0283"
FT                   /product="PTS system, mannose-specific IIC component"
FT                   /note="identified by similarity to EGAD:14386; match to
FT                   protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74461"
FT                   /protein_id="AAK74461.1"
FT                   /translation="MSIISMVLVVVVAFFAGLEGILDQFQFHQPLVACTLIGLVTGHLE
FT                   AGIILGGSLQMIALGWSNIGAAIAPDAALASVAAAIIMVLGGDFTKTGIGVAQAVAIPL
FT                   AVAGLFLTMIVRTISVGLVHTADAAAKKGDFGAVERAHFIALLFQGLRIALPAALLLMV
FT                   PTETVQSILSAMPDWLKDGMAIGGGMVVAVGYAMVINMMATREVWPFFALGFVLAAVSD
FT                   ITLIGFGAIGVAIALIYLHLSKTGGNGGGGAATSNDPIGDILEDY"
FT   gene            complement(261685..262683)
FT                   /gene="manL"
FT                   /locus_tag="SP_0284"
FT   CDS             complement(261685..262683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manL"
FT                   /locus_tag="SP_0284"
FT                   /product="PTS system, mannose-specific IIAB components"
FT                   /note="identified by similarity to GP:5669855; match to
FT                   protein family HMM PF03610; match to protein family HMM
FT                   PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74462"
FT                   /protein_id="AAK74462.1"
FT                   /translation="MTIMSIGIIIASHGEFAAGIHQSGSMIFGEQEKVQVVTFMPNEGP
FT                   DDLYAKFNNAVAAFDAEDEVLVLADLWSGSPFNQASRVMGENPERKFAIITGLNLPMLI
FT                   QAYTERLMDAAAGVEKVAANIIKEAKDGIKALPEELNPVEEVASAAAAPVAQTAIPEGT
FT                   VIGDGKLKINLARLDTRLLHGQVATAWTPDSKANRIIVASDNVAKDDLRKELIKQAAPG
FT                   NVKANVVPIQKLIEISKDPRFGETHALILFETPQDALRAIEGGVPIKTLNVGSMAHSTG
FT                   KTLVNTVLSMDKEDVATFEKMRDLGVEFDVRKVPNDSKKDLFDLINKANVK"
FT   gene            complement(262907..263926)
FT                   /locus_tag="SP_0285"
FT   CDS             complement(262907..263926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0285"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by similarity to EGAD:15881; match to
FT                   protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74463"
FT                   /protein_id="AAK74463.1"
FT                   /translation="MKAVVVNPESTGVAIEEKVLRPLETGEALVEVEYCGVCHTDLHVA
FT                   HGDFGQVPGRVLGHEGIGIVKEIAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRETLC
FT                   RTVKNAGYSVDGGMAEQCIVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAKVEPG
FT                   QWVVLYGAGGLGNLAVQYAKKVFNAHVIAVDINNDKLALAKEVGADIVINGLEVEDVAG
FT                   LIKEKTDGGAHSAVVTAVSKVAFNQAVDSIRAGGRVVAVGLPSEMMELSIVKTVLDGIQ
FT                   VIGSLVGTRKDLEEAFQFGAEGLVVPVVQKRPVEDAVAIFDEMEKGQIQGRMVLDFTH"
FT   gene            complement(264266..265078)
FT                   /locus_tag="SP_0286"
FT   CDS             complement(264266..265078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0286"
FT                   /product="Cof family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74464"
FT                   /protein_id="AAK74464.1"
FT                   /translation="MTKKIIAVDLDGTLLNSDSQISDFTKRTIKKVAEKGHQVIITTGR
FT                   PYRMSKDFYRELGLDTPMINFNGSLTHLPDQVWDFEKCLTVDKKYLLDMVQRSEDIQAD
FT                   FIAGEYRKKFYITNPNEEIANPKLFGVEAFQPEDQFQPELVTKDPNCILLQTRASDKYS
FT                   LAKEMNAFYQHQLSINTWGGPLNILECTPKGVNKAFALDYLLKIMNRDKKDLIAFGDEH
FT                   NDTEMLAFAGKGYAMKNANPELLPYADEQISLTNDQDGVAKTLQDLFL"
FT   gene            265214..266686
FT                   /locus_tag="SP_0287"
FT   CDS             265214..266686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0287"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74465"
FT                   /protein_id="AAK74465.1"
FT                   /translation="MINDIILLLFVKIKRRLMMDKLFKLKENGTDVRTEVLAGLTTFFA
FT                   MSYILFVNPQILSQTGMPAQGVFLATIIGAVAGTLMMAFYANLPYAQAPGMGLNAFFTF
FT                   TVVFGLGYSWQEALAMVFICGIISLIITLTNVRKMIIESIPNALRSAISAGIGVFLAYV
FT                   GIKNAGLLKFTIDPGNYTVVGEGADKAQATIAANSSAVPGLVSFNNPAVLVALAGLAIT
FT                   IFFVIKGIKGGIILSILTTTVLAIAVGLVDLSSIDFANNHVGAAFEDLKTIFGAALGSE
FT                   GLGALVSDTARLPETLMAILAFSLTDIFDTIGTLIGTGEKVGIVATNGENHQSAKLDKA
FT                   LYSDLIGTTVGAIAGTSNVTTYVESAAGIGAGGRTGLTALVVAICFAISSFFSPLLAIV
FT                   PTAATAPILIIVGIMMLGSLKNIHWDDMSEAVPAFFTSIFMGFSYSITQGIAVGFLTYT
FT                   LTKLVKGQVKDVHVMIWILDALFILNYISMAL"
FT   gene            266754..267446
FT                   /locus_tag="SP_0288"
FT   CDS             266754..267446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:6470197; match to
FT                   protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74466"
FT                   /protein_id="AAK74466.1"
FT                   /translation="MWKELLNRAGWILVFLLAVLLYQVPLVVTSILTLKEVALLQSGLI
FT                   VAGLSIVVLALFIMGARKTKLASFNFSFFRAKDLARLGLSYLVIVGSNILGSILLQLSN
FT                   ETTTANQSQINDMVQNSSLISSFFLLALLAPICEEILCRGIVPKKIFRGKENLGFVVGT
FT                   IVFALLHQPSNLPSLLIYGGMSTVLSWTAYKTQRLEMSILLHMIVNGIAFCLLALVVIM
FT                   SRTLGISV"
FT   gene            267571..268515
FT                   /locus_tag="SP_0289"
FT   CDS             267571..268515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0289"
FT                   /product="dihydropteroate synthase"
FT                   /note="identified by similarity to EGAD:29516; match to
FT                   protein family HMM PF00809; match to protein family HMM
FT                   TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74467"
FT                   /db_xref="GOA:P05382"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05382"
FT                   /protein_id="AAK74467.1"
FT                   /translation="MSSKANHAKTVICGIINVTPDSFSDGGQFFALEQALQQARKLIAE
FT                   GASMLDIGGESTRPGSSYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAA
FT                   GADLVNDITGLMGDEKMAYVVAEARAKVVIMFNPVMARPQHPSSLIFPHFGFGQTFTEK
FT                   ELADFETLPIEDLMVAFFERALARAAEAGIAPENILLDPGIGFGLTKKENLLLLRDLDK
FT                   LHQKGYPIFLGVSRKRFVINILEENGFEVNPETELGFRNRDTASAHVTSIAARQGVEVV
FT                   RVHDVASHRMAVEIASAIRLADEAENLDLKQYK"
FT   gene            268517..269839
FT                   /gene="folC"
FT                   /locus_tag="SP_0290"
FT   CDS             268517..269839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="SP_0290"
FT                   /product="dihydrofolate synthetase"
FT                   /EC_number="6.3.2.17"
FT                   /note="identified by similarity to EGAD:42028; match to
FT                   protein family HMM PF01225; match to protein family HMM
FT                   PF02875; match to protein family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74468"
FT                   /protein_id="AAK74468.1"
FT                   /translation="MKEIENNQWIANYRTDQPHFGLERMVELLALRGNPHLKLKVLHIG
FT                   GTNGKGSTIAFLKKMLEKLGLRVGVFSSPYLIHYTDQISINGESISEARLEALMADYQS
FT                   LLEGEAVANLQGTTEFEIITALAYDYFASEQVDVAIMEVGMGGLLDSTNVCQPILTGIT
FT                   TIGLDHVALLGDTLEVIAEQKAGIIKQGMPLVTGRIAPEALAVIDRIAEGKDAPRLAYG
FT                   TDYQVRHQESVVTGEVFDYTSAVRQGRFQTSLLGLYQIENAGMAIALLDTFCQEDGREL
FT                   ASNDFLGQALEETSWPGRLEIVSRDPLMILDGAHNPHAIKALLVTLQERFADYHKEILF
FT                   TCIKTKALEDMLDLLGAMPVTELTLTHFADSRATDENVLKEAAKSRNLSYQDWHDFLEQ
FT                   NLTDKKEEKQTVRIVTGSLYFLSQVRAYLMERKNENGYTKD"
FT   gene            269820..270374
FT                   /gene="folE"
FT                   /locus_tag="SP_0291"
FT   CDS             269820..270374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="SP_0291"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by similarity to EGAD:42029; match to
FT                   protein family HMM PF01227; match to protein family HMM
FT                   TIGR00063"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74469"
FT                   /db_xref="GOA:P51595"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51595"
FT                   /protein_id="AAK74469.1"
FT                   /translation="MDTQKIEAAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLG
FT                   QTAEEHLSKSFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLAR
FT                   TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTV
FT                   ARGLFETDKDLRDQAYRLMGL"
FT   gene            270417..271229
FT                   /gene="sulD"
FT                   /locus_tag="SP_0292"
FT   CDS             270417..271229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sulD"
FT                   /locus_tag="SP_0292"
FT                   /product="bifunctional folate synthesis protein"
FT                   /note="identified by similarity to SP:P22291; match to
FT                   protein family HMM PF01288; match to protein family HMM
FT                   PF02152; match to protein family HMM TIGR00525; match to
FT                   protein family HMM TIGR00526; match to protein family HMM
FT                   TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74470"
FT                   /db_xref="GOA:P22291"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22291"
FT                   /protein_id="AAK74470.1"
FT                   /translation="MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDL
FT                   DLTASVHYGELCQQWTTWFQETSEDLIETVAYKLVERTFEFYPLVQEMKLELKKPWAPV
FT                   HLSLDTCSVTIHRRKQRAFIALGSNMGDKQANLKQAIDKLRARGIHILKESSVLATEPW
FT                   GGVEQDSFANQVVEVETWLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQI
FT                   LYTDDLILPHPYIAERLFVLESLQEIAPHFIHPILKQPIRNLYDALKK"
FT   gene            complement(271379..271750)
FT                   /locus_tag="SP_0293"
FT   CDS             complement(271379..271750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0293"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74471"
FT                   /protein_id="AAK74471.1"
FT                   /translation="MIFNPICCMIREKKGDRDMAFTNTHMRSASFGIVTSLPDDIIDSF
FT                   WYIIDHFLKNVFELEEELEFQLLNNQGKITFHFSSQHLPTAIDFDFNHPFDPRYPPRVL
FT                   VLDMDGRETILLPEENDLF"
FT   gene            272052..272498
FT                   /gene="rplM"
FT                   /locus_tag="SP_0294"
FT   CDS             272052..272498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="SP_0294"
FT                   /product="ribosomal protein L13"
FT                   /note="identified by similarity to EGAD:7868; match to
FT                   protein family HMM PF00572; match to protein family HMM
FT                   TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74472"
FT                   /protein_id="AAK74472.1"
FT                   /translation="MNKTTFMAKPGQVERKWYVVDATDVPLGRLSAVVASVLRGKNKPT
FT                   FTPHTDTGDFVIVINAEKVKLTGKKATDKIYYTHSNHPGGLKQISAGELRSKNAVRLIE
FT                   KSVKGMLPHNTLGRAQGMKLKVFVGAEHTHAAQQPEVLDISGLI"
FT   gene            272517..272909
FT                   /gene="rpsI"
FT                   /locus_tag="SP_0295"
FT   CDS             272517..272909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="SP_0295"
FT                   /product="ribosomal protein S9"
FT                   /note="identified by similarity to EGAD:12856; match to
FT                   protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74473"
FT                   /db_xref="GOA:Q97SN4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SN4"
FT                   /protein_id="AAK74473.1"
FT                   /translation="MSQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLR
FT                   LVINQPFAVTSTVGSYDVFVNVIGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLL
FT                   TRDSRKVERKKPGLKKARKASQFSKR"
FT   gene            complement(273172..273303)
FT                   /locus_tag="SP_0296"
FT   CDS             complement(273172..273303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0296"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74474"
FT                   /protein_id="AAK74474.1"
FT                   /translation="MSLEAISEALTHSDTVTTKTYVNTSNIVPLSAGQVAYQHLKNK"
FT   gene            complement(273502..273651)
FT                   /locus_tag="SP_0297"
FT   CDS             complement(273502..273651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0297"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74475"
FT                   /protein_id="AAK74475.1"
FT                   /translation="MNNLDNMRFIMEIFASFSPEIELLLSYFSLFLMIYFNFLPLGKNN
FT                   KDMN"
FT   gene            complement(273953..275161)
FT                   /locus_tag="SP_0298"
FT   CDS             complement(273953..275161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0298"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74476"
FT                   /protein_id="AAK74476.1"
FT                   /translation="MNYIKRPHYLDFLRKHRDRPIIKVVSGVRRAGKSVLFQLYKEELL
FT                   ATGVDEDQIIFINFEDLSYYDLRHFQTLFAYIKDQLVSKKTYYIFLDEIQYVEKFELVA
FT                   DSLFILANVDLYLTGSNAYFMSSQLATNLTGRYVEIEVLPLSFEEYLSGQSLTENLNTT
FT                   EIFNNYLFSAFPYLLQTSSYDEKIDYLRGIYNSILLNDIVTRLGKPNPTIIERIVRTLL
FT                   SSTGSLISTNKIRNTLVSQNVSISHNTLENYLTTLTDSLLFYSVPRFDVKGRALLQRLE
FT                   KYYPVDLGLRHLLLPDQKEDIRHILENMVYLELRRRYSQVYVGNLDKYEVDFVVVTDLG
FT                   HYAYYQVSETTLAPETLERELRPLEAIKDQFPKYLLTMDTIQPTANYNGIEKKSIIDWL
FT                   LEK"
FT   gene            275290..275637
FT                   /locus_tag="SP_0299"
FT   CDS             275290..275637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0299"
FT                   /product="IS630-Spn1, transposase Orf1"
FT                   /note="identified by similarity to GP:5019554; match to
FT                   protein family HMM PF01710"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74477"
FT                   /protein_id="AAK74477.1"
FT                   /translation="MWYNLLMAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWL
FT                   KLKEKTGELNHQVKGTKPRKVDRDRLKNYLTDNPDAYLTEIASEFGCHPTTIHYALKAM
FT                   GYTRKKEPHLL"
FT   gene            275816..276154
FT                   /locus_tag="SP_0300"
FT   CDS             275816..276154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0300"
FT                   /product="IS630-Spn1, transposase Orf2"
FT                   /note="identified by similarity to GP:5019553"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74478"
FT                   /protein_id="AAK74478.1"
FT                   /translation="MVAGLTNGELIAPMTYEETMTSDFFEAWFQKFLLPTLTTPSVIIM
FT                   DNARFHRMGKLELLCEEFGYKLLPLPPYSPEYNPIEKTWAHIKKHLKKVLPSCNTFYEA
FT                   LLSCSCFN"
FT   gene            276142..276234
FT                   /locus_tag="SP_0301"
FT   CDS             276142..276234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0301"
FT                   /product="glycosyl hydrolase, family 1, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75786"
FT                   /protein_id="ABC75786.1"
FT                   /translation="MFQLTINRYKKKSFYWYKEVIESNGETLDN"
FT   gene            276283..276648
FT                   /locus_tag="SP_0302"
FT   CDS             276283..276648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0302"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:9658050; match to
FT                   protein family HMM PF03992"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74479"
FT                   /protein_id="AAK74479.1"
FT                   /translation="MKDDFGGYKMTLTIHVYYKGDGDSAIKFAREMLDSGLVKEIRNQK
FT                   GNLKYEYFLPIEKEGTILLIDQWINQETLDKHYQSKTMQKILDLRKKYHLQMQVERYIE
FT                   DDSGMPESDKSFIDTGN"
FT   gene            276838..278274
FT                   /gene="bglA-1"
FT                   /locus_tag="SP_0303"
FT   CDS             276838..278274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA-1"
FT                   /locus_tag="SP_0303"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /note="identified by similarity to EGAD:36677; match to
FT                   protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74480"
FT                   /protein_id="AAK74480.1"
FT                   /translation="MTTFKDGFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVAR
FT                   EITLGVLEGKYYPNHEAIDFYHRYKEDIALFAEMGFKCFRTSIAWTRIFPKGDELEPNE
FT                   EGLQFYDNLFDECLKNGIEPVITLSHFEMPYHLVTEYGGWKNRKLIDFFARFAEVVFKR
FT                   YKDKVKYWMTFNEINNQANYQEDFAPFTNSGIVYEEGDNREAIMYQAAHYELVASARAV
FT                   KIGHEINPDFQIGCMIAMCPIYPVTCNPKDILMAMKAMQKRYYFADVHVLGKYPEHIFK
FT                   YWERKGISVDFTAQDKEDLLGGTVDYIGFSYYMSFAIDSHRENNPYFDYLETEDLVKNN
FT                   YVKASEWEWQIDPEGLRYALNWFTDHYHLPLFIVENGFGAIDQVAADGMVHDDYRIEYL
FT                   GAHIREMKKAVVEDGVDLMGYTPWGCIDLVSAGTGEMRKRYGFIYVDKDDNGKGSYNRS
FT                   PKKSFGWYKEVISSNGESVE"
FT   gene            278326..278565
FT                   /locus_tag="SP_0304"
FT   CDS             278326..278565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:45124"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74481"
FT                   /protein_id="AAK74481.1"
FT                   /translation="MIGSIAAILTTFAFLPQVFRVVKTKDTGSIALGMYVMQVIGIALW
FT                   LAHGIRIGDLPLILANSVSFLLSGIILFYKLKYK"
FT   gene            278695..279009
FT                   /locus_tag="SP_0305"
FT   CDS             278695..279009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0305"
FT                   /product="PTS system, IIB component"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74482"
FT                   /protein_id="AAK74482.1"
FT                   /translation="MAKALIICAAGMSSSLMAQKTTEFLKGKGKDIVVDAISATEGGKA
FT                   IAAAAFDLYLVSPQTKMYFKQFEEAGSKAGKPVVQIPPQAYIPIPMGIEKMANLILENI
FT                   "
FT   gene            279127..280608
FT                   /locus_tag="SP_0306"
FT   CDS             279127..280608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0306"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by similarity to EGAD:30181; match to
FT                   protein family HMM PF00874"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74483"
FT                   /protein_id="AAK74483.1"
FT                   /translation="MNVLNIKEKDILQFLIKNKERFVTSKELAEYLSCSDRTVRNVLKL
FT                   IEKTMIIQGVRLISKQGQGYQIFFENQGAYQEFRQTYELEEDYTKTAVSKGDDRLVFIL
FT                   NKLLFEQVPVLFDDLADELYVSRSTLSHDFRKIRVMLSEYNLSIESRANKGVYVSGEER
FT                   DKRRFIINYFLENQFFKTIHCYVKFNFFDQTVPLEEFARIVLDECQEANLKLSDFVLQN
FT                   LVVHIALSVIRLKSGFEIKNIDCQMTDDAIERKVAQRILSKVREVTNQEFPVQEIDYIT
FT                   LHLLAKSQQCQKNQKNISEEVLKKSLFKTFQNLGLDDMYNFSSDFQLIEGLITHLMTLQ
FT                   VRLESRITLNNPLVDEIKQNYSDIFFMTREILANMDKFLEWTISDDEVAYVSLHFLAAM
FT                   ERSKESTKFNILAICATGFGAAQMLRNRLETEFGKRVEVVDVIGYYELNQEKLKGIDFI
FT                   VSAIDLSNLYFQIPVFKVSVFLKSDEMEMIRKAMD"
FT   gene            280609..281106
FT                   /locus_tag="SP_0307"
FT   CDS             280609..281106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0307"
FT                   /product="PTS system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74484"
FT                   /protein_id="AAK74484.1"
FT                   /translation="MQVSSYVQSSKINKFENNGFRQYFSKENFLICTESDKVNLLEKMV
FT                   ESLSVGESNEFEQSLLYGIKQREELSSVVFSEKIAVPHPIQPFGTEGKVSVAICKDSLL
FT                   WDNQSSHVQLVFLLSPSIYGNEGLATVTKKIVSLTENDELQNQLISCNNFEDFINIFEK
FT                   IK"
FT   gene            281116..281430
FT                   /locus_tag="SP_0308"
FT   CDS             281116..281430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0308"
FT                   /product="PTS system, IIA component"
FT                   /note="identified by match to protein family HMM PF02255"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74485"
FT                   /protein_id="AAK74485.1"
FT                   /translation="MNQEELQVAAFEIILHSGNARSEIHEAFAKMREGSFDDAESKLNQ
FT                   SNEIILEAHHAQTKLLQEYASGVEIKIEIIMVHAQDHLMTTMTLLEVAKEMLALYKKVN
FT                   "
FT   gene            281461..281967
FT                   /locus_tag="SP_0309"
FT   CDS             281461..281967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0309"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74486"
FT                   /protein_id="AAK74486.1"
FT                   /translation="MDKKERQKIEQQRREMALTNTFFNRYLLLRYSIALFFFGNIYWLL
FT                   SQFISPSPIIIFPIMLIVFSILATVEQFKLYGNRKEKLGITLMFVRIQMLISIGLLVLT
FT                   WTSWFKNLFPIFENNQVARLFVFVVLLLGLVLSLLDIRRIKKIYKRTDKAYQQFVQLEK
FT                   NSLSL"
FT   gene            282047..283393
FT                   /locus_tag="SP_0310"
FT   CDS             282047..283393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0310"
FT                   /product="PTS system, IIC component"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74487"
FT                   /protein_id="AAK74487.1"
FT                   /translation="MDQQNGLFGFLENHVMGPMGKLAQFKVVRAITAAGMAAVPFTIVG
FT                   SMFLVFSILPQAFSFWPIVADIFSASFDKFTSLYMVANYATMGSLSLYFVLSLAYELTK
FT                   IYAEEEELNMNPLNGALLALMAFVMTVPQIIFDGGMMKTVTSLKEGAVIADGWAMGNVV
FT                   ARFGTTGIFTAIIMAIVTVLIYRMCVKHNWVIKMPEAVPEGVSRGFTALVPGFVVAFVV
FT                   IFINGLLVAMGTDIFKVIAIPFGFVSNLTNSWIGLMIIYLLTQLLWIVGIHGANIVFAF
FT                   VSPIALANMAENAAGGHFAVAGEFSNMFVIAGGSGATLGLCLYIAFASKSEQLKAIGRA
FT                   SVVPALFNINEPLIFGLPIIYNPALAIPFILAPMVTATIYYVANSLNFIKPIIAQVPWP
FT                   TPVGIGAFLGTADLRAVLVALVCAFAAFLVYLPFIRVYDQKLVKEEQGI"
FT   gene            283772..283948
FT                   /locus_tag="SP_0311"
FT   CDS             283772..283948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74488"
FT                   /protein_id="AAK74488.1"
FT                   /translation="MSLDIDKEKMTIMGIAFENRSVFKSVWYALSTNMIEGWRPTVSDV
FT                   EKLRDEALALGMT"
FT   gene            284523..286562
FT                   /locus_tag="SP_0312"
FT   CDS             284523..286562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0312"
FT                   /product="glycosyl hydrolase, family 31"
FT                   /note="identified by match to protein family HMM PF01055"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74489"
FT                   /protein_id="AAK74489.1"
FT                   /translation="MTDYFHLHFNKGEFNAENLFIELKGNFAVYGSRWYFGESIETLKG
FT                   TARTLDKADGAISLEDGIISRNGIALLDDSQGFIWDEQSGYIERENQIDLYFFAYGHDY
FT                   RGAIRDFYHLTGSTPLLPRYALGNWWSRYWPYTSDEYLDLIDRFETEKIPLSIGVLDMD
FT                   WHITDIPARFGSGWTGYSWNRNLIPNPEQLLQQLHDRKLKLSLNVHPADGIRAYEEAYP
FT                   QIAKRLGLNVELEEPAIFDFFNPSFREAYFKDVHYELEKQGVDFWWIDWQQGTQGMLDP
FT                   LWLLNHYHYQDSCKNAEGGLILSRYAGPGSHRYPVGFSGDTIISWNSLRFQPYFTATAS
FT                   NIGYSWWSHDIGGHMLGDYDEELQTRWLQFGVFSPITRLHSSRSPFNSKEPWFFSETTS
FT                   KIMKKYLRLRHQMIPYLYTMNVQTHEEGAPLISPIYYFYPENDESYNVPNQYFFGTELM
FT                   VAPIVEKMDLTFQSAKVDVWFPEGEWYDFFSEKKYTGGVKLSVYRDISTTPVFAKSGAI
FT                   IPLVGSEIGMGVDLPEVVDWYVFPGKQHSFEMLEDQNGQRYKTRLSIDWEMGMVELALQ
FT                   GDSSIVPSNRKHRIHFKGTNVSIIELPNKNDTAKFEWKDNKRTSLNDEVFRLLKTASLP
FT                   YELKDRLLNQFINAKNSHDLMNILHHQDKELRGRLLEMIFTSQN"
FT   gene            complement(286784..287260)
FT                   /locus_tag="SP_0313"
FT   CDS             complement(286784..287260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0313"
FT                   /product="glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="identified by match to protein family HMM PF00255"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74490"
FT                   /protein_id="AAK74490.1"
FT                   /translation="MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQGL
FT                   QELYERYQDQGFEILDFPCNQFMGQAPGSAEEINAFCSLHFQTTFPRFAKIKVNGKEAD
FT                   PLYVWLQDQKSGPLGKRVEWNFAKFLIGRDGQVFERFSSKTDPKQIEEAIQTLL"
FT   gene            287483..290683
FT                   /locus_tag="SP_0314"
FT   CDS             287483..290683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0314"
FT                   /product="hyaluronidase"
FT                   /EC_number="4.2.2.1"
FT                   /note="identified by similarity to EGAD:23003; match to
FT                   protein family HMM PF00746; match to protein family HMM
FT                   PF02018; match to protein family HMM PF02278; match to
FT                   protein family HMM PF02884; match to protein family HMM
FT                   PF08124; match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74491"
FT                   /db_xref="GOA:Q54873"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012329"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR023295"
FT                   /db_xref="PDB:1C82"
FT                   /db_xref="PDB:1EGU"
FT                   /db_xref="PDB:1F9G"
FT                   /db_xref="PDB:1LOH"
FT                   /db_xref="PDB:1LXK"
FT                   /db_xref="PDB:1N7N"
FT                   /db_xref="PDB:1N7O"
FT                   /db_xref="PDB:1N7P"
FT                   /db_xref="PDB:1N7Q"
FT                   /db_xref="PDB:1N7R"
FT                   /db_xref="PDB:1OJM"
FT                   /db_xref="PDB:1OJN"
FT                   /db_xref="PDB:1OJO"
FT                   /db_xref="PDB:1OJP"
FT                   /db_xref="PDB:1W3Y"
FT                   /db_xref="PDB:2BRP"
FT                   /db_xref="PDB:2BRV"
FT                   /db_xref="PDB:2BRW"
FT                   /db_xref="PDB:4D0Q"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q54873"
FT                   /protein_id="AAK74491.1"
FT                   /translation="MQTKTKKLIVSLSSLVLSGFLLNHYMTIGAEETTTNTIQQSQKEV
FT                   QYQQRDTKNLVENGDFGQTEDGSSPWTGSKAQGWSAWVDQKNSADASTRVIEAKDGAIT
FT                   ISSHEKLRAALHRMVPIEAKKKYKLRFKIKTDNKIGIAKVRIIEESGKDKRLWNSATTS
FT                   GTKDWQTIEADYSPTLDVDKIKLELFYETGTGTVSFKDIELVEVADQLSEDSQTDKQLE
FT                   EKIDLPIGKKHVFSLADYTYKVENPDVASVKNGILEPLKEGTTNVIVSKDGKEVKKIPL
FT                   KILASVKDAYTDRLDDWNGIIAGNQYYDSKNEQMAKLNQELEGKVADSLSSISSQADRT
FT                   YLWEKFSNYKTSANLTATYRKLEEMAKQVTNPSSRYYQDETVVRTVRDSMEWMHKHVYN
FT                   SEKSIVGNWWDYEIGTPRAINNTLSLMKEYFSDEEIKKYTDVIEKFVPDPEHFRKTTDN
FT                   PFKALGGNLVDMGRVKVIAGLLRKDDQEISSTIRSIEQVFKLVDQGEGFYQDGSYIDHT
FT                   NVAYTGAYGNVLIDGLSQLLPVIQKTKNPIDKDKMQTMYHWIDKSFAPLLVNGELMDMS
FT                   RGRSISRANSEGHVAAVEVLRGIHRIADMSEGETKQCLQSLVKTIVQSDSYYDVFKNLK
FT                   TYKDISLMQSLLSDAGVASVPRPSYLSAFNKMDKTAMYNAEKGFGFGLSLFSSRTLNYE
FT                   HMNKENKRGWYTSDGMFYLYNGDLSHYSDGYWPTVNPYKMPGTTETDAKRADSDTGKVL
FT                   PSAFVGTSKLDDANATATMDFTNWNQTLTAHKSWFMLKDKIAFLGSNIQNTSTDTAATT
FT                   IDQRKLESGNPYKVYVNDKEASLTEQEKDYPETQSVFLESFDSKKNIGYFFFKKSSISM
FT                   SKALQKGAWKDINEGQSDKEVENEFLTISQAHKQNRDSYGYMLIPNVDRATFNQMIKEL
FT                   ESSLIENNETLQSVYDAKQGVWGIVKYDDSVSTISNQFQVLKRGVYTIRKEGDEYKIAY
FT                   YNPETQESAPDQEVFKKLEQAAQPQVQNSKEKEKSEEEKNHSDQKNLPQTGEGQSILAS
FT                   LGFLLLGAFYLFRRGKNN"
FT   gene            291067..291687
FT                   /pseudo
FT                   /locus_tag="SP_0315"
FT                   /note="This gene is interrupted by an RUP element. L20670.1
FT                   GI:437704; IS200S, transposase, interruption; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to EGAD:14951"
FT   gene            complement(291700..291807)
FT                   /locus_tag="SP_0316"
FT   CDS             complement(291700..291807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0316"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74492"
FT                   /protein_id="AAK74492.1"
FT                   /translation="MVYLRAISPNHQPAPKDAGFHVVQALLLLTRHLPL"
FT   gene            complement(291831..292460)
FT                   /locus_tag="SP_0317"
FT   CDS             complement(291831..292460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0317"
FT                   /product="4-hydroxy-2-oxoglutarate
FT                   aldolase/2-dehydro-3-deoxyphosphogluconate aldolase"
FT                   /EC_number="4.1.3.16"
FT                   /note="identified by similarity to EGAD:37718; match to
FT                   protein family HMM PF01081; match to protein family HMM
FT                   TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74493"
FT                   /protein_id="AAK74493.1"
FT                   /translation="MTKSDTIIELKKQKIVAVIRGNTKEEGLQASIACIKGGIKAIEIA
FT                   YTNQYAGQIIKELVDLYQDDQSVCIGAGTVLDAVTARDAILAGANYVVSPSFHAETAKM
FT                   CNLYSTPYIPGCITLTEITTALEAGSEIIKLFPGSTLSPAYISAVKAPIPQVSVMVTGG
FT                   VGLNNIPQWFAAGADAVGIGGELNKLASQGNFDRISEIAQQYITLR"
FT   gene            complement(292470..293471)
FT                   /locus_tag="SP_0318"
FT   CDS             complement(292470..293471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0318"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74494"
FT                   /protein_id="AAK74494.1"
FT                   /translation="MTKILLFGEPLIRISPLDATSIGDHVASSTYFGGSEINIACNLQA
FT                   LGISTKVFTALPANEIGDRFLTFLKQHQIDTSSICRLGDRIGLYYLENGFGCRQSEVFY
FT                   DRKHTSISQIRPNMLDMDSLFQGISHFHFSGITVAIGQEVRAILLLLLEEAKRRGIVVS
FT                   MDLNLRTKMISVLEAKYEFSKFARFTDYCFGIDPLMIDDQNLEMFPRDSASLEEVENRM
FT                   RLLKEAYGFKAIFHTLRSSDEQDKNVYQAYALEELFEESVQLKTAVYQRIGSGDAFISG
FT                   ALYQLLHHSSLKTTIDFAVASATLKCTLPGDHLSTSSTSIENLLANAQDIIR"
FT   gene            complement(293502..294143)
FT                   /locus_tag="SP_0319"
FT   CDS             complement(293502..294143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0319"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:3282092; match to
FT                   protein family HMM PF06562"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74495"
FT                   /protein_id="AAK74495.1"
FT                   /translation="MKIALINENSQASKNHIIYDSLKEATDKKGYQLFNYGMRGEEGES
FT                   QLTYVQNGLMAAILLNTKAVDFVVTGCGTGVGAMLALNSFPGVVCGLAVDPTDAYLYSQ
FT                   INGGNALSIPYAKGFGWGAELTLKLMFERLFAEEMGGGYPRERVIPEQRNARILNEVKQ
FT                   ITHNDLMTILKIIDQDFLKDTISGKYFQEYFFENCQDDEVAAYLKEVLAK"
FT   gene            complement(294162..294977)
FT                   /locus_tag="SP_0320"
FT   CDS             complement(294162..294977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0320"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74496"
FT                   /protein_id="AAK74496.1"
FT                   /translation="MTNTSFSIEQFSLKGKIALITGASYGIGFAIAKSYAEAGATIVFN
FT                   DINQDLVNKGIEAYREVGIQAHGYVCDVTDEDGIQAMVKQIEQEVGVIDILVNNAGIIR
FT                   RVPMCEMSAADFRKVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSA
FT                   YAAAKGGLKMLTRNIASEYGGANIQCNGIGPGYIATPQTAPLRELQEDGSRHPFDQFII
FT                   AKTPAARWGNTEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGKQPE"
FT   gene            295248..295682
FT                   /locus_tag="SP_0321"
FT   CDS             295248..295682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0321"
FT                   /product="PTS system, IIA component"
FT                   /note="identified by similarity to EGAD:151768; match to
FT                   protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74497"
FT                   /protein_id="AAK74497.1"
FT                   /translation="MKIVLVGHGHFATGIYSSLQLIAGNQENVEAIDFVEGMSADELKQ
FT                   KILLAISNEEEVLILSDLLGGSPFKVSSTIMGENPAKTMNVLSGLNLAMLMEAVFARMA
FT                   HSFDEVVNKSVVAAQGGVVNGKELFSTDAEEEEEDFESGI"
FT   gene            295694..296884
FT                   /locus_tag="SP_0322"
FT   CDS             295694..296884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0322"
FT                   /product="glucuronyl hydrolase"
FT                   /note="identified by similarity to GP:5869507; match to
FT                   protein family HMM PF07470"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74498"
FT                   /protein_id="AAK74498.1"
FT                   /translation="MIKKVTIEKIKSPERFLEVPLLTKEEVGQAIDKVIRQLELNLDYF
FT                   KEDFPTPATFDNVYPIMDNTEWTNGFWTGELWLAYEYSQQDAFKNIAHKNVLSFLDRVN
FT                   KRVELDHHDLGFLYTPSCMAEYKINGDGEAREATLKAADKLIERYQEKGGFIQAWGDLG
FT                   KKEHYRLIIDCLLNIQLLFFAYQETGDQKYYDIAESHFYASANNVIRDDASSFHTFYFD
FT                   PETGQPFKGVTRQGYSDDSCWARGQSWGVYGIPLTYRHLKDESCFDLFKGVTNYFLNRL
FT                   PKDHVSYWDLIFNDGSDQSRDSSATAIAVCGIHEMLKHLPEVDADKDIYKHAMHAMLRS
FT                   LIEHYANDQFTPGGTSLLHGVYSWHSGKGVDEGNIWGDYYYLEALIRFYKDWNLYW"
FT   gene            296895..297386
FT                   /locus_tag="SP_0323"
FT   CDS             296895..297386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0323"
FT                   /product="PTS system, IIB component"
FT                   /note="identified by match to protein family HMM PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74499"
FT                   /protein_id="AAK74499.1"
FT                   /translation="MTMPNIIMTRIDERLIHGQGQLWVKYLGCNTVIVANDEVSTDKMQ
FT                   QTLMKTVVPDSVAMRFFPLQKVIDIIHKANPAQTIFIVVKDVKDALTLVEGGVTIKEIN
FT                   IGNIHNAPGKEQVTRSIFLGEEDKAALKELSQTHQVTFNTKTTPTGNDGAVQVNIMDYI
FT                   "
FT   gene            297401..298180
FT                   /locus_tag="SP_0324"
FT   CDS             297401..298180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0324"
FT                   /product="PTS system, IIC component"
FT                   /note="identified by match to protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74500"
FT                   /protein_id="AAK74500.1"
FT                   /translation="MSINVFQAILIGLWTAFCFSGMLLGIYTNRCIVLSFGVGIILGDL
FT                   PTALAMGAIGELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSAGKVSPEAALALSTPI
FT                   AVAIQFLQTFAYTVRAGAPETAMKHLKNHNLKKFKFTLNATIWLFAFIGFTLGCLGALS
FT                   MDTLLKLVDYIPPVLLTGLTVAGKMLPAIGFAMILSVMAKKELIPFVLLGYVCAAYLNI
FT                   PTIGIAIVGTIFALIEFYNKPKTADHVVEEEAHDDWI"
FT   gene            298167..298985
FT                   /locus_tag="SP_0325"
FT   CDS             298167..298985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0325"
FT                   /product="PTS system, IID component"
FT                   /note="identified by match to protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74501"
FT                   /protein_id="AAK74501.1"
FT                   /translation="MTGSNKLTKRDYLKTSLRAFFCQNGFNYSNYQGLGYANVMYPALK
FT                   KHYGEDQEGFYQALEENCEFYNTNPHFLPFITSLHLVMLENGRPAKETRSIKMALMGPL
FT                   AGIGDSLSQFCLAPLFSTIAASFAQEGLVVGPILFFLAMNTILTAIKLSTGLYGYKLGT
FT                   TVIDKLSEQMATISRIANIIGVTVIAGLAATSVKIMVPITFAAGEVKADAKQSIVSIQG
FT                   MLDKVAPALLPALFTLLVYYLIKEKKWTTYKLVILTVIIGIIGSWLKIIA"
FT   gene            298985..299278
FT                   /gene="yajC-1"
FT                   /locus_tag="SP_0326"
FT   CDS             298985..299278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC-1"
FT                   /locus_tag="SP_0326"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="identified by match to protein family HMM PF02699;
FT                   match to protein family HMM TIGR00739"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74502"
FT                   /protein_id="AAK74502.1"
FT                   /translation="MDTTLFYGIVIVLAVSPLLLSSFHSIRQQKLLRKQMEQRQEYLAS
FT                   LTFGDEVLLLSGIHGKIISIQDDLVSLQIAKGVVIHVEKESVMGKTKELLFK"
FT   gene            299300..300940
FT                   /locus_tag="SP_0327"
FT   CDS             299300..300940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0327"
FT                   /product="hypothetical protein"
FT                   /note="This hypothetical gene is interrupted by an
FT                   IS1380-Spn1 element in the type 4 strain, but not in the
FT                   Cp5500 strain (GP:1524347).; identified by Glimmer2;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74503"
FT                   /protein_id="AAK74503.1"
FT                   /translation="MKEERRQFFERVDGNQCRDYILSHCSKDYEKVKSSLERLMDNRFM
FT                   FDSPWDMEPCSKIHQIQPMVWDQVFEDDPEWSYMLNRQEYLLQFMIGYLVEGDKDYIQK
FT                   CKFFLFDWIEQVREFSPQSLMTRTLDTGIRSFTWLKLLLLLLKFDLLEEKELEKILVSL
FT                   EKQIDFMKSYYRAKYTLSNWGILQTIPMLAIYHFFSDKMDLEEAYHFASEELKQQIETQ
FT                   ILGDGSQFEQSILYHVEVYKALLDLCLLLPDLQDSYQELLEKMATYIQMMTGLDGRTLA
FT                   FGDSDSTETTEILSLSAVVLNQEDLLNGLDVKVDLLSLLFLGREKVKRLQEFEKRAWQP
FT                   KSMIFEDSGHVCIKDEHRYLFFKNGPLGSAHSHSDENSFCLQYQGQPIFIDAGRYSYRE
FT                   IYERYLLKSAWSHSTCIVDGKAPERITGSWEYEYYPHSLFCHHKEREGVHYIEGAYWSA
FT                   EPDLPYLHRRKILMLVEDVWLLVDDIRCQGQHEVLTQFILDKDVTYQDGKINQLRLWSE
FT                   VDFDLEDTIISPKSPIIHPKSKNHPESLP"
FT   gene            301056..302402
FT                   /locus_tag="SP_0328"
FT   CDS             301056..302402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0328"
FT                   /product="IS1380-Spn1, transposase"
FT                   /note="identified by similarity to GP:8163721; match to
FT                   protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74504"
FT                   /protein_id="AAK74504.1"
FT                   /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKER
FT                   ISKYLVTNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLAS
FT                   QPTLSRFLSRTDEETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAY
FT                   NAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRMDSG
FT                   FATPKLYDLIEKTGQYYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAG
FT                   SWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIKEMKEGF
FT                   FGDKTDSSTLIKNEVRMMMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVR
FT                   TGRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPRRKASLMMH"
FT   gene            302580..302909
FT                   /locus_tag="SP_0329"
FT   CDS             302580..302909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0329"
FT                   /product="hypothetical protein"
FT                   /note="This hypothetical gene is interrupted by an
FT                   IS1380-Spn1 element in the type 4 strain, but not in the
FT                   Cp5500 strain (GP:1524347).; identified by Glimmer2;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74505"
FT                   /protein_id="AAK74505.1"
FT                   /translation="MNDLGKYNELERSSKLTKRQFFENQMLDYTIIAHESFEIIRHSVY
FT                   QTDDREVENALAFEVKNDETDKLILLLSEDIGVGEKLCLVDGTKMRGKCLVYDKINERM
FT                   IRLQC"
FT   gene            302969..303970
FT                   /gene="regR"
FT                   /locus_tag="SP_0330"
FT   CDS             302969..303970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regR"
FT                   /locus_tag="SP_0330"
FT                   /product="sugar binding transcriptional regulator RegR"
FT                   /note="identified by similarity to GP:1536958; match to
FT                   protein family HMM PF00356; match to protein family HMM
FT                   PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74506"
FT                   /protein_id="AAK74506.1"
FT                   /translation="MEKKLTIKDIAEMAQTSKTTVSFYLNGKYEKMSQETREKIEKVIH
FT                   ETNYKPSIVARSLNSKRTKLIGVLIGDITNSFSNQIVKGIEDIASQNGYQVMIGNSNYS
FT                   QESEDRYIESMLLLGVDGFIIQPTSNFRKYSRIIDEKKKKMVFFDSQLYEHRTSWVKTN
FT                   NYDAVYDMTQSCIEKGYEHFLLITADTSRLSTRIERASGFVDALTDANMRHASLTIEDK
FT                   HTNLEQIKEFLQKEIDPDEKTLVFIPNCWALPLVFTVIKELNYNLPQVGLIGFDNTEWT
FT                   CFSSPSVSTLVQPSFEEGQQATKILIDQIEGRNQEERQQVLDCSVNWKESTF"
FT   gene            complement(304080..304472)
FT                   /locus_tag="SP_2241"
FT   CDS             complement(304080..304472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_2241"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_2241"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75798"
FT                   /protein_id="ABC75798.1"
FT                   /translation="MSTHFVLQELKKTRIRRCLMKSLARLLIIHVFISIFLFFALTSGA
FT                   ISHTVLLLLLLFLPALNKGLEKIQSKRIPVLNAALFFLLISFPQLLTNPVQWKFSIFLV
FT                   VTIISSLAYFYNFYQVVKEVDQKQLI"
FT   gene            complement(304426..304668)
FT                   /pseudo
FT                   /locus_tag="SP_0331"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which is not the result of sequencing error;
FT                   identified by Glimmer2; putative"
FT   gene            complement(304679..305221)
FT                   /locus_tag="SP_0332"
FT   CDS             complement(304679..305221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0332"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74507"
FT                   /protein_id="AAK74507.1"
FT                   /translation="MKKETFTEKLIKRTYGISGPLDEYKRREADSIGNQVFIILFYLMI
FT                   FGNLIPLLLAYKYPQEVALIYPPLILVIALIASGYVTYQMKKTGITVIEPDMLNEKESK
FT                   QLHYPGLKAGLFFGLWMFFITPLLRILIDEGQDYFHSLLTIRNGVSSILGSIFFGASIQ
FT                   FLISRRIAKTKKNQDED"
FT   gene            complement(305237..305431)
FT                   /locus_tag="SP_0333"
FT   CDS             complement(305237..305431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0333"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74508"
FT                   /protein_id="AAK74508.1"
FT                   /translation="MNRVKEFRKELGISQLELAKDIGVSRQTINMIENDKYNPTLELCL
FT                   NLARSLQTDLNSLFWEEDF"
FT   gene            305597..306547
FT                   /gene="yllC"
FT                   /locus_tag="SP_0334"
FT   CDS             305597..306547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yllC"
FT                   /locus_tag="SP_0334"
FT                   /product="yllC protein"
FT                   /note="identified by similarity to GP:4009486; match to
FT                   protein family HMM PF01795; match to protein family HMM
FT                   TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74509"
FT                   /db_xref="GOA:P0CB58"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CB58"
FT                   /protein_id="AAK74509.1"
FT                   /translation="MTKEFHHVTVLLHETIDMLDVKPDGIYVDATLGGAGHSEYLLSKL
FT                   SEKGHLYAFDQDQNAIDNAQKRLAPYIEKGMVTFIKDNFRHLQACLREAGVQEIDGICY
FT                   DLGVSSPQLDQRERGFSYKKDAPLDMRMNQDASLTAYEVVNNYDYHDLVRIFFKYGEDK
FT                   FSKQIARKIEQAREVKPIETTTELAEIIKLVKPAKELKKKGHPAKQIFQAIRIEVNDEL
FT                   GAADESIQQAMDMLALDGRISVITFHSLEDRLTKQLFKEASTVEVPKGLPFIPDDLKPK
FT                   MELVSRKPILPSAEELEANNRSHSAKLRVVRKIHK"
FT   gene            306559..306876
FT                   /gene="ftsL"
FT                   /locus_tag="SP_0335"
FT   CDS             306559..306876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="SP_0335"
FT                   /product="cell division protein FtsL"
FT                   /note="identified by similarity to GP:1524351; match to
FT                   protein family HMM TIGR02209"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74510"
FT                   /protein_id="AAK74510.1"
FT                   /translation="MAEKMEKTGQILQMQLKRFSRVEKAFYFSIAVTTLIVAISIIFMQ
FT                   TKLLQVQNDLTKINAQIEEKKTELDDAKQEVNELLRAERLKEIANSHDLQLNNENIRIA
FT                   E"
FT   gene            306880..309132
FT                   /gene="pbpX"
FT                   /locus_tag="SP_0336"
FT   CDS             306880..309132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpX"
FT                   /locus_tag="SP_0336"
FT                   /product="penicillin-binding protein 2X"
FT                   /note="identified by similarity to EGAD:7962; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF03717; match to protein family HMM PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74511"
FT                   /db_xref="GOA:P14677"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="PDB:1PMD"
FT                   /db_xref="PDB:1QME"
FT                   /db_xref="PDB:1QMF"
FT                   /db_xref="PDB:1RP5"
FT                   /db_xref="PDB:2Z2L"
FT                   /db_xref="PDB:2Z2M"
FT                   /db_xref="PDB:2ZC3"
FT                   /db_xref="PDB:2ZC4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14677"
FT                   /protein_id="AAK74511.1"
FT                   /translation="MKWTKRVIRYATKNRKSPAENRRRVGKSLSLLSVFVFAIFLVNFA
FT                   VIIGTGTRFGTDLAKEAKKVHQTTRTVPAKRGTIYDRNGVPIAEDATSYNVYAVIDENY
FT                   KSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANM
FT                   MSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESS
FT                   LNSILAGTDGIITYEKDRLGNIVPGTEQVSQRTMDGKDVYTTISSPLQSFMETQMDAFQ
FT                   EKVKGKYMTATLVSAKTGEILATTQRPTFDADTKEGITEDFVWRDILYQSNYEPGSTMK
FT                   VMMLAAAIDNNTFPGGEVFNSSELKIADATIRDWDVNEGLTGGRTMTFSQGFAHSSNVG
FT                   MTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIVNIAQSSFGQGISVTQ
FT                   TQMIRAFTAIANDGVMLEPKFISAIYDPNDQTARKSQKEIVGNPVSKDAASLTRTNMVL
FT                   VGTDPVYGTMYNHSTGKPTVTVPGQNVALKSGTAQIADEKNGGYLVGLTDYIFSAVSMS
FT                   PAENPDFILYVTVQQPEHYSGIQLGEFANPILERASAMKDSLNLQTTAKALEQVSQQSP
FT                   YPMPSVKDISPGDLAEELRRNLVQPIVVGTGTKIKNSSAEEGKNLAPNQQVLILSDKAE
FT                   EVPDMYGWTKETAETLAKWLNIELEFQGSGSTVQKQDVRANTAIKDIKKITLTLGD"
FT   gene            309134..310114
FT                   /gene="mraY"
FT                   /locus_tag="SP_0337"
FT   CDS             309134..310114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="SP_0337"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="identified by similarity to SP:Q9ZHA5; match to
FT                   protein family HMM PF00953; match to protein family HMM
FT                   TIGR00445"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74512"
FT                   /db_xref="GOA:P0CB59"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CB59"
FT                   /protein_id="AAK74512.1"
FT                   /translation="MFISISAGIVTFLLTLVEIPAFIQFYRKAQITGQQMHEDVKQHQA
FT                   KAGTPTMGGLVFLITSVLVAFFFALFSSQFSNNVGMILFILVLYGLVGFLDDFLKVFRK
FT                   INEGLNPKQKLALQLLGGVIFYLFYERGGDILSVFGYPVHLGFFYIFFALFWLVGFSNA
FT                   VNLTDGVDGLASISVVISLSAYGVIAYVQGQMDILLVILAMIGGLLGFFIFNHKPAKVF
FT                   MGDVGSLALGGMLAAISMALHQEWTLLIIGIVYVFETTSVMMQVSYFKLTGGKRIFRMT
FT                   PVHHHFELGGLSGKGNPWSEWKVDFFFWGVGLLASLLTLAILYLM"
FT   gene            310723..312828
FT                   /locus_tag="SP_0338"
FT   CDS             310723..312828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0338"
FT                   /product="putative ATP-dependent Clp protease, ATP-binding
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07724"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74513"
FT                   /protein_id="AAK74513.1"
FT                   /translation="MNNNFNNFNNMDDLFNQLMGGMRGYSSENRRYLINGREVTPEEFA
FT                   HYRATGQLPGNAETDVQMPQQASGMKQGGVLAKLGRNLTAEAREGKLDPVIGRNKEIQE
FT                   TSEILSRRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPAAIKNKEIISIDISGLEAG
FT                   TQYRGSFEENVQNLVNEVKEAGNIILFFDEIHQILGAGSTGGDSGSKGLADILKPALSR
FT                   GELTVIGATTQDEYRNTILKNAALARRFNEVKVNAPSAENTFKILQGIRDLYQQHHNVI
FT                   LPDEVLKAAVDYSVQYIPQRSLPDKAIDLVDVTAAHLAAQHPVTDVHAVEREIETEKDK
FT                   QEKAVEAEDFEAALNYKTRIAELERKIENHTEDMKVTASVNDVAESVERMTGIPVSQME
FT                   ASDIERLKDMAHRLQDKVIGQDKAVEVVARAIRRNRAGFDEGNRPIGNFLFVGSTGVGK
FT                   TELAKQLALDMFGTQDAIIRLDMSEYSDRTAVSKLIGTTAGYVGYDDNSNTLTERVRRN
FT                   PYSIILLDEIEKADPQVITLLLQVLDDGRLTDGQGNTVNFKNTVIIATSNAGFGYEANL
FT                   TEDADKPELMDRLKPFFRPEFLNRFNAVIEFSHLTKEDLSKIVDLMLAEVNQTLAKKDI
FT                   DLVVSQAAKDYITEEGYDEVMGVRPLRRVVEQEIRDKVTDFHLDHLDAKHLEADMEDGV
FT                   LVIREKV"
FT   gene            312935..313057
FT                   /pseudo
FT                   /locus_tag="SP_0339"
FT                   /note="Although this gene is truncated, 2 full length (1974
FT                   bp) copies fold into the secondary structures expected for
FT                   a group II intron. Left end = TTTTTTGCGGTACGACGGGC. Right
FT                   end = GAGATTATCCCCTACTCGAT.; group II intron, maturase,
FT                   truncation; comparison of this gene to its homologs
FT                   suggests this gene has been truncated; identified by
FT                   similarity to GP:2804734"
FT   gene            complement(313124..313606)
FT                   /gene="luxS"
FT                   /locus_tag="SP_0340"
FT   CDS             complement(313124..313606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="SP_0340"
FT                   /product="autoinducer-2 production protein"
FT                   /note="identified by similarity to SP:P45578; match to
FT                   protein family HMM PF02664"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74514"
FT                   /db_xref="GOA:P65334"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65334"
FT                   /protein_id="AAK74514.1"
FT                   /translation="MSKEVIVESFELDHTIVKAPYVRLIGEETGPKGDIISNYDIRLVQ
FT                   PNEDSIPTAGLHTIEHLLAKLIRTRIDGMIDCSPFGCRTGFHMIMWGRHTSAKIAAVIK
FT                   DSLKEIAETTTWEDVPGTTIESCGNYKDHSLFSAKEWAKLILEQGISDDAFERHVI"
FT   gene            complement(313701..315185)
FT                   /locus_tag="SP_0341"
FT   CDS             complement(313701..315185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0341"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74515"
FT                   /db_xref="InterPro:IPR014999"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SJ8"
FT                   /protein_id="AAK74515.1"
FT                   /translation="MKKQAFSSEQYLNLQRDHILERINQFDGKLYLEFGGKMLEDFHAA
FT                   RVLPGYEPDNKIKLLQELKEQVEVVIAINASNIEHSKARGDLGISYDQEVLRLIDKFNE
FT                   LGIFVGSVVITQYAGQPAADAFRNQLEKNGIDSYLHYPIKGYPTDMDHIISPEGMGKND
FT                   YIKTSRNLIVVTAPGPGSGKLATCMSNMYHDQINGIKSGYAKFETFPVWNLPLHHPVNL
FT                   AYEAATADLDDVNMIDPFHLQTYGETTVNYNRDIEIFPVLKRMLERILGKSPYASPTDM
FT                   GVNMVGFAITDDEAAVEASKQEIIRRYYQTVLDFKAEKVGEAAVKKIELLMNDLGITPA
FT                   DRKVAVVARQKAEETGGPALAFELPNGEIITGKNSELFGPTAAALINAIKKSADIAKEV
FT                   KLIEPEVVKPIQGLKIDHLGSRNPRLHSNEILIALAITATENPDAARAMEELGNLKGSE
FT                   AHSTIILTDEDKNVLRKLGINVTFDPYYQYDRLYRK"
FT   gene            315338..316945
FT                   /gene="dexB"
FT                   /locus_tag="SP_0342"
FT   CDS             315338..316945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dexB"
FT                   /locus_tag="SP_0342"
FT                   /product="glucan 1,6-alpha-glucosidase"
FT                   /EC_number="3.2.1.70"
FT                   /note="identified by similarity to GP:3320387; match to
FT                   protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74516"
FT                   /db_xref="GOA:Q54796"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q54796"
FT                   /protein_id="AAK74516.1"
FT                   /translation="MQEKWWHNAVVYQVYPKSFMDSNGDGVGDLPGITSKLDYLAKLGI
FT                   TAIWLSPVYDSPMDDNGYDIADYQAIAAIFGTMEDMDQLIAEAKKRDIRIIMDLVVNHT
FT                   SDEHAWFVEACENTDSPERDYYIWRDEPNDLDSIFSGSAWEYDEKSGQYYLHFFSKKQP
FT                   DLNWENEKLRQKIYEMMNFWIDKGIGGFRMDVIDMIGKIPDEKVVNNGPMLHPYLKEMN
FT                   QATFGDKDLLTVGETWGATPEIAKFYSDPKGQELSMVFQFEHIGLQYQEGQPKWHYQKE
FT                   LNIAKLKEIFNKWQTELGVEDGWNSLFWNNHDLPRIVSIWGNDQEYREKSAKAFAILLH
FT                   LMRGTPYIYQGEEIGMTNYPFETLDQVEDIESLNYAREALEKGVPIEEIMDSIRVIGRD
FT                   NARTPMQWDESKNAGFSTGQPWLAVNPNYEMINVQEALANPDSIFYTYQKLVQIRKENS
FT                   WLVRADFELLDTADKVFAYIRKDGDRRFLVVANLSNEEQDLTVEGKVKSVLIENTAAKE
FT                   VLEKQVLAPWDAFCVELL"
FT   gene            complement(317355..318701)
FT                   /locus_tag="SP_0343"
FT   CDS             complement(317355..318701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0343"
FT                   /product="IS1380-Spn1, transposase"
FT                   /note="identified by similarity to GP:8163721; match to
FT                   protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74517"
FT                   /protein_id="AAK74517.1"
FT                   /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKER
FT                   ISKYLVTNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLAS
FT                   QPTLSRFLSRTDEETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAY
FT                   NAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRMDSG
FT                   FATPKLYDLIEKTGQYYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAG
FT                   SWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIKEMKEGF
FT                   FGDKTDSSTLIKNEVRMMMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVR
FT                   TGRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPRRKASLMMH"
FT   gene            complement(318978..319316)
FT                   /locus_tag="SP_0344"
FT   CDS             complement(318978..319316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0344"
FT                   /product="IS630-Spn1, transposase Orf2"
FT                   /note="identified by similarity to GP:5019553"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74518"
FT                   /protein_id="AAK74518.1"
FT                   /translation="MVAGLTNGELIAPITYEETMTSDFFEAWFQKFLLPTLNTPSVIIM
FT                   DNARFHRMGKLELLCEEFGYKLLPLPPYSPEYNPIEKTWAHIKKHLKKVLPSCNTFYEA
FT                   LLSCSCFN"
FT   gene            complement(319495..319842)
FT                   /locus_tag="SP_0345"
FT   CDS             complement(319495..319842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0345"
FT                   /product="IS630-Spn1, transposase Orf1"
FT                   /note="identified by similarity to GP:4200438; match to
FT                   protein family HMM PF01710"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75784"
FT                   /protein_id="ABC75784.1"
FT                   /translation="MWYNLLMAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWL
FT                   KLKEKTGELNHQVKGTKPRKVDRDRLKNYLTDNPDAYLTEIASEFGCHPTTIHYALKAM
FT                   GYTRKKEPHLL"
FT   gene            320077..321522
FT                   /gene="cps4A"
FT                   /locus_tag="SP_0346"
FT   CDS             320077..321522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4A"
FT                   /locus_tag="SP_0346"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4A"
FT                   /note="identified by match to protein family HMM PF02916;
FT                   match to protein family HMM PF03816; match to protein
FT                   family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74519"
FT                   /protein_id="AAK74519.1"
FT                   /translation="MSRRFKKSRSQKVKRSVNIVLLTIYLLLVCFLLFLIFKYNILAFR
FT                   YLNLVVTALVLLVALVGLLLIIYKKAEKFTIFLLVFSILVSSVSLFAVQQFVGLTNRLN
FT                   ATSNYSEYSISVAVLADSEIENVTQLTSVTAPTGTNNENIQKLLADIKSSQNTDLTVNQ
FT                   SSSYLAAYKSLIAGETKAIVLNSVFENIIESEYPDYASKIKKIYTKGFTKKVEAPKTSK
FT                   SQSFNIYVSGIDTYGPISSVSRSDVNILMTVNRDTKKILLTTTPRDAYVPIADGGNNQK
FT                   DKLTHAGIYGVDSSIHTLENLYGVDINYYVRLNFTSFLKLIDLLGGIDVYNDQEFTAHT
FT                   NGKYYPAGNVHLDSEQALGFVRERYSLADGDRDRGRHQQKVIVAILQKLTSTEVLKNYS
FT                   TIINSLQDSIQTNMPLETMINLVNAQLESGGNYKVNSQDLKGTGRMDLPSYAMPDSNLY
FT                   VMEIDDSSLAVVKAAIQDVMEGR"
FT   gene            321524..322255
FT                   /gene="cps4B"
FT                   /locus_tag="SP_0347"
FT   CDS             321524..322255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4B"
FT                   /locus_tag="SP_0347"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4B"
FT                   /note="identified by similarity to GP:3550628; match to
FT                   protein family HMM PF02811"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74520"
FT                   /db_xref="GOA:Q9AHD4"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="PDB:2WJD"
FT                   /db_xref="PDB:2WJE"
FT                   /db_xref="PDB:2WJF"
FT                   /db_xref="PDB:3QY8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AHD4"
FT                   /protein_id="AAK74520.1"
FT                   /translation="MIDIHSHIVFDVDDGPKSREESKALLAESYRQGVRTIVSTSHRRK
FT                   GMFETPEEKIAENFLQVREIAKEVASDLVIAYGAEIYYTPDVLDKLEKKRIPTLNDSRY
FT                   ALIEFSMNTPYRDIHSALSKILMLGITPVIAHIERYDALENNEKRVRELIDMGCYTQVN
FT                   SSHVLKPKLFGERYKFMKKRAQYFLEQDLVHVIASDMHNLDGRPPHMAEAYDLVTQKYG
FT                   EAKAQELFIDNPRKIVMDQLI"
FT   gene            322264..322956
FT                   /gene="cps4C"
FT                   /locus_tag="SP_0348"
FT   CDS             322264..322956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4C"
FT                   /locus_tag="SP_0348"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4C"
FT                   /note="identified by similarity to EGAD:15994; match to
FT                   protein family HMM PF02706; match to protein family HMM
FT                   TIGR01006"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74521"
FT                   /db_xref="GOA:Q97SJ6"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SJ6"
FT                   /protein_id="AAK74521.1"
FT                   /translation="MKEQNTIEIDVFQLVKSLWKRKLMILIVALVTGAGAFAYSTFIVK
FT                   PEYTSTTRIYVVNRNQGDKPGLTNQDLQAGTYLVKDYREIILSQDVLEEVVSDLKLDLT
FT                   PKGLANKIKVTVPVDTRIVSISVNDRVPEEASRIANSLREVAAQKIISITRVSDVTTLE
FT                   EARPAISPSSPNIKRNTLIGFLAGVIGTSVIVLHLELLDTRVKRPEDIENTLQMTLLGV
FT                   VPNLGKLK"
FT   gene            322966..323649
FT                   /gene="cps4D"
FT                   /locus_tag="SP_0349"
FT   CDS             322966..323649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4D"
FT                   /locus_tag="SP_0349"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4D"
FT                   /note="identified by similarity to EGAD:19337; match to
FT                   protein family HMM TIGR01007"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74522"
FT                   /db_xref="GOA:Q9AHD2"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AHD2"
FT                   /protein_id="AAK74522.1"
FT                   /translation="MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNP
FT                   GEGKTTTSINIAWSFARAGYKTLLIDGDTRNSVMLGVFKSREKITGLTEFLSGTADLSH
FT                   GLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIIDTPPIGIVIDAA
FT                   IITQKCDASILVTATGEANKRDIQKAKQQLKQTGKLFLGVVLNKLDISVNKYGVYGSYG
FT                   NYGKK"
FT   gene            323990..324625
FT                   /gene="cps4E"
FT                   /locus_tag="SP_0350"
FT   CDS             323990..324625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4E"
FT                   /locus_tag="SP_0350"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4E"
FT                   /note="identified by similarity to GP:3411126; match to
FT                   protein family HMM PF02397"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74523"
FT                   /protein_id="AAK74523.1"
FT                   /translation="MKNGNRIYSWRLFMYGIIKRLGDILLSLIGIIILCPVFMIIAIAI
FT                   KLDSEGPVIFKQKRFGIHKEYFYILKFRSMKIDAPKNVAPRNLYNPEQWITKVGAFLRK
FT                   TSLDELPQLFNILVGNMSIVGPRPAGINELDLIAERDKYGANDILPGLTGWAQINGRDT
FT                   LSVEMKTELDGYYVKHLSLIMDIRCIVKTIPYVLKRKGIVEGSGKKES"
FT   gene            324634..325863
FT                   /gene="cps4F"
FT                   /locus_tag="SP_0351"
FT   CDS             324634..325863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4F"
FT                   /locus_tag="SP_0351"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4F"
FT                   /note="identified by similarity to GP:1657651; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74524"
FT                   /protein_id="AAK74524.1"
FT                   /translation="MKILFVCQHYKPEPFRLSDICEDLVRKGHEVSVLAGIPNYPEGKI
FT                   YADYRHNKKRREIIEGVTIYRSYTIPRKKSVVFRLLNYFSFAISSTLGVLLGRYKTKDG
FT                   SNFDCVFVNQLSPVMMAWAGMAYKKKYKKPMFLYCMDVWPDSLTVGGVKQDGLIFKLFK
FT                   FISKKVYRASDYIFVTSPSFKNYFVKQFDISEQKITYLPQYAEDLFIPDESIVNKESVD
FT                   LTFAGNIGKAQNLETILKAASLIEKNTNLPKKIHFHFVGDGTELLSMKALAHELELKNI
FT                   SFYGRRSLEEMPSFYKKSDAMLVSLIGDSIVSRTIPGKVQSYMAAGKPIIGAISGDAKI
FT                   IVEEANCGYVSPERDVKQLAKNICKFSMLSIKRQRELGKKARCYYENHFSKEQFMLELE
FT                   TCLERESKKE"
FT   gene            325868..326944
FT                   /gene="cps4G"
FT                   /locus_tag="SP_0352"
FT   CDS             325868..326944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4G"
FT                   /locus_tag="SP_0352"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4G"
FT                   /note="identified by similarity to GP:1657647"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74525"
FT                   /protein_id="AAK74525.1"
FT                   /translation="MRVLFILSDNIYLTPYFNFYKELLKKLSISYDVIYWDKNINEIIT
FT                   KQNYYRISFSGKGKLSKILGYVKFRKEIKKKLKENDYDMILPLHSIVSFILVDFLLFSF
FT                   KNRYIYDIRDYSYEKFLVYRLVQKQLVKNSLMNIVSSDGYKFFLPMGEYFTTHNLPNMI
FT                   ELNEVKQLKNNSTFPIQLSYIGLIRFQEQNKKIIDFFANDSRFQLNFIGTNAGELREFC
FT                   QEKNISNVNLVDTFQPKDTMSFYKNTDVVLNLYGNHTPLLDYALSNKLYFAALLYKPIL
FT                   VCEDTYMEKVSIENGFGFVLPMKDESEKDCLALYIQNLDRKQLIKNCDNFMDRISLEKQ
FT                   KTEIELEKRILSLRKKND"
FT   gene            326937..328055
FT                   /gene="cps4H"
FT                   /locus_tag="SP_0353"
FT   CDS             326937..328055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4H"
FT                   /locus_tag="SP_0353"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4H"
FT                   /note="identified by similarity to GP:9996704; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74526"
FT                   /protein_id="AAK74526.1"
FT                   /translation="MIKVLHLFTTLDSGGVESFLFNYYSHIDRKKIQFDFIVPGKEQGF
FT                   LEDKMKELGAKVYHVPLLRKKPLHQFLSLARIIKKGDYDIVHCHGYKSAIGLILSKIIG
FT                   CKIRIIHSHMAYVTENSFQKVLRKLVTILVKILATHWFACGEDSAKWLYGEKAYKDGKI
FT                   EIIFNAIDLKKYQFLSDVREKCRRELDVSNKFVLGNIARLSDQKNQSYLFNVLKELILI
FT                   KPNVILLLVGNGEDEQKLKQKALELNLTPYVLFLGRRTDISDLLSAMDVFLLPSKYEGL
FT                   PVSLVEAQASGLQILSSDTVTQEVDVTKNISYLPINEESVLLWKDKVLSLTSEECNRFE
FT                   INNSMTDGLYDICYQASKLLNRYQEMCVIKEI"
FT   gene            328056..329456
FT                   /locus_tag="SP_0354"
FT   CDS             328056..329456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0354"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74527"
FT                   /protein_id="AAK74527.1"
FT                   /translation="MQTKYICRVTLVTLSFIFAFCYLFWTLDNWNNGFLISNYVPSIFI
FT                   WVCFLIIFQITGFILQKVSIYDFSVWYLILSYFFMFGLIFNEYMGFQTTLLWSPSNFYN
FT                   NEELFHSYIFIIWILFCYSVGYLFFYSDGKVHYHSEVQNYQENEEKILYNAGRILTGVG
FT                   FISRVITDSKTVLAVRAANSYSAYSEAASSGIIDDLGVLMLPGVFSLFYSDKLSRVIKR
FT                   TIFWVMLFYLILIMILTGSRKIQVFSILALVLVYTQSLGITFSKKRVLVFLIVTVFLLN
FT                   VLVVIRGHRFDLNTIGIYLFDSFSSLDFVKNILGEVFSESGLTSLTVASAVTVVPSSIP
FT                   YEYGMTFLRTILSIFPIGWLVGDFFDKASATVVINKFLGLPVGSSFVEELFWNFGYYGG
FT                   VFWSFVLGIFSGWRLNFRAFQTSKISKVIYFSVISQLLLLVRSSSIDVYRPIMYSLIMI
FT                   FIFRRLKK"
FT   gene            329456..330538
FT                   /locus_tag="SP_0355"
FT   CDS             329456..330538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0355"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74528"
FT                   /protein_id="AAK74528.1"
FT                   /translation="MVKKIMLHGATDYGSSNYGDYLYGEIVYDLLESKGYEVSFYNPSD
FT                   FFQMYLKEYRQKQSFTKKQADAILYIPGGYFGEGHNARFRDNLIQFKRFLPLGIWASYF
FT                   KKPIGVLGIGAGPNNDSLMNYGIKRIINHAQFITVRDRESFDSLKHLSPSAPVHETFDL
FT                   IISSKLREEKTEQLCQLKREAKDKKIILVHYNHSKKALEKFAESISLFLENNPNYYVVV
FT                   TSDSILPYEDAYYQEFRKLVRTEDCFQFKYHSPAEMTSLLKMVDVVLTCKLHVGVVATC
FT                   FNKSVIAIACHPEKTARYYGAIGELQRCESLFDSSVNSIVKKLETFHLKPITIPSELVL
FT                   KARSSLDYLDLFLEGLVRES"
FT   gene            330528..331769
FT                   /locus_tag="SP_0356"
FT   CDS             330528..331769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0356"
FT                   /product="putative polysaccharide transporter"
FT                   /note="identified by similarity to EGAD:8775; match to
FT                   protein family HMM PF01943"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74529"
FT                   /protein_id="AAK74529.1"
FT                   /translation="MKVDRISFIKNTSSLYILNIVKLLFPLLTLPYLTRVLSLDAYGMV
FT                   IYVKALIAYVQLVIDFGFMISATKNIVNACTTPSKIGRIVGDTLVEKIFLSIISILIYT
FT                   ILMWQIPIMRENILFSVFYLLATVTNIFIFDFLFRGIEKMHAVAIPYIISKTIITILTF
FT                   IVVKDDSSILWIPILEGIGNLVAAVVSYRFLHYYGIKLSFSYLSVWVKDLKESSIYFLS
FT                   NFATTIFGVFTTVISGFYLQSQEIAFWGIAMQLLSAAKSLYNPIANSLYPHMIRTKDIQ
FT                   SVKSINRIMFIPIIFGVLIVLFFSNQILSIIGGEKYTVSADFLKYLLPAFVASFYSMIY
FT                   GWPVLGAIDKVKETTMTTILASIVQTLGLGIFILSDNFSLVTLAICSSMSEVVLWISRY
FT                   LIYFKNRSLFVRSK"
FT   gene            331774..332871
FT                   /gene="cps4I"
FT                   /locus_tag="SP_0357"
FT   CDS             331774..332871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4I"
FT                   /locus_tag="SP_0357"
FT                   /product="UDP-N-acetylglucosamine-2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="identified by match to protein family HMM PF02350;
FT                   match to protein family HMM TIGR00236"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74530"
FT                   /protein_id="AAK74530.1"
FT                   /translation="MKKVVVVFGTRPEAIKMCPLVKELRTRKNIETLVCVTGQHRQMLD
FT                   QVLDTFGIIPDFDLSIMKDKQTLFDVTIGILEGMKAILESEKPDLVLVHGDTSTTFASS
FT                   LAAFYLQIPIGHVEAGLRTYDIYSPYPEEFNRQAVGVLAQYHFTPTQLSKDNLLREGKT
FT                   PESIFVTGNTAIDALQTTIQEDYTHPELEWIGESRFILITAHRRENLGEPMRHMFRAIR
FT                   RIIEEYSDVKAIYPIHMNPRVRQIAEEELSGCERIKMIEPLEVLDFHNFLSRSYLILTD
FT                   SGGIQEEAPSLGKPVLVMRDTTERPEGIEAGTLKLVGADENNIYRHFKELLENDSVYQA
FT                   MSQASNPYGDGTACKKIADILEGEV"
FT   gene            332875..333930
FT                   /gene="cap4J"
FT                   /locus_tag="SP_0358"
FT   CDS             332875..333930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap4J"
FT                   /locus_tag="SP_0358"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4J"
FT                   /note="identified by similarity to GP:1657644; match to
FT                   protein family HMM PF02719; match to protein family HMM
FT                   PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74531"
FT                   /protein_id="AAK74531.1"
FT                   /translation="MSQFTGKTLLITGGTGSFGNAVLKRFLETDVSEIRIFSRDEKKQD
FT                   DMRHEFQVKVPEVAGKIRFYLGDVRDLASVKNAMHGVDYVFHAAALKQVPSCEFFPVEA
FT                   VKTNILGTENVLTAAIEAGVKQVICLSTDKAAYPVNAMGTSKAMMEKIAVAKSRTVNPE
FT                   HTKICVTRYGNVLCSRGSVVPLWIEQIKQGNALTITEPSMTRFVMTLEEAVDLVLFAFE
FT                   EGKSGDILVQKAPACTIEVLAKAVSEIFASEQDIKIIGIRHGEKRYETLLTNEECANAI
FT                   DLGDFYRVPSDNRNLNYDKYFKDGSTNRNLLTEFNSNNTDLMDVEQVKRKLLELDEIQT
FT                   AIRDMVADEEM"
FT   gene            334030..335259
FT                   /gene="cps4K"
FT                   /locus_tag="SP_0359"
FT   CDS             334030..335259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4K"
FT                   /locus_tag="SP_0359"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps4K"
FT                   /note="identified by similarity to GP:1773345; match to
FT                   protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74532"
FT                   /protein_id="AAK74532.1"
FT                   /translation="MIKNILITGAKGFVGKNLICTLEALKDGRDRTRPNLEIGEIFQYD
FT                   RDTDPILLDEYCKKADFVFHLAGVNRPQNPDEFMEGNYGFSSRLLEILEKYENTCPVLL
FT                   SSSTQASLEGRFSNSIYGQSKLAGEELFFEYGKKTGAPVLVYRFPNLYGKWCRPNYNSA
FT                   VATFCYNLAHDLPIQVNDPSVELELLYIDDLIQECLTALEGNPHRCNLDGLQILPSPSG
FT                   NYCYVPTTHRATLGEIVSLLETFKKQPDSLVMPEIPQGSFKKKLYSTYLSYLPVDKFKF
FT                   PLKMNIDERGSFTELLKTENTGQFSVNISKPGITKGQHWHHSKWEFFMVVSGRALIQER
FT                   RIGLDENGQEYPILNFEVSGDKIEAIHMIPGYAHNIINLSDTENLITVMWANESFDPRH
FT                   PDTFFEQVEK"
FT   gene            335260..336444
FT                   /gene="cps4L"
FT                   /locus_tag="SP_0360"
FT   CDS             335260..336444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps4L"
FT                   /locus_tag="SP_0360"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="identified by match to protein family HMM PF02350;
FT                   match to protein family HMM TIGR00236"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74533"
FT                   /protein_id="AAK74533.1"
FT                   /translation="MKIKTDYSDIHFKDNGKLKLLIIVGTRPEIIRLSSVITKCRKYFD
FT                   VILAHTGQNYDYNLNGIFFDNLGLDTPDVYMDAVGDDLGATVGNIINTSYKLMNQIKPD
FT                   ALLILGDTNSCLSAIAAKRLHIPIFHMEAGNRCKDECLPEETNRRIVDVISDVNLAYSE
FT                   HARKYLHECGLPKERTYVTGSPMAEVLHKNLSAIESSDIHERLGLKKGGYILLSAHREE
FT                   NIDTDKNFISLFTAINQLAEKYNMPILYSCHPRSKKRLQESGFKLDKRVIQHEPLGFHD
FT                   YNCLQMNAFVVVSDSGTLPEESSFFTSQGYPFPAVCIRTSTERPESLDKAGFILAGIDE
FT                   NSLLQAVETAVSLAQDEDFGLPVPDYVEENVSTKVVKIIQSYTGIVDKIVWRKS"
FT   gene            complement(336639..336740)
FT                   /locus_tag="SP_0361"
FT   CDS             complement(336639..336740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0361"
FT                   /product="IS1167, transposase, truncation"
FT                   /note="identified by similarity to GP:2804700"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75799"
FT                   /protein_id="ABC75799.1"
FT                   /translation="MGGYFRNFENFKKRIFIALNIKKERTKFVLSQA"
FT   gene            complement(336807..337914)
FT                   /pseudo
FT                   /locus_tag="SP_0362"
FT                   /note="This gene has an N-terminal truncation, and is
FT                   interrupted by an RUP element. IRleft =
FT                   GTAAGCGCGTCATAACAAGG. IRright = GTAACCGCCCAATAACGAAG.; IS66
FT                   family element, Orf3, degenerate; this gene contains a
FT                   frame shift which is not the result of sequencing error;
FT                   identified by similarity to GP:6009427"
FT   gene            337984..338250
FT                   /locus_tag="SP_0363"
FT   CDS             337984..338250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0363"
FT                   /product="transposase family protein, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75796"
FT                   /protein_id="ABC75796.1"
FT                   /translation="MDNAIWHKSSTLKIPTNIGFAFIPPYTPEMNPIEQVWKEIRKRGF
FT                   KNKAFRTLEDVMNQLQDVIQGLEKEVIKSIVNRRWTRVLFESR"
FT   gene            complement(338273..338728)
FT                   /pseudo
FT                   /locus_tag="SP_0364"
FT                   /note="An RUP element disrupts the C-terminus of this gene.
FT                   IRleft = GTAAGCGCGTCATAACAAGG. IRright =
FT                   GTAACCGCCCAATAACGAAG.; IS66 family element, Orf2,
FT                   interruption; this gene contains a premature stop which is
FT                   not the result of sequencing error; identified by
FT                   similarity to GP:6009406"
FT   gene            complement(338709..338946)
FT                   /pseudo
FT                   /locus_tag="SP_0365"
FT                   /note="Gene assignment is based on location within inverted
FT                   repeats which also flank genes (Orf2 and Orf3-5) that
FT                   resemble IS679. IRleft = GTAAGCGCGTCATAACAAGG. IRright =
FT                   GTAACCGCCCAATAACGAAG.; IS66 family element, Orf1, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error"
FT   gene            339096..341081
FT                   /gene="aliA"
FT                   /locus_tag="SP_0366"
FT   CDS             339096..341081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aliA"
FT                   /locus_tag="SP_0366"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein AliA"
FT                   /note="identified by similarity to SP:P35592; match to
FT                   protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74534"
FT                   /db_xref="GOA:P35592"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35592"
FT                   /protein_id="AAK74534.1"
FT                   /translation="MMKSSKLFALAGVTLLAATTLAACSGSGSSTKGEKTFSYIYETDP
FT                   DNLNYLTTAKAATANITSNVVDGLLENDRYGNFVPSMAEDWSVSKDGLTYTYTIRKDAK
FT                   WYTSEGEEYAAVKAQDFVTGLKYAADKKSDALYLVQESIKGLDAYVKGEIKDFSQVGIK
FT                   ALDEQTVQYTLNKPESFWNSKTTMGVLAPVNEEFLNSKGDDFAKATDPSSLLYNGPYLL
FT                   KSIVTKSSVEFAKNPNYWDKDNVHVDKVKLSFWDGQDTSKPAENFKDGSLTAARLYPTS
FT                   ASFAELEKSMKDNIVYTQQDSITYLVGTNIDRQSYKYTSKTSDEQKASTKKALLNKDFR
FT                   QAIAFGFDRTAYASQLNGQTGASKILRNLFVPPTFVQADGKNFGDMVKEKLVTYGDEWK
FT                   DVNLADSQDGLYNPEKAKAEFAKAKSALQAEGVQFPIHLDMPVDQTATTKVQRVQSMKQ
FT                   SLEATLGADNVIIDIQQLQKDEVNNITYFAENAAGEDWDLSDNVGWGPDFADPSTYLDI
FT                   IKPSVGESTKTYLGFDSGEDNVAAKKVGLYDYEKLVTEAGDETTDVAKRYDKYAAAQAW
FT                   LTDSALIIPTTSRTGRPILSKMVPFTIPFALSGNKGTSEPVLYKYLELQDKAVTVDEYQ
FT                   KAQEKWMKEKEESNKKAQEDLAKHVK"
FT   gene            341229..341348
FT                   /locus_tag="SP_0367"
FT   CDS             341229..341348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0367"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74535"
FT                   /protein_id="AAK74535.1"
FT                   /translation="MFPIAFSAIICYIKSIIIFYLSELSIALSEEGVFFKKKM"
FT   gene            341383..346686
FT                   /locus_tag="SP_0368"
FT   CDS             341383..346686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0368"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by similarity to GP:1658320; match to
FT                   protein family HMM PF00397; match to protein family HMM
FT                   PF00746; match to protein family HMM PF00754; match to
FT                   protein family HMM PF04650; match to protein family HMM
FT                   TIGR01167; match to protein family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75807"
FT                   /db_xref="GOA:Q2MGH6"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR025706"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2MGH6"
FT                   /protein_id="ABC75807.1"
FT                   /translation="MNKGLFEKRCKYSIRKFSLGVASVMIGAAFFGTSPVLADSVQSGS
FT                   TANLPADLATALATAKENDGRDFEAPKVGEDQGSPEVTDGPKTEEELLALEKEKPAEEK
FT                   PKEDKPAAAKPETPKTVTPEWQTVANKEQQGTVTIREEKGVRYNQLSSTAQNDNAGKPA
FT                   LFEKKGLTVDANGNATVDLTFKDDSEKGKSRFGVFLKFKDTKNNVFVGYDKDGWFWEYK
FT                   SPTTSTWYRGSRVAAPETGSTNRLSITLKSDGQLNASNNDVNLFDTVTLPAAVNDHLKN
FT                   EKKILLKAGSYDDERTVVSVKTDNQEGVKTEDTPAEKETGPEVDDSKVTYDTIQSKVLK
FT                   AVIDQAFPRVKEYSLNGHTLPGQVQQFNQVFINNHRITPEVTYKKINETTAEYLMKLRD
FT                   DAHLINAEMTVRLQVVDNQLHFDVTKIVNHNQVTPGQKIDDESKLLSSISFLGNALVSV
FT                   SSNQTGAKFDGATMSNNTHVSGDDHIDVTNPMKDLAKGYMYGFVSTDKLAAGVWSNSQN
FT                   SYGGGSNDWTRLTAYKETVGNANYVGIHSSEWQWEKAYKGIVFPEYTKELPSAKVVITE
FT                   DANADKNVDWQDGAIAYRSIMNNPQGWEKVKDITAYRIAMNFGSQAQNPFLMTLDGIKK
FT                   INLHTDGLGQGVLLKGYGSEGHDSGHLNYADIGKRIGGVEDFKTLIEKAKKYGAHLGIH
FT                   VNASETYPESKYFNEKILRKNPDGSYSYGWNWLDQGINIDAAYDLAHGRLARWEDLKKK
FT                   LGDGLDFIYVDVWGNGQSGDNGAWATHVLAKEINKQGWRFAIEWGHGGEYDSTFHHWAA
FT                   DLTYGGYTNKGINSAITRFIRNHQKDAWVGDYRSYGGAANYPLLGGYSMKDFEGWQGRS
FT                   DYNGYVTNLFAHDVMTKYFQHFTVSKWENGTPVTMTDNGSTYKWTPEMRVELVDADNNK
FT                   VVVTRKSNDVNSPQYRERTVTLNGRVIQDGSAYLTPWNWDANGKKLSTDKEKMYYFNTQ
FT                   AGATTWTLPSDWAKSKVYLYKLTDQGKTEEQELTVKDGKITLDLLANQPYVLYRSKQTN
FT                   PEMSWSEGMHIYDQGFNSGTLKHWTISGDASKAEIVKSQGANDMLRIQGNKEKVSLTQK
FT                   LTGLKPNTKYAVYVGVDNRSNAKASITVNTGEKEVTTYTNKSLALNYVKAYAHNTRRDN
FT                   ATVDDTSYFQNMYAFFTTGADVSNVTLTLSREAGDQATYFDEIRTFENNSSMYGDKHDT
FT                   GKGTFKQDFENVAQGIFPFVVGGVEGVEDNRTHLSEKHNPYTQRGWNGKKVDDVIEGNW
FT                   SLKTNGLVSRRNLVYQTIPQNFRFEAGKTYRVTFEYEAGSDNTYAFVVGKGEFQSGRRG
FT                   TQASNLEMHELPNTWTDSKKAKKATFLVTGAETGDTWVGIYSTGNASNTRGDSGGNANF
FT                   RGYNDFMMDNLQIEEITLTGKMLTENALKNYLPTVAMTNYTKESMDALKEAVFNLSQAD
FT                   DDISVEEARAEIAKIEALKNALVQKKTALVADDFASLTAPAQAQEGLANAFDGNVSSLW
FT                   HTSWNGGDVGKPATMVLKEPTEITGLRYVPRGSGSNGNLRDVKLVVTDESGKEHTFTAT
FT                   DWPNNNKPKDIDFGKTIKAKKIVLTGTKTYGDGGDKYQSAAELIFTRPQVAETPLDLSG
FT                   YEAALVKAQKLTDKDNQEEVASVQASMKYATDNHLLTERMVEYFADYLNQLKDSATKPD
FT                   APTVEKPEFKLRSLASEQGKTPDYKQEIARPETPEQILPATGESQSDTALILASVSLAL
FT                   SALFVVKTKKD"
FT   gene            complement(346853..349012)
FT                   /gene="pbp1A"
FT                   /locus_tag="SP_0369"
FT   CDS             complement(346853..349012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp1A"
FT                   /locus_tag="SP_0369"
FT                   /product="penicillin-binding protein 1A"
FT                   /note="identified by similarity to SP:Q04707; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF00912; match to protein family HMM TIGR02074"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74536"
FT                   /db_xref="GOA:Q04707"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="PDB:2ZC5"
FT                   /db_xref="PDB:2ZC6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04707"
FT                   /protein_id="AAK74536.1"
FT                   /translation="MNKPTILRLIKYLSISFLSLVIAAIVLGGGVFFYYVSKAPSLSES
FT                   KLVATTSSKIYDNKNQLIADLGSERRVNAQANDIPTDLVKAIVSIEDHRFFDHRGIDTI
FT                   RILGAFLRNLQSNSLQGGSTLTQQLIKLTYFSTSTSDQTISRKAQEAWLAIQLEQKATK
FT                   QEILTYYINKVYMSNGNYGMQTAAQNYYGKDLNNLSLPQLALLAGMPQAPNQYDPYSHP
FT                   EAAQDRRNLVLSEMKNQGYISAEQYEKAVNTPITDGLQSLKSASNYPAYMDNYLKEVIN
FT                   QVEEETGYNLLTTGMDVYTNVDQEAQKHLWDIYNTDEYVAYPDDELQVASTIVDVSNGK
FT                   VIAQLGARHQSSNVSFGINQAVETNRDWGSTMKPITDYAPALEYGVYDSTATIVHDEPY
FT                   NYPGTNTPVYNWDRGYFGNITLQYALQQSRNVPAVETLNKVGLNRAKTFLNGLGIDYPS
FT                   IHYSNAISSNTTESDKKYGASSEKMAAAYAAFANGGTYYKPMYIHKVVFSDGSEKEFSN
FT                   VGTRAMKETTAYMMTDMMKTVLTYGTGRNAYLAWLPQAGKTGTSNYTDEEIENHIKTSQ
FT                   FVAPDELFAGYTRKYSMAVWTGYSNRLTPLVGNGLTVAAKVYRSMMTYLSEGSNPEDWN
FT                   IPEGLYRNGEFVFKNGARSTWNSPAPQQPPSTESSSSSSDSSTSQSSSTTPSTNNSTTT
FT                   NPNNNTQQSNTTPDQQNQNPQPAQP"
FT   gene            complement(349009..349605)
FT                   /gene="recU"
FT                   /locus_tag="SP_0370"
FT   CDS             complement(349009..349605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="SP_0370"
FT                   /product="recombination protein U"
FT                   /note="identified by similarity to EGAD:24099; match to
FT                   protein family HMM PF03838; match to protein family HMM
FT                   TIGR00648"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74537"
FT                   /db_xref="GOA:P0A455"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A455"
FT                   /protein_id="AAK74537.1"
FT                   /translation="MVNYPHKVSSQKRQTSLSQPKNFANRGMSFEKMINATNDYYLSQG
FT                   LAVIHKKPTPIQIVQVDYPQRSRAKIVEAYFRQASTTDYSGVYNGYYIDFEVKETKQKR
FT                   AIPMKNFHPHQIQHMEQVLAQQGICFVLLHFSSQQETYLLPAFDLIRFYHQDKGQKSMP
FT                   LEYIREYGYEIKAGAFPQIPYLNVIKEHLLGGKTR"
FT   gene            349671..350198
FT                   /locus_tag="SP_0371"
FT   CDS             349671..350198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:37709; match to
FT                   protein family HMM PF06908"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74538"
FT                   /db_xref="GOA:Q97SJ0"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SJ0"
FT                   /protein_id="AAK74538.1"
FT                   /translation="MATALVLGYSAFDLGLFSDKDPRLKLIKKAIRKDLEAMAADGVSW
FT                   LVFTGSLGFEYWVLEVAQEMKTEYGFQLATIFAFETHGENWNEGNQMKLSRFKQVDFVK
FT                   YAYPRYEHKGQLRDYQQFLLENTTSSYLFYDEENETKLAYFYQKMKNQEDYFIKRLTFD
FT                   ELNELAENFSEN"
FT   gene            350268..350597
FT                   /locus_tag="SP_0372"
FT   CDS             350268..350597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:37710; match to
FT                   protein family HMM PF05103"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74539"
FT                   /db_xref="GOA:Q97SI9"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR011229"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SI9"
FT                   /protein_id="AAK74539.1"
FT                   /translation="MASIIFSAKDIFEQEFGREVRGYNKVEVDEFLDDVIKDYETYAAL
FT                   VKSLRQEIADLKEELTRKPKPSPVQAEPLEAAITSSMTNFDILKRLNRLEKEVFGKQIL
FT                   DNSDF"
FT   gene            351083..352240
FT                   /locus_tag="SP_0373"
FT   CDS             351083..352240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:48783; match to
FT                   protein family HMM PF01170"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74540"
FT                   /protein_id="AAK74540.1"
FT                   /translation="MKKEFNLIATVAAGLEAVVGREVRELGYDCQVENGRVRFQGDVRA
FT                   IIETNLWLRAADRIKIIVGTFPAKTFEELFQGVFALDWENYLPLGARFPISKAKCVKSK
FT                   LHNEPSVQAISKKAVVKKLQKHYARPEGVPLMENGPEFKIEVSILKDVATVMIDTTGSS
FT                   LFKRGYRTEKGGAPIKENMAAAILQLSNWYPDKPLIDPTCGSGTFCIEAVMIARKMAPG
FT                   LRRSFAFEEWNWISDRLIQEVRTEAAKKVDRELELDIMGCDIDARMVEIAKANAQVAGV
FT                   AGDITFKQMRVQDLRSDKINGVIISNPPYGERLSDDAGVTKLYAEMGQVFAPLKTWSKF
FT                   ILTSDEAFESKYGSQADKKRKLYNGTLKVDLYQYFGQRVKRQEVK"
FT   gene            352253..353647
FT                   /locus_tag="SP_0374"
FT   CDS             352253..353647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0374"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74541"
FT                   /protein_id="AAK74541.1"
FT                   /translation="MSKKRRNRHKKEGQEPQFDFDEAKELTVGQAIRKNEEVESGVLPE
FT                   DSILDKYVKQHRDEIEADKFATRQYKKEEFVETQSLDDLIQEMREAVEKSEASSEEVPS
FT                   SEDILLPLPLDDEEQGLDPLLLDDENPTEMTEEVEEEQNLSRLDQEDSEKKSKKGFILT
FT                   VLALVSVIICVSAYYVYRQVARSTKEIETSQSTTANQSDVDDFNTLYDAFYTDSNKTAL
FT                   KNSQFDKLSQLKTLLDKLEGSREHTLAKSKYDSLATQIKAIQDVNAQFEKPAIVDGVLD
FT                   TNAKAKSDAKFTDIKTGNTELDKVLDKAISLGKSQQTSTSSSSSSQTSSSSSSQASSNT
FT                   TSEPKPSSSNETRSSRSEVNMGLSSAGVAVQRSASRVAYNQSAIDDSNNSAWDFADGVL
FT                   EQILATSRSRGYITGDQYILERVNIVNGNGYYNLYKPDGTYLFTLNCKTGYFVGNGAGH
FT                   ADDLDY"
FT   gene            353723..355147
FT                   /gene="gnd"
FT                   /locus_tag="SP_0375"
FT   CDS             353723..355147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="SP_0375"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /note="identified by similarity to EGAD:37374; match to
FT                   protein family HMM PF00393; match to protein family HMM
FT                   PF03446; match to protein family HMM TIGR00873"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74542"
FT                   /protein_id="AAK74542.1"
FT                   /translation="MTKANFGVVGMAVMGRNLALNIESRGYTVAIYNRSKEKTEDVIAC
FT                   HPEKNFVPSYDVESFVNSIEKPRRIMLMVQAGPGTDATIQALLPHLDKGDILIDGGNTF
FT                   YKDTIRRNEELANSGINFIGTGVSGGEKGALEGPSIMPGGQKEAYELVADVLEEISAKA
FT                   PEDGKPCVTYIGPDGAGHYVKMVHNGIEYGDMQLIAESYDLMQHLLGLSAEDMAEIFTE
FT                   WNKGELDSYLIEITADILSRKDDEGQDGPIVDYILDAAGNKGTGKWTSQSSLDLGVPLS
FT                   LITESVFARYISTYKEERVHASKVLPKPAAFNFEGDKAELIEKIRQALYFSKIISYAQG
FT                   FAQLRVASKENNWNLPFADIASIWRDGCIIRSRFLQKITDAYNRDADLANLLLDEYFLD
FT                   VTAKYQQAVRDIVALAVQAGVPVPTFSAAITYFDSYRSADLPANLIQAQRDYFGAHTYQ
FT                   RKDKEGTFHYSWYDEK"
FT   gene            355159..355848
FT                   /locus_tag="SP_0376"
FT   CDS             355159..355848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0376"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74543"
FT                   /protein_id="AAK74543.1"
FT                   /translation="MGKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQT
FT                   DYDLMLLNVNLGDMMAQDFAEKLSRTKPASVIMILDHWEDLQEELEVVQRFAVSYIYKP
FT                   VLIENLVARISAIFRGRDFIDQHCSLMKVPRTYRNLRIDVEHHTVYRGEEMIALTRREY
FT                   DLLATLMGSKKVLTREQLLESVWKYESATETNIVDVYIRYLRSKLDVKGQKSYIKTVRG
FT                   VGYTMQE"
FT   gene            355947..356969
FT                   /gene="cbpC"
FT                   /locus_tag="SP_0377"
FT   CDS             355947..356969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbpC"
FT                   /locus_tag="SP_0377"
FT                   /product="choline binding protein C"
FT                   /note="identified by similarity to GP:1914875; similarity
FT                   to GP:9454354; match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74544"
FT                   /protein_id="AAK74544.1"
FT                   /translation="MKLLKKMMQVALAVFFFGLLATNTVFANTTGGRFVDKDNRKYYVK
FT                   DDHKAIYWHKIDGKTYYFGDIGEMVVGWQYLEIPGTGYRDNLFDNQPVNEIGLQEKWYY
FT                   FGQDGALLEQTDKQVLEAKTSENTGKVYGEQYPLSAEKRTYYFDNNYAVKTGWIYEEGH
FT                   WYYLNKLGNFGDDSYNPLPIGEVAKGWTQDFHVTIDIDRSKPAPWYYLDASGKMLTDWQ
FT                   KVNGKWYYFGSSGSMATGWKYVRGKWYYLDNKNGDMKTGWQYLGNKWYYLRSSGAMVTG
FT                   WYQDGSTWYYLDPSNGDMKIGWTKVNGKWYYLNSNGAMVTGSQTIDGKVYNFASSGEWI
FT                   "
FT   gene            356987..357985
FT                   /gene="cbpJ"
FT                   /locus_tag="SP_0378"
FT   CDS             356987..357985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbpJ"
FT                   /locus_tag="SP_0378"
FT                   /product="choline binding protein J"
FT                   /note="identified by similarity to GP:9454358; match to
FT                   protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74545"
FT                   /protein_id="AAK74545.1"
FT                   /translation="MKILKKTMQVGLTVFFFGLLGTSTVFADDSEGWQFVQENGRTYYK
FT                   KGDLKETYWRVIDGKYYYFDSLSGEMVVGWQYIPFPSKGSTIGPYPNGIRLEGFPKSEW
FT                   YYFDKNGVLQEFVGWKTLEIKTKDSVGRKYGEKREDSEDKEEKRYYTNYYFNQNHSLET
FT                   GWLYDQSNWYYLAKTEINGENYLGGERRAGWINDDSTWYYLDPTTGIMQTGWQYLGNKW
FT                   YYLRSSGAMATGWYQEGTTWYYLDHPNGDMKTGWQNLGNKWYYLRSSGAMATGWYQDGS
FT                   TWYYLNAGNGDMKTGWFQVNGNWYYAYSSGALAVNTTVDGYSVNYNGEWVR"
FT   gene            complement(358103..359335)
FT                   /locus_tag="SP_0379"
FT   CDS             complement(358103..359335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3582221; match to
FT                   protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74546"
FT                   /protein_id="AAK74546.1"
FT                   /translation="MKLFWTNNIYRQLLLNSCFSSFGDSIFYLAIINYVAQYNFAPLAI
FT                   LLISISEMVPLLSQLFLGILGDFQENRVKHALWIAKIKILLYAILTVFLVLSPFSLVSV
FT                   IMIVIINLISDTLSYLSAYMMNALYISVIKDDLHDAMGFRQSLMRVVRIVANLAGAFLI
FT                   NVISIQTISLINTLTFVIAFLGLYVIRHTLYEVEKRIEMSHTALSFKKYFQHLKQSLAV
FT                   LLRLKDTVILLFLTTSMIAILDVSPRLIALRFIQQTLAQLSIGQLLALLSIIMSCGAIL
FT                   GNMTSSNLFKNIRFTHLLVFCEISLLTLITSILCQAYIVIFMTSFISSTIIGILSPRLQ
FT                   AAVFAHIPSDKMGTVGSALSTVDILAPSLLSLLALSIASGVSVQLALIFLYLILIALIF
FT                   CQWLVKFNTHN"
FT   gene            complement(359378..360253)
FT                   /locus_tag="SP_0380"
FT   CDS             complement(359378..360253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0380"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74547"
FT                   /protein_id="AAK74547.1"
FT                   /translation="MYPPELDSKILSIIKKAVTIRTTHTYEYQYSLLFGDAGYLWLLLH
FT                   LFSISKNQYYLQLANVTAKKLIENYDTLEEIDFALGKSGVLLSLIKYYQFTNDNTLKIF
FT                   IHNSIGEIYHYFLQRDTAKESILDYSFAHGYCGIAYALFAYSKVLEPSMFYNDLHTFHT
FT                   ELKKLLEKVTSNTENLGNLQLSWCKGISGIILYLCMYDCDGNKDIISKYQEFVFNHHLK
FT                   MMTGYCHGITSLLQTTVYNQNKLLMKKIQQVILACSERDDHGLLMFQGDSGKADLFDFG
FT                   IGSMGYIGVY"
FT   gene            361318..362196
FT                   /gene="mvaK1"
FT                   /locus_tag="SP_0381"
FT   CDS             361318..362196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaK1"
FT                   /locus_tag="SP_0381"
FT                   /product="mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /note="identified by similarity to GP:9937407; match to
FT                   protein family HMM PF00288; match to protein family HMM
FT                   TIGR00549"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74548"
FT                   /protein_id="AAK74548.1"
FT                   /translation="MTKKVGVGQAHSKIILIGEHAVVYGYPAISLPLLEVEVTCKVVPA
FT                   ESPWRLYEEDTLSMAVYASLEYLNITEACIRCEIDSAIPEKRGMGSSAAISIAAIRAVF
FT                   DYYQADLPHDVLEILVNRAEMIAHMNPSGLDAKTCLSDQPIRFIKNVGFTELEMDLSAY
FT                   LVIADTGVYGHTREAIQVVQNKGKDALPFLHALGELTQQAEVAISQKDAEGLGQILSQA
FT                   HLHLKEIGVSSPEADFLVETTLSHGALGAKMSGGGLGGCIIALVTNLTHAQELAERLEE
FT                   KGAVQTWIESL"
FT   gene            362178..363131
FT                   /gene="mvaD"
FT                   /locus_tag="SP_0382"
FT   CDS             362178..363131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="SP_0382"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /note="identified by similarity to GP:9937408; match to
FT                   protein family HMM PF00288; match to protein family HMM
FT                   TIGR01240"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74549"
FT                   /protein_id="AAK74549.1"
FT                   /translation="MDREPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTE
FT                   TTLSPLPANVTADEFYINGQLQNEVEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGL
FT                   SSSSSGLSALVKACNAYFKLGLDRSQLAQEAKFASGSSSRSFYGPLGAWDKDSGEIYPV
FT                   ETDLKLAMIMLVLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDF
FT                   AKIGELTEKNALAMHATTKTASPAFSYLTDASYEAMAFVRQLREKGEACYFTMDAGPNV
FT                   KVFCQEKDLEHLSEIFGHRYRLIVSKTKDLSQDDCC"
FT   gene            363118..364125
FT                   /gene="mvaK2"
FT                   /locus_tag="SP_0383"
FT   CDS             363118..364125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaK2"
FT                   /locus_tag="SP_0383"
FT                   /product="phosphomevalonate kinase"
FT                   /note="identified by similarity to GP:9937409; match to
FT                   protein family HMM PF00288; match to protein family HMM
FT                   TIGR01220"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74550"
FT                   /protein_id="AAK74550.1"
FT                   /translation="MIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYR
FT                   IYSDMFDFAVDLRPNPDYSLIQETIALMGDFLAVRGQNLRPFSLEICGKMEREGKKFGL
FT                   GSSGSVVVLVVKALLALYDVSVDQELLFKLTSAVLLKRGDNGSMGDLACIVAEDLVLYQ
FT                   SFDRQKVAAWLEEENLATVLERDWGFSISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQ
FT                   NINQNFLTSSKETVTSLVEALEQGKSEKIIDQVEVASKLLEGLSTDIYTPLLRQLKEAS
FT                   QDLQTVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERIGHDDKS"
FT   gene            364109..365119
FT                   /locus_tag="SP_0384"
FT   CDS             364109..365119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0384"
FT                   /product="FMN-dependent dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF01070;
FT                   match to protein family HMM TIGR02151"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74551"
FT                   /db_xref="GOA:Q97SH8"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SH8"
FT                   /protein_id="AAK74551.1"
FT                   /translation="MTTNRKDEHILYALEQKSSYNSFDEVELIHSSLPLYNLDEIDLST
FT                   EFAGRKWDFPFYINAMTGGSNKGREINQKLAQVAESCGILFVTGSYSAALKNPTDDSFS
FT                   VKSSHPNLLLGTNIGLDKPVELGLQTVEEMNPVLLQVHVNVMQELLMPEGERKFRSWQS
FT                   HLADYSKQIPVPIVLKEVGFGMDAKTIERAYEFGVRTVDLSGRGGTSFAYIENRRSGQR
FT                   DYLNQWGQSTMQALLNAQEWKDKVELLVSGGVRNPLDMIKCLVFGAKAVGLSRTVLELV
FT                   ETYTVEEVIGIVQGWKADLRLIMCSLNCATIADLQKVDYLLYGKLKEAKDQMKKA"
FT   gene            365196..365894
FT                   /locus_tag="SP_0385"
FT   CDS             365196..365894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108483"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74552"
FT                   /protein_id="AAK74552.1"
FT                   /translation="MRKFKIFLFIEACLLTGALILMVSEHFSRFLLILFLFLLLIRYYT
FT                   GKEGNNLLLVAATILFFFIVMLNPFVILAIFVAVIYSLFLLYPMMNQEKEQTNLVFEEV
FT                   VTVKKEKNRWFGNLHHFSSYQTCQFDDINLFRFMGKDTIHLERVILTNHDNVIILRKMV
FT                   GTTKIIVPVDVEVSLSVNCLYGDLIFFNQPKRALRNEHYHQETKDYLKSNKSVKIFLTT
FT                   MIGDVEVVRG"
FT   gene            365891..366886
FT                   /locus_tag="SP_0386"
FT   CDS             365891..366886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0386"
FT                   /product="putative sensor histidine kinase"
FT                   /note="identified by similarity to GP:5830526; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74553"
FT                   /protein_id="AAK74553.1"
FT                   /translation="MKKQAYVIIALTSFLFVFFFSHSLLEILDFDWSIFLHDVEKTEKF
FT                   VFLLLVFSMSMTCLLALFWRGIEELSLRKMQANLKRLLAGQEVVQVADPDLDASFKSLS
FT                   GKLNLLTEALQKAENQSLAQEEEIIEKERKRIARDLHDTVSQELFAAHMILSGISQQAL
FT                   KLDREKMQTQLQSVTAILETAQKDLRVLLLHLRPVELEQKSLIEGIQILLKELEDKSDL
FT                   RVSLKQNMTKLPKKIEEHIFRILQELISNTLRHAQASCLDVYLYQTDVELQLKVVDNGI
FT                   GFQLGSLDDLSYGLRNIKERVEDMAGTVQLLTAPKQGLAVDIRIPLLDKE"
FT   gene            366900..367532
FT                   /locus_tag="SP_0387"
FT   CDS             366900..367532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0387"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74554"
FT                   /protein_id="AAK74554.1"
FT                   /translation="MKILLVDDHEMVRLGLKSYFDLQDDVEVVGEASNGSQGIDLALEL
FT                   RPDVIVMDIVMPEMNGIDATLAILKEWPEAKILIVTSYLDNEKIMPVLDAGAKGYMLKT
FT                   SSADELLHAVSKVAAGELAIEQEVSKKVEYHRNHMELHEELTARERDVLQLIAKGYENQ
FT                   RIADDLFISLKTVKTHVSNILAKLEVSDRTQAAVYAFQHHLVGQEEF"
FT   gene            367636..368301
FT                   /pseudo
FT                   /locus_tag="SP_0388"
FT                   /note="This gene is interrupted by a BOX element which is
FT                   present in many copies in this genome.; conserved
FT                   hypothetical protein; this gene contains a frame shift
FT                   which is not the result of sequencing error; identified by
FT                   similarity to GP:8977912"
FT   gene            368451..368690
FT                   /locus_tag="SP_0389"
FT   CDS             368451..368690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0389"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74555"
FT                   /protein_id="AAK74555.1"
FT                   /translation="MKKTVYKKLGISIIASTLLASQLSTVSALSVISSTGEEYEVSETL
FT                   EKGPESNDSSLSEISPTYGSYYQKQSEVLSVMMI"
FT   gene            368735..369592
FT                   /gene="cbpG"
FT                   /locus_tag="SP_0390"
FT   CDS             368735..369592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbpG"
FT                   /locus_tag="SP_0390"
FT                   /product="choline binding protein G"
FT                   /note="identified by similarity to GP:9454353; match to
FT                   protein family HMM PF00089; match to protein family HMM
FT                   PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74556"
FT                   /protein_id="AAK74556.1"
FT                   /translation="MVLSKYYGVADGMNVEGRGSANFIKDNVLITAAHNYYRHDYGKEA
FT                   DDIYVLPAVSPSQEPFGKIKVKEVRYLKEFRNLNSKDAREYDLALLILEEPIGAKLGTL
FT                   GLPTSQKNLTGITVTITGYPSYNFKIHQMYTDKKQVLSDDGMFLDYQVDTLEGSSGSTV
FT                   YDASHRVVGVHTLGDGANQINSAVKLNERNLPFIYSVLKGYSLEGWKKINGSWYHYRQH
FT                   DKQTGWQEINDTWYYLDSSGKMLTDWQKVNGKWYYLNSNGAMVTGSQTIDGKVYNFASS
FT                   GEWI"
FT   gene            369611..370633
FT                   /gene="cbpF"
FT                   /locus_tag="SP_0391"
FT   CDS             369611..370633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbpF"
FT                   /locus_tag="SP_0391"
FT                   /product="choline binding protein F"
FT                   /note="identified by similarity to GP:9454354; match to
FT                   protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74557"
FT                   /protein_id="AAK74557.1"
FT                   /translation="MKLLKKMMQIALATFFFGLLATNTVFADDSEGWQFVQENGRTYYK
FT                   KGDLKETYWRVIDGKYYYFDPLSGEMVVGWQYIPAPHKGVTIGPSPRIEIALRPDWFYF
FT                   GQDGVLQEFVGKQVLEAKTATNTNKHHGEEYDSQAEKRVYYFEDQRSYHTLKTGWIYEE
FT                   GHWYYLQKDGGFDSRINRLTVGELARGWVKDYPLTYDEEKLKAAPWYYLNPATGIMQTG
FT                   WQYLGNRWYYLHSSGAMATGWYKEGSTWYYLDAENGDMRTGWQNLGNKWYYLRSSGAMA
FT                   TGWYQESSTWYYLNASNGDMKTGWFQVNGNWYYAYDSGALAVNTTVGGYYLNYNGEWVK
FT                   "
FT   gene            complement(370761..371592)
FT                   /pseudo
FT                   /locus_tag="SP_0392"
FT                   /note="IS3-Spn1, transposase, degenerate; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:8163693"
FT   gene            complement(371592..372101)
FT                   /pseudo
FT                   /locus_tag="SP_0393"
FT                   /note="IS3-Spn1, hypothetical protein, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GP:8163692"
FT   gene            372310..374079
FT                   /locus_tag="SP_0394"
FT   CDS             372310..374079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0394"
FT                   /product="PTS system, mannitol-specific IIBC components"
FT                   /note="identified by similarity to EGAD:37996; match to
FT                   protein family HMM PF02302; match to protein family HMM
FT                   PF02378; match to protein family HMM TIGR00851"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74558"
FT                   /db_xref="GOA:Q97SH4"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SH4"
FT                   /protein_id="AAK74558.1"
FT                   /translation="MEEKVSLKVRVQKLGTSLSNMVMPNIGAFIAWGVLTALFIADGYL
FT                   PNEQLATVVGPMLTYLLPILIGYTGGYMIHGQRGAVVGAIATVGAITGSSVPMFIGAMV
FT                   MGPLGGWTIKKFDEKFQEKIRPGFEMLVNNFSAGLVGFALLLLAFYAIGPVVSTLTGAV
FT                   GNGVEAIVNARLLPMANIIIEPAKVLFLNNALNHGIFTPLGVEQVAQAGKSILFLLEAN
FT                   PGPGLGILLAYAVFGKGSAKSSSWGAMVIHFFGGIHEIYFPYVMMKPTLFLAAMAGGIS
FT                   GTFTFQLLDAGLKSPASPGSIIAIIATAPKGVWPHLNVLLGVLVAAVVSFLVAALILHA
FT                   DKSTEDSLEAAQAATQAAKAQSKGQLVSTSVDAVVSTDSVEKIIFACDAGMGSSAMGAS
FT                   ILRDKVKKAGLEIPVSNQAISNLLDTPKTLIVTQEELTPRAKDKSPSAIHVSVDNFLAS
FT                   SRYDEIVASLTGASPIAEIEGDIPTSAPVDSQESDLNHIDAVVVAYGKAQGTATMGCET
FT                   IRAIFRNKNIRIPVSTAKISELGEFNSKNIMIVTTISLQAEVQQAAPNSQFLIVDSLVT
FT                   TPEYDKMAARMYK"
FT   gene            374103..376058
FT                   /locus_tag="SP_0395"
FT   CDS             374103..376058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0395"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by similarity to GP:3025455"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74559"
FT                   /protein_id="AAK74559.1"
FT                   /translation="MLLTKREEQLLKAFLHVGKLSMQDMTEILQVSSRTIYRTLSDLTD
FT                   SMEQYGIEITKHGKYYILTGELDDLPTELEVLVEYSPQERQELITYRLLTESGFVTNEA
FT                   LQECTKVSNVTIIQDISDIDKRLLDFDLKIERQKGYRISGDSVGKRRFLAILLTNCISV
FT                   ADFSTGNFGSFDILEADRTGLASQIVNKQLSGFPDMDARMKMFFAILLSLIGQEQNIEN
FT                   SPNTSKQALEISQKIFQAYSKQTAQFYSIQEIIYFASILDELIIKRQDNPLFTEKFDGE
FT                   FFYNISNLIDTVSMYTKIDFFKDKVLFNFLFHHIRLSLGVPILFQGENLPESIQILVER
FT                   NKFLYTVISLLVNDIFPKYLHTEYEYGMIALHFISSLGRSPEIYPVRVLLLTDERRVTR
FT                   DLLVSKIKSVAPFVELIDIQSLVDYHSIDLSQYDYILSTKPLTNQEIDVISSFPTVKEL
FT                   LELQERLQYVQAHRTIVARDAIAPEKSYDLQDYLISSSQLLSQFELVQLENNQSFEHTV
FT                   EQIIQYQKNVSDRAYLTRKLLSHFQNSPMAIPNTGLVLLHSQSSKVTTNSFTMFELKLP
FT                   ISALSMKREEEEVKRCLLMLMSKEASEEARDLMTAISQSIIENHLYTEIYKTGNQSIIY
FT                   QMLNTIFNEKIKKLEN"
FT   gene            376060..376497
FT                   /gene="mtlF"
FT                   /locus_tag="SP_0396"
FT   CDS             376060..376497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlF"
FT                   /locus_tag="SP_0396"
FT                   /product="PTS system, mannitol-specific IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by similarity to EGAD:14326; match to
FT                   protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74560"
FT                   /protein_id="AAK74560.1"
FT                   /translation="MKLEKHLIKLNKQFSNKEEAICYCGQVLYEGGYVNEDYIEAMIER
FT                   DKELSVYMGNFIAIPHGTDAAKNDVLKSGITVVQVPRGVDFGNVSNPQVATVLFGIAGI
FT                   GNEHLEIIQKISIFCADVDNVLKLADAQSKEEVLRLFDAVE"
FT   gene            376559..377695
FT                   /gene="mtlD"
FT                   /locus_tag="SP_0397"
FT   CDS             376559..377695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="SP_0397"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /EC_number="1.1.1.17"
FT                   /note="identified by similarity to EGAD:16282; match to
FT                   protein family HMM PF01232; match to protein family HMM
FT                   PF08125"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74561"
FT                   /db_xref="GOA:Q97SH1"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SH1"
FT                   /protein_id="AAK74561.1"
FT                   /translation="MKHSVHFGAGNIGRGFIGEILFKNGFHIDFVDVNNQIIHALNEKG
FT                   KYEIEIAQKGQSRIEVTNVAGINSKEHPEQVIEAIQKTDIITTAIGPNILPFIAELLAK
FT                   GIEARRVAGNTQALDVMACENMIGGSQFLYQEVKKYLSPEGLTFADNYIGFPNAAVDRI
FT                   VPAQSHEDSLFVVVEPFNEWVVETKRLKNPDLRLKDVHYEEDLEPFIERKLFSVNSGHA
FT                   TSAYIGAHYGAKTILEALQNPNIKSRIESVLAEIRSLLIAKWNFDKKELENYHKVIIER
FT                   LENPFIVDEVSRVARTPIRKLGYNERFIRPIRELKELSLSYKNLLKTVGYVFDYRDVND
FT                   EESIRLGELLAKQSVKDVVIQVTGLDDQELIEQIVEYI"
FT   gene            377853..378011
FT                   /locus_tag="SP_0398"
FT   CDS             377853..378011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0398"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74562"
FT                   /protein_id="AAK74562.1"
FT                   /translation="MSLIFVVIYKVKEAGQKVFKIGKRQPIGCSKILIGCPLLWKALLD
FT                   FLLRLSF"
FT   gene            378019..378177
FT                   /pseudo
FT                   /locus_tag="SP_0399"
FT                   /note="glutamine ABC transporter, ATP-binding protein,
FT                   truncation; comparison of this gene to its homologs
FT                   suggests this gene has been truncated; identified by
FT                   similarity to EGAD:40185"
FT   gene            378481..379764
FT                   /gene="tig"
FT                   /locus_tag="SP_0400"
FT   CDS             378481..379764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SP_0400"
FT                   /product="trigger factor"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF05697; match to protein
FT                   family HMM PF05698; match to protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74563"
FT                   /db_xref="GOA:Q97SG9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SG9"
FT                   /protein_id="AAK74563.1"
FT                   /translation="MSVSFENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFR
FT                   KGHLPRPIFDQKFGEEALYQDAMNALLPNAYEAAVKEAGLEVVAQPKIDVTSMEKGQDW
FT                   VITAEVVTKPEVKLGDYKNLEVSVDVEKEVTDADVEERIERERNNLAELVIKEAAAENG
FT                   DTVVIDFVGSIDGVEFDGGKGENFSLGLGSGQFIPGFEDQLVGHSAGETVDVIVTFPED
FT                   YQAEDLAGKEAKFVTTIHEVKAKEVPALDDELAKDIDEEVETLADLKEKYSKELAAAKE
FT                   EAYKDAVEGAAIDTAVENAEIVELPEEMIHEEVHRSVNEFLGNLQRQGINPDMYFQITG
FT                   TTQEDLHNQYQAEAESRTKTNLVIEAVAKAEGFDASEEEIQKEVEQLAADYNMEVAQVQ
FT                   NLLSADMLKHDITIKKAVELITSTATVK"
FT   gene            complement(379812..382178)
FT                   /locus_tag="SP_0401"
FT   CDS             complement(379812..382178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0401"
FT                   /product="putative helicase"
FT                   /note="identified by match to protein family HMM TIGR01448"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74564"
FT                   /protein_id="AAK74564.1"
FT                   /translation="MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDFDDFEIIVTG
FT                   TMADVIEGEDYTFWGQIVQHSKYGEQLQISRYDRAKPTSKGLVKYFSSSHFKGIGLKTA
FT                   QKIVDTYGENTIDEILQHPEKLEGIAGLSAKNREAFVSTLRLNYGTEMILAKLANYGIP
FT                   NKLAFQIQDFYKEETLDVVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERFRAGL
FT                   VHSLFQACMETGDTYVEARDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDKVQQID
FT                   TKIFDNSLFFAEEGIRSHLVRILEKGKQKSHDLETIQKHITTVEQELGIEYDNIQKQAI
FT                   CDAIQNKVFILTGGPGTGKTTVINGIIAVYALLEGLDFRKKSNLPILLAAPTGRAARRM
FT                   NELTGLPSATIHRHLGMTGDDDTSHLEDYLDADFIIVDEFSMVDTWLANQLFSNISSNS
FT                   KILIVGDSDQLPSVSPGQVLADLLHIPLIPQTRLEKIYRQSKESTIVTLASQIRQGILP
FT                   ADFTQKKADRSYFEIASGHIPATIEKILGAALRNGIPARDIQVLAPMYRGTAGIDAINQ
FT                   LMQDLLNPPQKDQLSFEAPQCHYRKRDRVIHLVNDAEINVFNGDLGAITDLIPGKYTES
FT                   KQDEIVIDFDGNEVSYPRNEWYKIRLAYAMSIHKSQGSEFPVVILPITSASRRMLERNL
FT                   IYTAITRAKSKLILLGELQAFDYATQHIGTARKTYLIERFSDLLENVEEKQQAVSETVT
FT                   SSASEQSYILTEENWDRIPAMIGITDTDLKEIFGK"
FT   gene            complement(382457..383071)
FT                   /gene="spi"
FT                   /locus_tag="SP_0402"
FT   CDS             complement(382457..383071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spi"
FT                   /locus_tag="SP_0402"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="identified by similarity to SP:O07344; match to
FT                   protein family HMM PF00717; match to protein family HMM
FT                   TIGR02227"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74565"
FT                   /db_xref="GOA:O07344"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/Swiss-Prot:O07344"
FT                   /protein_id="AAK74565.1"
FT                   /translation="MNSFKNFLKEWGLFLLILSLLALSRIFFWSNVRVEGHSMDPTLAD
FT                   GEILFVVKHLPIDRFDIVVAHEEDGNKDIVKRVIGMPGDTIRYENDKLYINDKETDEPY
FT                   LADYIKRFKDDKLQSTYSGKGFEGNKGTFFRSIAQKAQAFTVDVNYNTNFSFTVPEGEY
FT                   LLLGDDRLVSSDSRHVGTFKAKDITGEAKFRLWPITRIGTF"
FT   gene            complement(383075..383956)
FT                   /gene="rnhC"
FT                   /locus_tag="SP_0403"
FT   CDS             complement(383075..383956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhC"
FT                   /locus_tag="SP_0403"
FT                   /product="ribonuclease HIII"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by similarity to SP:O07874; match to
FT                   protein family HMM PF01351; match to protein family HMM
FT                   TIGR00716"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74566"
FT                   /db_xref="GOA:O07874"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR024568"
FT                   /db_xref="UniProtKB/Swiss-Prot:O07874"
FT                   /protein_id="AAK74566.1"
FT                   /translation="MASITLTPSEKDIQAFLEHYQTSLAPSKNPYIRYFLKLPQATVSI
FT                   YTSGKILLQGEGAEKYASFFGYQAVEQTSGQNLPLIGTDEVGNGSYFGGLAVVAAFVTP
FT                   DQHDFLRKLGVGDSKTLTDQKIRQITPILKEKIQHQALLLSPSKYNEVIGDRYNAVSVK
FT                   VALHNQAIYLLLQKGVQPEKIVIDAFTSAKNYDKYLAQEANRFSNPISLEEKAEGKYLS
FT                   VAVSSVIARDLFLENLENLGRELGYQLPSGAGTASDKVASQILQAYGMQGLSFCAKLHF
FT                   KNTEKAKKRLER"
FT   gene            384034..384345
FT                   /locus_tag="SP_0404"
FT   CDS             384034..384345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0404"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74567"
FT                   /protein_id="AAK74567.1"
FT                   /translation="MNFMANLNRFKFTFGKKSLTLTSEHDNLFMEEIAKVATEKYQAIK
FT                   EQMPSADDETIALLLAVNCLSTQLSREIEFDDKEQELEELRHKLVTCKQEQSKIEDSL"
FT   gene            384342..384890
FT                   /locus_tag="SP_0405"
FT   CDS             384342..384890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:107723; match to
FT                   protein family HMM PF02674"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74568"
FT                   /protein_id="AAK74568.1"
FT                   /translation="MISFLLLLVLVWGFYIGYRRGLLLQVYYLISAMASAFMAGQFYKG
FT                   LGEQFHLLLPYANSQEGQGTFFFPSDQLFQLDKVFYAGIGYLLVFGIVYSIGRLLGLLL
FT                   HLIPSKKLGGKLFQVSAGILSMLVTLFVLQMALTILATIPMAVIQNPLEKSIVAKHIIQ
FT                   SIPVTTSWLKQIWVTNLIG"
FT   gene            384994..387330
FT                   /locus_tag="SP_0406"
FT   CDS             384994..387330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0406"
FT                   /product="MutS2 family protein"
FT                   /note="Function of MutS2 is unknown. It should not be
FT                   considered a DNA mismatch repair protein. It is likely a
FT                   DNA mismatch binding protein of unknown cellular function.;
FT                   identified by match to protein family HMM PF00488; match to
FT                   protein family HMM PF01713; match to protein family HMM
FT                   TIGR01069"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74569"
FT                   /db_xref="GOA:Q97SG5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SG5"
FT                   /protein_id="AAK74569.1"
FT                   /translation="MNKKILETLEFDKVKALFEPHLLTEQGLEQLRQLAPTAKADKIKQ
FT                   AFAEMKEMQALFVEQPHFTILSTKEIAGVCKRLEMGADLNIEEFLLLKRVLLASRELQN
FT                   FYTNLENVSLEELALWFEKLHDFPQLQGNLQAFNDAGFIENFASEELARIRRKIHDSES
FT                   QVRDVLQDLLKQKAQLLTEGIVASRNGRQVLPVKNTYRNKIAGVVHDISASGNTVYIEP
FT                   REVVKLSEEIASLRADERYEMLRILQEISERVRPHAAEIANDAWIIGHLDLIRAKVRFI
FT                   QERQAVVPQLSENQEIQLLHVCHPLVKNAVANDVYFGQDLTAIVITGPNTGGKTIMLKT
FT                   LGLTQVMAQSGLPILADKGSRVGIFEEIFADIGDEQSIEQSLSTFSSHMTNIVDILGKV
FT                   NQHSLLLLDELGAGTDPQEGAALAMAILEDLRLRQIKTMATTHYPELKAYGIETAFVQN
FT                   ASMEFDTATLRPTYRFMQGVPGRSNAFEIAKRLGLSEVIVGDASQQIDQDNDVNRIIEQ
FT                   LEEQTLESRKRLDNIREVEQENLKMNRALKKLYNELNREKETELNKAREQAAEIVDMAL
FT                   SESDQILKNLHSKSQLKPHEIIEAKAKLKKLAPEKVDLSKNKVLQKAKKKRAPKVGDDI
FT                   VVLSYGQRGTLTSQLKDGRWEAQVGLIKMTLEEKEFDLVQAQQEKPVKKKQVNVVKRTS
FT                   GRGPQARLDLRGKRYEEAMNELDTFIDQALLNNMAQVDIIHGIGTGVIREGVTKYLQRN
FT                   KHVKSFGYAPQNAGGSGATIVTFKG"
FT   gene            complement(387451..387552)
FT                   /locus_tag="SP_0407"
FT   CDS             complement(387451..387552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0407"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74570"
FT                   /protein_id="AAK74570.1"
FT                   /translation="MSSCLPCPFGAFTVSPEFRPFTVMENQTIPHFY"
FT   gene            387673..388995
FT                   /locus_tag="SP_0408"
FT   CDS             387673..388995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0408"
FT                   /product="sodium:alanine symporter family protein"
FT                   /note="identified by match to protein family HMM PF01235;
FT                   match to protein family HMM TIGR00835"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74571"
FT                   /protein_id="AAK74571.1"
FT                   /translation="MLELLKSIDAFAWGPPLLILLVGTGIYLTIRLGLLQVLRLPKAFQ
FT                   LIFIQDKGHGDVSSFAALCTALASTVGTGNIIGVATAIKVGGPGALFWMWMAAFFGMAT
FT                   KYAEGLLAIKYRTKDDHGAVAGGPMHYILLGMGEKWRPLAVLFAVAGVLVALLGIGTFT
FT                   QVNSIAESIQNTTTISPAITALVLSVFVAIAVFGGLKSISKVSTTVVPFMAIIYILGTL
FT                   TVIFFNIGKIPGTIALVFTSAFSPLAAVGGFAGASVRMAIQNGVARGVFSNESGLGSAP
FT                   IAAAAAKTNEPVEQGLISMTGTFIDTLIICTLTGLTILVTGVWSGDLNGVALTQSAFST
FT                   NFSHFGPALLTIFLVLFAFTTILGWNYYGERCFEFLFGVRFIWLYRVVFVLMVLLGGFI
FT                   ELDMVWIIADIVNALMALPNLIALLVLSPVVIAETKKYFDK"
FT   gene            389213..389761
FT                   /locus_tag="SP_0409"
FT   CDS             389213..389761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:175822; match to
FT                   protein family HMM TIGR00778"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74572"
FT                   /protein_id="AAK74572.1"
FT                   /translation="MTTFTIHTVESAPAEVKEILETVEKDNNGYIPNLIGLLANAPTVL
FT                   EAYQIVSSIHRRNSLTPVEREVVQITAAVTNGCAFCVAGHTAFSIKQIQMNDDLIQALR
FT                   NRTPIETDPKLDTLAKFTLAVINTKGRVGDEALSEFLEAGYTQQNALDVVFGVSLAILC
FT                   NYANNLANTPINPELQPYA"
FT   gene            389871..390770
FT                   /locus_tag="SP_0410"
FT   CDS             389871..390770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0410"
FT                   /product="putative exfoliative toxin"
FT                   /note="identified by similarity to GP:9757655"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74573"
FT                   /protein_id="AAK74573.1"
FT                   /translation="MKKLPLVFSGCLLGLAGAGNLILDTLPVLSHLFSLIGLVLWIYFL
FT                   ILHLFNWKETKQELTKPPLLSGMATFPMAGMILSTYVFRVFSYLPLVAQGIWWFSFLLD
FT                   LTLIAGFTIKFACPGRRVHATPSWTVLYVGIAVAALTYPLVGIIEIAYATLSFGFLLTF
FT                   YLYPLIYSDLKKHPLPLALLGQEGIYCAPFSLLLASLVRVGGTSLPTWVLIVMILASQS
FT                   FFFFVLTRLPNILKQGFQPAFSALTFPTIITATSLKMAQGILKLPFLDYLVLAETIICL
FT                   TILFFVLGAYLIWLRKKV"
FT   gene            complement(390795..392069)
FT                   /gene="serS"
FT                   /locus_tag="SP_0411"
FT   CDS             complement(390795..392069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="SP_0411"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74574"
FT                   /db_xref="GOA:Q97SG0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SG0"
FT                   /protein_id="AAK74574.1"
FT                   /translation="MLDIKRIRTDFEAVAEKLATRGVDAAVLNEMKEIDAKRRNILVKV
FT                   ETLKAERNTVSAEIAQAKRNKENTDDKIAAMQNLSAEVKALDAELAEIDAKLTEFTTTL
FT                   PNIPADSVPVGADEDDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARF
FT                   LFYKGLGARLERAIYNFMLDEHGKEGYTEVITPYIVNHDSMFGTGQYPKFKEDTFELSD
FT                   TNFVLIPTAEVPLTNYYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFH
FT                   KVEMVKFAKPEESYEELEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWI
FT                   PAQNNYREISSCSNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENY
FT                   QNEDGSVTIPEALRPYMGGAEVIKP"
FT   gene            complement(392282..392653)
FT                   /locus_tag="SP_0412"
FT   CDS             complement(392282..392653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:5669858; match to
FT                   protein family HMM PF06115"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74575"
FT                   /protein_id="AAK74575.1"
FT                   /translation="MAQSLNKTVLLSTTGTSYLSIAGKVGKFLVGDQALEFYPDVNVEQ
FT                   FIQIPWSHINQIGANVTGRKISRHFEVFTDKGKFLFASKDSGAILKIAREKLGNDKVVK
FT                   LPTLIQTISQKFKNLFAKK"
FT   gene            complement(392656..394020)
FT                   /locus_tag="SP_0413"
FT   CDS             complement(392656..394020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0413"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="identified by similarity to EGAD:9487; match to
FT                   protein family HMM PF00696; match to protein family HMM
FT                   PF01842; match to protein family HMM TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74576"
FT                   /protein_id="AAK74576.1"
FT                   /translation="MKVVKFGGSSLASASQLEKVLNIVKSDSERRFVVVSAPGKRNAED
FT                   TKVTDALIKYYRDYVAGNDISKNQSWIIDRYAAMVSELGLKPAVLEKISKSIHALATLP
FT                   IEENEFLYDTFLAAGENNNAKLIAAYFNQNGIDARYMHPREAGIVVTSEPGHARIIPSS
FT                   YDKIEELTNTNEVLVIPGFFGVTKENQICTFSRGGSDITGSIIAAGVKADLYENFTDVD
FT                   GIFAAHPGIIHQPHSIPELTYREMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPD
FT                   HPGTRIVLKHSNDEFPVVGIAGDSGFVSINMSKYLMNREVGFGRKVLQILEELNIGWEH
FT                   MPTGIDDLSIILRSRQLTPIKEEEILRQLVQKAKVDHAEIEHDLSIIMIVGEKMKSHIG
FT                   VTATATRALSENKINIQMMSQGSSEVSIMFVVNKDQEKAAIKALYNAFFGESKED"
FT   gene            complement(394104..394208)
FT                   /locus_tag="SP_0414"
FT   CDS             complement(394104..394208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0414"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74577"
FT                   /protein_id="AAK74577.1"
FT                   /translation="MSVKLFHCQSISFLGAESKKKSTESVSADKKGSL"
FT   gene            394345..395130
FT                   /locus_tag="SP_0415"
FT   CDS             394345..395130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0415"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74578"
FT                   /protein_id="AAK74578.1"
FT                   /translation="MEHIIYQLEEDLAILTLNRPEVANGFHIPMCEEILEALTLAEENP
FT                   AVHFILINANGKVFSVGGDLVEMKRAVDEDDIPSLTKIAELVNTISYKIKQIAKPVLME
FT                   VDGAVAGAAANMAVAADFCLATDKAKFIQAFVGVGLAPDAGGIHLLSRSIGVTRAAQLA
FT                   MTGEALTAEKALEWGLVYRVSEAEKLEKTREQLLKKLRRASSNSYAAIKKLVWESQFKD
FT                   WQGYATLELNLQKSLAQTEDFKEGVRAHSERRRPKFTGK"
FT   gene            395224..395658
FT                   /locus_tag="SP_0416"
FT   CDS             395224..395658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0416"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74579"
FT                   /protein_id="AAK74579.1"
FT                   /translation="MDYQRINEYLTSIFNNVLVIEEVNLRGSRFKDISIKEMHTIDVIG
FT                   KAPDVTPSQVSKELMVTLGTVTTSLNNLERKGYIERVRSEQDRRVVHLHLTKKGRLIHR
FT                   LHKRFHKAMVEKIIDGMSEEEIAVMGKGLTNLYQFLEDLK"
FT   gene            395658..396632
FT                   /gene="fabH"
FT                   /locus_tag="SP_0417"
FT   CDS             395658..396632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="SP_0417"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by similarity to EGAD:23257; match to
FT                   protein family HMM TIGR00747"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74580"
FT                   /db_xref="GOA:P0A3C5"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A3C5"
FT                   /protein_id="AAK74580.1"
FT                   /translation="MAFAKISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHI
FT                   SRTESTSDLATEVAKKLMAKAGITGEELDFIILATITPDSMMPSTAARVQANIGANKAF
FT                   AFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSETLSKAVDWSDRSTAVLFGDGAGG
FT                   VLLEASEQEHFLAESLNSDGSRSECLTYGHSGLHSPFSDQESADSFLKMDGRTVFDFAI
FT                   RDVAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEYGNTS
FT                   AASIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI"
FT   gene            396692..396916
FT                   /gene="acpP"
FT                   /locus_tag="SP_0418"
FT   CDS             396692..396916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="SP_0418"
FT                   /product="acyl carrier protein"
FT                   /note="identified by similarity to EGAD:37837; match to
FT                   protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74581"
FT                   /db_xref="GOA:P0A2W0"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2W0"
FT                   /protein_id="AAK74581.1"
FT                   /translation="MAVFEKVQEIIVEELGKDASEVTLESTFDDLDADSLDLFQVISEI
FT                   EDAFDIQIEAENDLKTVGDLVAYVEEQAK"
FT   gene            397035..398009
FT                   /gene="fabK"
FT                   /locus_tag="SP_0419"
FT   CDS             397035..398009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabK"
FT                   /locus_tag="SP_0419"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.3.1.9"
FT                   /note="identified by similarity to GP:9789231; match to
FT                   protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74582"
FT                   /protein_id="AAK74582.1"
FT                   /translation="MKTRITELLKIDYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGN
FT                   APKEVVKANIDKIKSLTDKPFGVNIMLLSPFVEDIVDLVIEEGVKVVTTGAGNPSKYME
FT                   RFHEAGIIVIPVVPSVALAKRMEKIGADAVIAEGMEAGGHIGKLTTMTLVRQVATAISI
FT                   PVIAAGGIADGEGAAAGFMLGAEAVQVGTRFVVAKESNAHPNYKEKILKARDIDTTISA
FT                   QHFGHAVRAIKNQLTRDFELAEKDAFKQEDPDLEIFEQMGAGALAKAVVHGDVDGGSVM
FT                   AGQIAGLVSKEETAEEILKDLYYGAAKKIQEEASRWTGVVRND"
FT   gene            398002..398922
FT                   /gene="fabD"
FT                   /locus_tag="SP_0420"
FT   CDS             398002..398922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="SP_0420"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="identified by similarity to SP:P25715; match to
FT                   protein family HMM PF00698; match to protein family HMM
FT                   TIGR00128"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74583"
FT                   /protein_id="AAK74583.1"
FT                   /translation="MTKTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLR
FT                   YLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGALD
FT                   FEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPA
FT                   QIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTALLEPASQKLAETLAQVSFSDF
FT                   TCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGF
FT                   VKKIDQTAHLAHVEDQASLVALLEK"
FT   gene            398956..399687
FT                   /gene="fabG"
FT                   /locus_tag="SP_0421"
FT   CDS             398956..399687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="SP_0421"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="identified by similarity to EGAD:108288; match to
FT                   protein family HMM PF00106; match to protein family HMM
FT                   PF07993; match to protein family HMM TIGR01830"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74584"
FT                   /protein_id="AAK74584.1"
FT                   /translation="MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELL
FT                   AEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEAD
FT                   FEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGF
FT                   TKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTV
FT                   FLAGQDYLTGQVVAIDGGLSM"
FT   gene            399709..400944
FT                   /gene="fabF"
FT                   /locus_tag="SP_0422"
FT   CDS             399709..400944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="SP_0422"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by similarity to SP:P39435; match to
FT                   protein family HMM PF00109; match to protein family HMM
FT                   PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74585"
FT                   /protein_id="AAK74585.1"
FT                   /translation="MKLNRVVVTGYGVTSPIGNTPEEFWNSLATGKIGIGGITKFDHSD
FT                   FDVHNAAEIQDFPFDKYFVKKDTNRFDNYSLYALYAAQEAVNHANLDVEALNRDRFGVI
FT                   VASGIGGIKEIEDQVLRLHEKGPKRVKPMTLPKALPNMASGNVAMRFGANGVCKSINTA
FT                   CSSSNDAIGDAFRSIKFGFQDVMLVGGTEASITPFAIAGFQALTALSTTEDPTRASIPF
FT                   DKDRNGFVMGEGSGMLVLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPHPEGQGAIK
FT                   AIKLALEEAEISPEQVAYVNAHGTSTPANEKGESGAIVAVLGKEVPVSSTKSFTGHLLG
FT                   AAGAVEAIVTIEAMRHNFVPMTAGTSEVSDYIEANVVYGQGLEKEIPYAISNTFGFGGH
FT                   NAVLAFKRWENR"
FT   gene            400947..401432
FT                   /gene="accB"
FT                   /locus_tag="SP_0423"
FT   CDS             400947..401432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="SP_0423"
FT                   /product="acetyl-CoA carboxylase, bitoin carboxyl carrier
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00364;
FT                   match to protein family HMM TIGR00531"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74586"
FT                   /protein_id="AAK74586.1"
FT                   /translation="MNLNDIKDLMTQFDQSSLREFSYKNGTDELQFSKNEARPVPEVAT
FT                   QVAPAPVLATPSPVAPTSAPAETVAEEVPAPAEASVATEGNLVESPLVGVVYLAAGPDK
FT                   PAFVTVGDSVKKGQTLVIIEAMKVMNEIPAPKDGVVTEILVSNEEMVEFGKGLVRIK"
FT   gene            401429..401851
FT                   /gene="fabZ"
FT                   /locus_tag="SP_0424"
FT   CDS             401429..401851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="SP_0424"
FT                   /product="(3R)-hydroxymyristoyl-(acyl-carrier-protein)
FT                   dehydratase"
FT                   /note="identified by similarity to EGAD:12613; match to
FT                   protein family HMM PF03061; match to protein family HMM
FT                   PF07977; match to protein family HMM TIGR01750"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74587"
FT                   /db_xref="GOA:P59201"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59201"
FT                   /protein_id="AAK74587.1"
FT                   /translation="MIDIQGIKEALPHRYPMLLVDRVLEVSEDTIVAIKNVTINEPFFN
FT                   GHFPQYPVMPGVVIMEALAQTAGVLELSKPENKGKLVFYAGMDKVKFKKQVVPGDQLVM
FT                   TATFVKRRGTIAVVEAKAEVDGKLAASGTLTFAIGN"
FT   gene            401863..403230
FT                   /gene="accC"
FT                   /locus_tag="SP_0425"
FT   CDS             401863..403230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="SP_0425"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by similarity to EGAD:17503; match to
FT                   protein family HMM PF00289; match to protein family HMM
FT                   PF02785; match to protein family HMM PF02786; match to
FT                   protein family HMM TIGR00514"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74588"
FT                   /protein_id="AAK74588.1"
FT                   /translation="MFRKILIANRGEIAVRIIRAARELGIATVAVYSTADKEALHTLLA
FT                   DEAVCIGPGKATESYLNINAVLSAAVLTEAEAIHPGFGFLSENSKFATMCEEVGIKFIG
FT                   PSGHVMDMMGDKINARAQMIKAGVPVIPGSDGEVHNSEEALIVAEKIGYPVMLKASAGG
FT                   GGKGIRKVEKPDDLVSAFETASSEAKANYGNGAMYIERVIYPARHIEVQILGDEHGHVI
FT                   HLGERDCSLQRNNQKVLEESPSIAIGKTLRHEIGAAAVRAAEFVGYENAGTIEFLLDEA
FT                   SSNFYFMEMNTRVQVEHPVTEFVSGVDIVKEQICIAAGQPLSVKQEDIVLRGHAIECRI
FT                   NAENPAFNFAPSPGKITNLYLPSGGVGLRVDSAVYPGYTIPPYYDSMIAKIIVHGENRF
FT                   DALMKMQRALYELEIEGVQTNADFQLDLISDRNVIAGDYDTSFLMETFLPKYQEKE"
FT   gene            403267..404133
FT                   /gene="accD"
FT                   /locus_tag="SP_0426"
FT   CDS             403267..404133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="SP_0426"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM TIGR00515"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74589"
FT                   /db_xref="GOA:P0CC08"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CC08"
FT                   /protein_id="AAK74589.1"
FT                   /translation="MALFSKKDKYIRINPNRSVREKPQAKPEVPDELFSQCPGCKHTIY
FT                   QKDLGSERICPHCSYTFRISAQERLALTIDMGTFKELFTGIESKDPLHFPGYQKKLASM
FT                   REKTGLHEAVVTGTALIKGQTVALGIMDSNFIMASMGTVVGEKITRLFEYATVEKLPVV
FT                   LFTASGGARMQEGIMSLMQMAKISAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGDI
FT                   ILAEPQSLVGFAGRRVIENTVRESLPEDFQKAEFLLEHGFVDAIVKRRDLPDTIASLVR
FT                   LHGGSPR"
FT   gene            404130..404897
FT                   /gene="accA"
FT                   /locus_tag="SP_0427"
FT   CDS             404130..404897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="SP_0427"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM PF03255;
FT                   match to protein family HMM TIGR00513"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74590"
FT                   /db_xref="GOA:Q9FBB7"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBB7"
FT                   /protein_id="AAK74590.1"
FT                   /translation="MNIAKIVREAREQSRLTTLDFATGIFDEFIQLHGDRSFRDDGAVV
FT                   GGIGWLGDQAVTVVGIQKGKSLQDNLKRNFGQPHPEGYRKALRLMKQAEKFGRPVVTFI
FT                   NTAGAYPGVGAEERGQGEAIARNLMEMSDLKVPIIAIIIGEGGSGGALALAVADRVWML
FT                   ENSIYAILSPEGFASILWKDGTRAMEAAELMKITSHELLEMDVVDKVISEIGLSSKELI
FT                   KSVKKELQTELARLSQKPLEELLEERYQRFRKY"
FT   gene            404908..405015
FT                   /locus_tag="SP_0428"
FT   CDS             404908..405015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0428"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74591"
FT                   /protein_id="AAK74591.1"
FT                   /translation="MRLERSHFLWKNVIQVEKLPVEEMGYKIDKKRNIL"
FT   gene            405056..405241
FT                   /locus_tag="SP_0429"
FT   CDS             405056..405241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0429"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74592"
FT                   /protein_id="AAK74592.1"
FT                   /translation="MTGTNTFTVLSTEDLEQTSGGLAVWEDGYSRWLYYREFAPYMRQG
FT                   ALNSYIDAWKYGFRAG"
FT   gene            405214..405732
FT                   /locus_tag="SP_0430"
FT   CDS             405214..405732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0430"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74593"
FT                   /protein_id="AAK74593.1"
FT                   /translation="MEVRLPSRVIFQKSTMRNTKKLRQFGIFLLIILLSTYLPQTIGLY
FT                   VTIILGLGADVYSLILTMGLVGSFLLLIWRLKKKKMLFIFEKKSWNWSFVFYLFATYVV
FT                   YQILGNFWARYAHLINHRNIHDEYFTVLFSNGQPTFLSTILSFVLPVIIGPVFEETLDR
FT                   GYFMNTFFP"
FT   gene            405745..405981
FT                   /locus_tag="SP_0431"
FT   CDS             405745..405981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0431"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74594"
FT                   /protein_id="AAK74594.1"
FT                   /translation="MDVILSAIIFGISHLILSHRDPISLLYYSLIGFFFALVYRSTDNL
FT                   RLTILCHSFFNFLNHAKPIWIFVYNYIYYHFFR"
FT   gene            406163..407469
FT                   /pseudo
FT                   /locus_tag="SP_0432"
FT                   /note="IS1167, transposase, interruption; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:2804700"
FT   gene            complement(407504..407926)
FT                   /gene="nusB"
FT                   /locus_tag="SP_0433"
FT   CDS             complement(407504..407926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="SP_0433"
FT                   /product="N utilization substance protein B"
FT                   /note="identified by similarity to EGAD:24212; match to
FT                   protein family HMM PF01029; match to protein family HMM
FT                   TIGR01951"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74595"
FT                   /db_xref="GOA:P65582"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65582"
FT                   /protein_id="AAK74595.1"
FT                   /translation="MTSPLLESRRQLRKCAFQALMSLEFGTDVETACRFAYTHDREDTD
FT                   VQLPAFLIDLVSGVQAKKEELDKQITQHLKAGWTIERLTLVERNLLRLGVFEITSFDTP
FT                   QLVAVNEAIELAKDFSDQKSARFINGLLSQFVTEEQ"
FT   gene            complement(407919..408308)
FT                   /locus_tag="SP_0434"
FT   CDS             complement(407919..408308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:40949; similarity
FT                   to EGAD:45861; match to protein family HMM PF03780"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74596"
FT                   /protein_id="AAK74596.1"
FT                   /translation="MGIEEQLGEIVIAPRVLEKIIAIATAKVEGVHSFSNRSVSDTLSK
FT                   LSLGRGIYLKNVDEELTADIYLYLEYGVKVPKVAVAIQKAVKDAVRNMADVELAAINIH
FT                   VAGIVPDKTPKPELKDLFDEDFLND"
FT   gene            complement(408330..408890)
FT                   /gene="efp"
FT                   /locus_tag="SP_0435"
FT   CDS             complement(408330..408890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="SP_0435"
FT                   /product="translation elongation factor P"
FT                   /note="identified by similarity to SP:P33398; match to
FT                   protein family HMM PF01132; match to protein family HMM
FT                   PF08207; match to protein family HMM TIGR00038"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74597"
FT                   /db_xref="GOA:P64042"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64042"
FT                   /protein_id="AAK74597.1"
FT                   /translation="MIEASKLKAGMTFETADGKLIRVLEASHHKPGKGNTIMRMKLRDV
FT                   RTGSTFDTSYRPEEKFEQAIIETVPAQYLYKMDDTAYFMNTETYDQYEIPVVNVENELL
FT                   YILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSIKGATVTGSGKPATMETGLVVNV
FT                   PDFIEAGQKLVINTAEGTYVSRA"
FT   gene            complement(409019..410461)
FT                   /gene="gatB"
FT                   /locus_tag="SP_0436"
FT   CDS             complement(409019..410461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="SP_0436"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74598"
FT                   /db_xref="GOA:Q97SE7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SE7"
FT                   /protein_id="AAK74598.1"
FT                   /translation="MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFP
FT                   GVLPVLNKGVVDAGIKAALALNMDIHKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGW
FT                   IEVKLEDGTTKKIGIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPE
FT                   EAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFSNV
FT                   RKGLEYEVQRQAEILRSGGQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDLPLFE
FT                   ISDEWIEEMRTELPEFPKERRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALGGDAK
FT                   QVSNWLQGEVAQFLNAEGKTLEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNG
FT                   GGAREYVEKAGMVQISDPAILIPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATK
FT                   GQANPQVALKLLAQELAKLKEN"
FT   gene            complement(410461..411927)
FT                   /gene="gatA"
FT                   /locus_tag="SP_0437"
FT   CDS             complement(410461..411927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="SP_0437"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74599"
FT                   /db_xref="GOA:Q97SE6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SE6"
FT                   /protein_id="AAK74599.1"
FT                   /translation="MTFNNKTIEELHNLLVSKEISATELTQATLENIKSREEALNSFVT
FT                   IAEEQALVQAKAIDEAGIDADNVLSGIPLAVKDNISTDGILTTAASKMLYNYEPIFDAT
FT                   AVANAKTKGMIVVGKTNMDEFAMGGSGETSHYGATKNAWNHSKVPGGSSSGSAAAVASG
FT                   QVRLSLGSDTGGSIRQPAAFNGIVGLKPTYGTVSRFGLIAFGSSLDQIGPFAPTVKENA
FT                   LLLNAIASEDAKDSTSAPVRIADFTSKIGQDIKGMKIALPKEYLGEGIDPEVKETILNA
FT                   AKHFEKLGAIVEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGYRAEDATNLDEI
FT                   YVNSRSQGFGEEVKRRIMLGTFSLSSGYYDAYYKKAGQVRTLIIQDFEKVFADYDLILG
FT                   PTAPSVAYDLDSLNHDPVAMYLADLLTIPVNLAGLPGISIPAGFSQGLPVGLQLIGPKY
FT                   SEETIYQAAAAFEATTDYHKQQPVIFGGDN"
FT   gene            complement(411927..412229)
FT                   /gene="gatC"
FT                   /locus_tag="SP_0438"
FT   CDS             complement(411927..412229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="SP_0438"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF02686;
FT                   match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74600"
FT                   /db_xref="GOA:Q97SE5"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SE5"
FT                   /protein_id="AAK74600.1"
FT                   /translation="MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVD
FT                   TTGVAPTTTMADRKTVLRPDVAEEGIDRDRLFKNVPEKDNYYIKVPAILDNGGDA"
FT   gene            412442..413986
FT                   /gene="prfC"
FT                   /locus_tag="SP_0439"
FT   CDS             412442..413986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="SP_0439"
FT                   /product="peptide chain release factor 3"
FT                   /note="identified by similarity to SP:P33998; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF03144; match to protein family HMM TIGR00231; match to
FT                   protein family HMM TIGR00503"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74601"
FT                   /db_xref="GOA:Q97SE4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SE4"
FT                   /protein_id="AAK74601.1"
FT                   /translation="MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKG
FT                   KKTGTFAKSDWMDIEKQRGISVTSSVMQFDYDGKRVNILDTPGHEDFSEDTYRTLMAVD
FT                   AAVMVVDSAKGIEAQTKKLFEVVKHRGIPVFTFMNKLDRDGREPLDLLQELEEILGIAS
FT                   YPMNWPIGMGKAFEGLYDLYNQRLELYKGDERFASLEDGDKLFGSNPFYEQVKDDIELL
FT                   NEAGNEFSEEAILAGELTPVFFGSALTNFGVQTFLETFLKFAPEPHGHKKTDGEIVDPY
FT                   DKDFSGFVFKIQANMDPRHRDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAE
FT                   SRENVTNAVAGDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQ
FT                   KSFHKGIEQLVQEGAVQLYKNYQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMNPMGK
FT                   KTVRWIKPEDLDERMSSSRNILAKDRFDQPVFLFENDFALRWFADKYPDVELEEKM"
FT   gene            414269..414753
FT                   /pseudo
FT                   /locus_tag="SP_0440"
FT                   /note="glycosyl transferase, degenerate; this gene contains
FT                   a frame shift which is not the result of sequencing error;
FT                   identified by similarity to GP:6760462"
FT   gene            414869..415057
FT                   /gene="rpmB"
FT                   /locus_tag="SP_0441"
FT   CDS             414869..415057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="SP_0441"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by similarity to EGAD:21484; match to
FT                   protein family HMM PF00830; match to protein family HMM
FT                   TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74602"
FT                   /db_xref="GOA:P66155"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66155"
FT                   /protein_id="AAK74602.1"
FT                   /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRAVKPNLQKVTVLIDGKPK
FT                   KVWASARALKSGKVERV"
FT   gene            415214..415579
FT                   /locus_tag="SP_0442"
FT   CDS             415214..415579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:40949; similarity
FT                   to EGAD:108275; match to protein family HMM PF03780"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74603"
FT                   /protein_id="AAK74603.1"
FT                   /translation="MTVKINTKDGQIELTDEVIATVVGGAATEIFGVVGMASKNALKDN
FT                   FQALLGKENYSKGVVVKAAEDGSIAVDVYTVLSYGTKISEVSKNIQERVAFSLENQLGI
FT                   TAQTVNVYIQNIKVVGE"
FT   gene            415582..417249
FT                   /locus_tag="SP_0443"
FT   CDS             415582..417249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108277; match to
FT                   protein family HMM PF02734"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74604"
FT                   /protein_id="AAK74604.1"
FT                   /translation="MSKITTSLFQEMVQAASTRLNKQAEYVNSLNVFPVPDGDTGTNMG
FT                   MTIENGAKEVADKPASTVGEVASILAKGLLMGARGNSGVITSQLFRGFSQAIKDKDELT
FT                   GQDLALAFQSGVEVAYKAVMKPVEGTILTVSRGAAIGAKKKAEQTDDAVEVMRAALEGA
FT                   KTALAKTPDMLPVLKEVGVVDSGGQGLVFIYEGFLSALTGEYIASEDFVATPANMSEMI
FT                   NVEHHKSVAGHVATEDITFGYCTEIMVALKQGPTYAKDFDYDEFRNYLDELGDSLLVVN
FT                   DDEIVKVHVHTEDPGLVMQEGLKYGSLVKVKVDNMRNQHEAQVEKEATQVIKSAEEKEY
FT                   ALIAVVAGKGLADIFCSQGVDYVIEGGQTMNPSTEDFIKAVEQVNARNIIFLPNNKNIF
FT                   MAAQSAAEVLEQPAVVVEARTLPQGMTSLLAFDPSKSIEENQERMTAALSDVVSGSVTT
FT                   AVRDTTIDGLEIHENDNLGMVDGKILVSNPDMHQTLTETLKHMLDEDSEIVTFYVGEDG
FT                   SEELANEIAQEIVEEFEDVEVEIHQGQQPVYPYLFSVE"
FT   gene            complement(417236..417337)
FT                   /locus_tag="SP_0444"
FT   CDS             complement(417236..417337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0444"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74605"
FT                   /protein_id="AAK74605.1"
FT                   /translation="MNVIFVFIKKIPISFTKKKKELISQSFINLIPH"
FT   gene            417449..419149
FT                   /gene="ilvB"
FT                   /locus_tag="SP_0445"
FT   CDS             417449..419149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="SP_0445"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02776; match to protein
FT                   family HMM TIGR00118"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74606"
FT                   /protein_id="AAK74606.1"
FT                   /translation="MEKISLESPKTGSDLVLETLRDLGVDTIFGYPGGAVLPFYDAIYN
FT                   FKGIRHILGRHEQGCLHEAEGYAKSTGKLGVAVVTSGPGATNAITGIADAMSDSVPLLV
FT                   FTGQVARAGIGKDAFQEADIVGITMPITKYNYQVRETADIPRIITEAVHIATTGRPGPV
FT                   VIDLPKDISALETDFIYSPEVNLPSYQPTLEPNDMQIKKILKQLSKAKKPVLLAGGGIS
FT                   YAEAATELNEFAERYQIPVVTSLLGQGTIATSHPLFLGMGGMHGSFAANIAMTEADFMI
FT                   SIGSRFDDRLTGNPKTFAKNAKVAHIDIDPAEIGKIISADIPVVGDAKKALQMLLAEPT
FT                   VHNNTEKWIEKVTKDKNRVRSYDKKERVVQPQAVIERIGELTNGDAIVVTDVGQHQMWT
FT                   AQYYPYQNERQLVTSGGLGTMGFGIPAAIGAKIANPDKEVVLFVGDGGFQMTNQELAIL
FT                   NIYKVPIKVVMLNNHSLGMVRQWQESFYEGRTSESVFDTLPDFQLMAQAYGIKNYKFDN
FT                   PETLAQDLEVITEDVPMLIEVDISRKEQVLPMVPAGKSNHEMLGVQFHA"
FT   gene            419142..419618
FT                   /gene="ilvN"
FT                   /locus_tag="SP_0446"
FT   CDS             419142..419618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="SP_0446"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM TIGR00119"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74607"
FT                   /protein_id="AAK74607.1"
FT                   /translation="MRRMLTAKLQNRSGVLNRFTGVLSRRQVNIESISVGATEDPNVSR
FT                   ITIIIDVASHDEVEQIIKQLNRQIDVIRIRDITDKPHLEREVILVKMSAPAEKRAEILA
FT                   IIQPFRATVVDVAPSSITIQMTGNAEKSEALLRVIRPYGIRNIARTGATGFTRD"
FT   gene            419696..420706
FT                   /gene="ilvC"
FT                   /locus_tag="SP_0447"
FT   CDS             419696..420706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="SP_0447"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="identified by similarity to EGAD:13826; match to
FT                   protein family HMM PF01450; match to protein family HMM
FT                   PF07991; match to protein family HMM TIGR00465"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74608"
FT                   /db_xref="GOA:Q97SD7"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SD7"
FT                   /protein_id="AAK74608.1"
FT                   /translation="MEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDSGRDVIIGVR
FT                   PGKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAEIAPNLEAGNAVGFAH
FT                   GFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTYEEGFGVPALYAVYQDATGNAKNIAMD
FT                   WCKGVGAARVGLLETTYKEETEEDLFGEQAVLCGGLTALIEAGFEVLTEAGYAPELAYF
FT                   EVLHEMKLIVDLIYEGGFKKMRQSISNTAEYGDYVSGPRVITEQVKENMKAVLADIQNG
FT                   KFANDFVNDYKAGRPKLTAYREQAANLEIEKVGAELRKAMPFVGKNDDDAFKIYN"
FT   gene            420783..421049
FT                   /locus_tag="SP_0448"
FT   CDS             420783..421049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0448"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74609"
FT                   /protein_id="AAK74609.1"
FT                   /translation="MYNVITPSVIVLADQNKADWSYDENAVINIYDDANFEDGRLHMNF
FT                   EQFFKLAQIAREEGLEIHSPFERAGATKSARYIAKWILRNKKH"
FT   gene            421287..421643
FT                   /locus_tag="SP_0449"
FT   CDS             421287..421643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0449"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74610"
FT                   /protein_id="AAK74610.1"
FT                   /translation="MNITNLFSIKTGCDETDRQLQKLFFQLDLQLGELTDQLRKLDSNF
FT                   VPRSQFVDTLDLNDVEYKEILNYFIFHRNDSEESLVEWLYDWISTNRYELPKEFSIRMA
FT                   HKYHESVTEVFGDE"
FT   gene            421693..422943
FT                   /gene="ilvA"
FT                   /locus_tag="SP_0450"
FT   CDS             421693..422943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="SP_0450"
FT                   /product="threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /note="identified by similarity to SP:P37946; match to
FT                   protein family HMM PF00291; match to protein family HMM
FT                   PF00585; match to protein family HMM TIGR02079"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74611"
FT                   /protein_id="AAK74611.1"
FT                   /translation="MLSSKDIIKAHKVLNGVVVNTPLDYDHYLSEKYGAKIYLKKENAQ
FT                   RVRSFKIRGAYYAISQLSKEERERGVVCASAGNHAQGVAYTCNEMKIPATIFMPITTPQ
FT                   QKIGQVRFFGGDFVTIKLVGDTFDASAKAAQEFTVSENRTFIDPFDDAHVQAGQGTVAY
FT                   EILEEARKESIDFDAVLVPVGGGGLIAGVSTYIKETSPEIEVIGVEANGARSMKAAFEA
FT                   GGPVKLKEIDKFADGIAVQKVGQLTYEATRQHIKTLVGVDEGLISETLIDLYSKQGIVA
FT                   EPAGAASIASLEVLAEYIKGKTICCIISGGNNDINRMPEMEERALIYDGIKHYFVVNFP
FT                   QRPGALREFVNDILGPNDDITRFEYIKRASKGTGPVLIGIALADKHDYAGLIRRMEGFD
FT                   PAYINLNGNETLYNMLV"
FT   gene            423678..423893
FT                   /locus_tag="SP_0451"
FT   CDS             423678..423893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0451"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74612"
FT                   /protein_id="AAK74612.1"
FT                   /translation="MAKSNFEKVESVVGWVRDKKITGYRISKETNAREMSIIALAQGRA
FT                   KVKNISFETALGLIDFYEKNYEKFED"
FT   gene            complement(424002..424742)
FT                   /locus_tag="SP_0452"
FT   CDS             complement(424002..424742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0452"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P27675; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74613"
FT                   /protein_id="AAK74613.1"
FT                   /translation="MTQAILEIKHLKKSYGQNEVLKDISLTVHKGEVISIIGSSGSGKS
FT                   TFLRSINLLETPTDGQILYHGQNVLEKGYDLTQYREKLGMVFQSFNLFENLNVLENTIV
FT                   AQTTVLKRERTEAEKIAKENLEKVGMGERYWQAKPKQLSGGQKQRVAIARALSMNPDAI
FT                   LFDEPTSALDPEMVGEVLKIMQDLAQEGLTMIVVTHEMEFARDVSHRVIFMDKGVIAEE
FT                   GKPEDLFTNPKEDRTKEFLQRYLK"
FT   gene            complement(424742..426307)
FT                   /locus_tag="SP_0453"
FT   CDS             complement(424742..426307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0453"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein/permease protein"
FT                   /note="identified by similarity to EGAD:9064; match to
FT                   protein family HMM PF00497; match to protein family HMM
FT                   PF00528; match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74614"
FT                   /protein_id="AAK74614.1"
FT                   /translation="MRKIYLSIFTSLLLMLGLVNVAQADEYLRIGMEAAYAPFNWTQDD
FT                   DSNGAVKIDGTNQYANGYDVQIAKKIAKDLGKEPLVVKTKWEGLVPALTSGKIDMIIAG
FT                   MSPTAERKQEIAFSSSYYTSEPVLLVKKDSAYASAKSLDDFNGAKITSQQGVYLYNLIA
FT                   QIPGAKKETAMGDFAQMRQALEAGVIDAYVSERPEALTAEAANSKFKMIQVEPGFKTGE
FT                   EDTAIAIGLRKNDNRISQINASIETISKDDQVALMDRMIKEQPAEATTTEETSSSFFSQ
FT                   VAKILSENWQQLLRGAGITLLISIVGTIIGLIIGLAIGVFRTAPLSENKVIYGLQKLVG
FT                   WVLNVYIEIFRGTPMIVQSMVIYYGTAQAFGINLDRTLAAIFIVSINTGAYMTEIVRGG
FT                   ILAVDKGQFEAATALGMTHNQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLNVISVV
FT                   ELYFSGNTVATQTYQYFQTFTIIAVIYFVLTFTVTRILRFIERRMDMDTYTTGANQMQT
FT                   EDLK"
FT   gene            426442..428334
FT                   /locus_tag="SP_0454"
FT   CDS             426442..428334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0454"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74615"
FT                   /protein_id="AAK74615.1"
FT                   /translation="MMKKTFFLLVLGLFCLLPLSVFAIDFKINSYQGDLYIHADNTAEF
FT                   RQKIVYQFEEDFKGQIVGLGRAGKMPSGFDIDPHPKIQAAKNGAELADVTSEVTEEADG
FT                   YTVRVYNPGQEGDIVEVDLVWNLKNLLFLYDDIAELNWQPLTDSSESIEKFEFHVRGDK
FT                   GAEKLFFHTGKLFREGTIEKSNLDYTIRLDNLPAKRGVELHAYWPRTDFASARDQGLKG
FT                   NRLEEFNKIEDSIVREKDQSKQLVTWVLPSILSISLLLSVCFYFIYRRKTTPSVKYAKN
FT                   HRLYEPPMELEPMVLSEAVYSTSLEEVSPLVKGAGKFTFDQLIQATLLDVIDRGNVSII
FT                   SEGDAVGLRLVKEDGLSSFEKDCLNLAFSGKKEETLSNLFADYKVSDSLYRRAKVSDEK
FT                   RIQARGLQLKSSFEEVLNQMQEGVRKRVSFWGLPDYYRPLTGGEKALQVGMGALTILPL
FT                   FIGFGLFLYSLDVHGYLYLPLPILGFLGLVLSVFYYWKLRLDNRDGVLNEAGAEVYYLW
FT                   TSFENMLREIARLDQAELESIVVWNRLLVYATLFGYADKVSHLMKVHQIQVENPDINLY
FT                   VAYGWHSTFYHSTAQMSHYASVANTASTYSVSSGSGSSGGGFSGGGGGGSIGAF"
FT   gene            complement(428331..428501)
FT                   /locus_tag="SP_0455"
FT   CDS             complement(428331..428501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0455"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74616"
FT                   /protein_id="AAK74616.1"
FT                   /translation="MKKWTFSRAFCRALKSSPNHQIEIRNSLDKTIDFSYSLSFFYLPL
FT                   YHTFSVYGSSL"
FT   gene            complement(428528..429652)
FT                   /pseudo
FT                   /locus_tag="SP_0456"
FT                   /note="Edited sequence gives a weak match to PF01548 and a
FT                   strong match to PF02371, which are often found together.;
FT                   transposase, IS116/IS110/IS902 family, degenerate; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:9965290"
FT   gene            429907..430752
FT                   /gene="bacA"
FT                   /locus_tag="SP_0457"
FT   CDS             429907..430752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="SP_0457"
FT                   /product="bacitracin resistance protein"
FT                   /note="identified by similarity to EGAD:37519; match to
FT                   protein family HMM PF02673"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74617"
FT                   /db_xref="GOA:P60934"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60934"
FT                   /protein_id="AAK74617.1"
FT                   /translation="MYLIEILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEA
FT                   FMSMFNVVIQLGAILAVMVIYFNKLNPFKPTKDKQEVRKTWRLWLKVLIATLPLLGVFK
FT                   FDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRNKARAIEPSVTELDKLPYTTAFYIGLF
FT                   QVLALLPGTSRSGATIVGGLLNGTSRSVVTEFTFYLGIPVMFGASALKIFKFVKAGELL
FT                   SFGQLFLLLVAMGVAFAVSMVAIRFLTSYVKKHDFTLFGKYRIVLGSVLLLYSFVRLFV
FT                   "
FT   gene            complement(430899..431933)
FT                   /gene="dinP"
FT                   /locus_tag="SP_0458"
FT   CDS             complement(430899..431933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="SP_0458"
FT                   /product="DNA-damage inducible protein P"
FT                   /note="identified by similarity to GP:9946826; match to
FT                   protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74618"
FT                   /db_xref="GOA:Q97SC7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SC7"
FT                   /protein_id="AAK74618.1"
FT                   /translation="MSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSDPRQTGGRGVV
FT                   STCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKSVGLQIRAIFKRYTDLIEPM
FT                   SIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGVSYNKFLAKMASDYQKPH
FT                   GLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLIDRFGRL
FT                   GYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILLAEEDIKKELTLLSEKVALNLHQQ
FT                   EKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQISQIALQLYEELSKKERGVRLLGIT
FT                   MTGF"
FT   gene            432308..434632
FT                   /gene="pfl"
FT                   /locus_tag="SP_0459"
FT   CDS             432308..434632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfl"
FT                   /locus_tag="SP_0459"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.5"
FT                   /note="identified by similarity to EGAD:40969; match to
FT                   protein family HMM PF01228; match to protein family HMM
FT                   PF02901; match to protein family HMM TIGR01255"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74619"
FT                   /protein_id="AAK74619.1"
FT                   /translation="MVVKTVVEAQDIFDKAWEGFKGVDWKEKASVSRFVQANYTPYDGD
FT                   ESFLAGPTERSLHIKKIVEETKAHYEETRFPMDTRPTSIADIPAGFIDKENEVIFGIQN
FT                   DELFKLNFMPKGGIRMAETTLKENGYEPDPAVHEIFTKYVTTVNDGIFRAYTSNIRRAR
FT                   HAHTVTGLPDAYSRGRIIGVYARLALYGADYLMQEKVNDWNAIKEIDEETIRLREEVNL
FT                   QYQALQQVVRLGDLYGVDVRKPAMNVKEAIQWVNIAFMAVCRVINGAATSLGRVPIVLD
FT                   IFAERDLARGTFTESEIQEFVDDFVMKLRTVKFARTKAYDQLYSGDPTFITTSMAGMGN
FT                   DGRHRVTKMDYRFLNTLDNIGNSPEPNLTVLWTDKLPYNFRRYCMHMSHKHSSIQYEGV
FT                   TTMAKDGYGEMSCISCCVSPLDPENEEQRHNIQYFGARVNVLKALLTGLNGGYDDVHKD
FT                   YKVFDIEPIRDEVLEFESVKANFEKSLDWLTDTYVDALNIIHYMTDRYNYEAVQMAFLP
FT                   TKQRANMGFGICGFANTVDTLSAIKYATVKPIRDEDGYIYDYETIGDYPRWGEDDPRSN
FT                   ELAEWLIEAYTTRLRSHKLYKDAEATVSLLTITSNVAYSKQTGNSPVHKGVYLNEDGSV
FT                   NLSKLEFFSPGANPSNKAKGGWLQNLNSLSSLDFSYAADGISLTTQVSPRALGKTRDEQ
FT                   VDNLVTILDGYFENGGQHVNLNVMDLNDVYEKIMSGEDVIVRISGYCVNTKYLTPEQKT
FT                   ELTQRVFHEVLSMDDALDALS"
FT   gene            complement(434770..436038)
FT                   /locus_tag="SP_0460"
FT   CDS             complement(434770..436038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0460"
FT                   /product="IS1167, transposase"
FT                   /note="identified by similarity to GP:2804700; match to
FT                   protein family HMM PF01610"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74620"
FT                   /protein_id="AAK74620.1"
FT                   /translation="MEHINHTTLLIGIKDKNITLNKAIQHDTHIEVFATLDYHPPKCKH
FT                   CKGKQIKYDFQKPSKIPFIEIGGFPSLIHLKKRRFQCKSCRKVTVAETTLVQKNCQISE
FT                   MVRQKIAQLLLNREALTHIASKLAISTSTSTSTVYRKLKQFHFQEDYTTLPEILSWDEF
FT                   SYQKGKLAFIAQDFNTKKIMTILDNRRQTTIRNHFFKYSKEARKKVKVVTVDMSGSYIP
FT                   LIKKLFPNAKIVLDRFHIVQHMSRALNQTRINIMKQFDDKSLEYRALKYYWKFILKDSR
FT                   KLSLKPFYARTFRETLTPRECLKKIFTLVPELKDYYDLYQLLLFHLQEKNTDQFWGLIQ
FT                   DTLPHLNRTFKTTLSTFICYKNYITNAIELPYSNAKLEATNKLIKDIKRNAFGFRNFEN
FT                   FKKRIFIALNIKKERTKFVLSQA"
FT   gene            complement(436303..437832)
FT                   /locus_tag="SP_0461"
FT   CDS             complement(436303..437832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0461"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by similarity to GP:1289510; match to
FT                   protein family HMM PF07003"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74621"
FT                   /protein_id="AAK74621.1"
FT                   /translation="MLNKYIEKRITDKITILNILLDIRSIELDELSTLTSLQSKSLLSI
FT                   LQELQETFEEELTFNLDTQQVQLIEHHSHQTNYYFHQLYNQSTILKILRFFLLQGNQSF
FT                   NEFTQKEYISIATGYRVRQKCGLLLRSVGLDLVKNQVVGPEYRIRFLIALLQFHFGIEI
FT                   YDLNDGSMDWVTHMIVQSNSQLSHELLEITPDEYVHFSILVALTWKRREFPLEFPESKE
FT                   FEKLKNLFMYPILMEHCQTYLEPHANMTFTQEELDYIFLVYCSANSSFSKDKWNQEKKT
FT                   HTIQLILQHTRGKHLLSKFKNILGNDISNSLSFLTALTFLTRTFLFGLQNLVPYYNYYE
FT                   HYGIESDKPLYHISKAIVQEWMTEQKIEGVIDQHRLYLFSLYLTETIFSSLPAIPIFII
FT                   LNNQADVNLIKSIILRNFTDKVASVTGYNILISPPPSEEHLTEPLIIITTKEYLPYVKK
FT                   QYPKGKHHFLTIALDLHVSQQRLIYQTIVDIRKEAFDKRVAMIAKKAHYLL"
FT   gene            438327..441008
FT                   /locus_tag="SP_0462"
FT   CDS             438327..441008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0462"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by similarity to GP:4927374; match to
FT                   protein family HMM PF00092; match to protein family HMM
FT                   PF05738"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74622"
FT                   /protein_id="AAK74622.1"
FT                   /translation="MLNRETHMKKVRKIFQKAVAGLCCISQLTAFSSIVALAETPETSP
FT                   AIGKVVIKETGEGGALLGDAVFELKNNTDGTTVSQRTEAQTGEAIFSNIKPGTYTLTEA
FT                   QPPVGYKPSTKQWTVEVEKNGRTTVQGEQVENREEALSDQYPQTGTYPDVQTPYQIIKV
FT                   DGSEKNGQHKALNPNPYERVIPEGTLSKRIYQVNNLDDNQYGIELTVSGKTVYEQKDKS
FT                   VPLDVVILLDNSNSMSNIRNKNARRAERAGEATRSLIDKITSDSENRVALVTYASTIFD
FT                   GTEFTVEKGVADKNGKRLNDSLFWNYDQTSFTTNTKDYSYLKLTNDKNDIVELKNKVPT
FT                   EAEDHDGNRLMYQFGATFTQKALMKADEILTQQARQNSQKVIFHITDGVPTMSYPINFN
FT                   HATFAPSYQNQLNAFFSKSPNKDGILLSDFITQATSGEHTIVRGDGQSYQMFTDKTVYE
FT                   KGAPAAFPVKPEKYSEMKAAGYAVIGDPINGGYIWLNWRESILAYPFNSNTAKITNHGD
FT                   PTRWYYNGNIAPDGYDVFTVGIGINGDPGTDEATATSFMQSISSKPENYTNVTDTTKIL
FT                   EQLNRYFHTIVTEKKSIENGTITDPMGELIDLQLGTDGRFDPADYTLTANDGSRLENGQ
FT                   AVGGPQNDGGLLKNAKVLYDTTEKRIRVTGLYLGTDEKVTLTYNVRLNDEFVSNKFYDT
FT                   NGRTTLHPKEVEQNTVRDFPIPKIRDVRKYPEITISKEKKLGDIEFIKVNKNDKKPLRG
FT                   AVFSLQKQHPDYPDIYGAIDQNGTYQNVRTGEDGKLTFKNLSDGKYRLFENSEPAGYKP
FT                   VQNKPIVAFQIVNGEVRDVTSIVPQDIPAGYEFTNDKHYITNEPIPPKREYPRTGGIGM
FT                   LPFYLIGCMMMGGVLLYTRKHP"
FT   gene            441232..443229
FT                   /locus_tag="SP_0463"
FT   CDS             441232..443229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0463"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF05738; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74623"
FT                   /protein_id="AAK74623.1"
FT                   /translation="MKSINKFLTMLAALLLTASSLFSAATVFAAGTTTTSVTVHKLLAT
FT                   DGDMDKIANELETGNYAGNKVGVLPANAKEIAGVMFVWTNTNNEIIDENGQTLGVNIDP
FT                   QTFKLSGAMPATAMKKLTEAEGAKFNTANLPAAKYKIYEIHSLSTYVGEDGATLTGSKA
FT                   VPIEIELPLNDVVDAHVYPKNTEAKPKIDKDFKGKANPDTPRVDKDTPVNHQVGDVVEY
FT                   EIVTKIPALANYATANWSDRMTEGLAFNKGTVKVTVDDVALEAGDYALTEVATGFDLKL
FT                   TDAGLAKVNDQNAEKTVKITYSATLNDKAIVEVPESNDVTFNYGNNPDHGNTPKPNKPN
FT                   ENGDLTLTKTWVDATGAPIPAGAEATFDLVNAQTGKVVQTVTLTTDKNTVTVNGLDKNT
FT                   EYKFVERSIKGYSADYQEITTAGEIAVKNWKDENPKPLDPTEPKVVTYGKKFVKVNDKD
FT                   NRLAGAEFVIANADNAGQYLARKADKVSQEEKQLVVTTKDALDRAVAAYNALTAQQQTQ
FT                   QEKEKVDKAQAAYNAAVIAANNAFEWVADKDNENVVKLVSDAQGRFEITGLLAGTYYLE
FT                   ETKQPAGYALLTSRQKFEVTATSYSATGQGIEYTAGSGKDDATKVVNKKITIPQTGGIG
FT                   TIIFAVAGAAIMGIAVYAYVKNNKDEDQLA"
FT   gene            443276..444457
FT                   /locus_tag="SP_0464"
FT   CDS             443276..444457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0464"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by similarity to EGAD:33100; match to
FT                   protein family HMM PF05738; match to protein family HMM
FT                   TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74624"
FT                   /protein_id="AAK74624.1"
FT                   /translation="MISRIFFVMALCFSLVWGAHAVQAQEDHTLVLQLENYQEVVSQLP
FT                   SRDGHRLQVWKLDDSYSYDDRVQIVRDLHSWDENKLSSFKKTSFEMTFLENQIEVSHIP
FT                   NGLYYVRSIIQTDAVSYPAEFLFEMTDQTVEPLVIVAKKTDTMTTKVKLIKVDQDHNRL
FT                   EGVGFKLVSVARDVSEKEVPLIGEYRYSSSGQVGRTLYTDKNGEIFVTNLPLGNYRFKE
FT                   VEPLAGYAVTTLDTDVQLVDHQLVTITVVNQKLPRGNVDFMKVDGRTNTSLQGAMFKVM
FT                   KEESGHYTPVLQNGKEVVVTSGKDGRFRVEGLEYGTYYLWELQAPTGYVQLTSPVSFTI
FT                   GKDTRKELVTVVKNNKRPRIDVPDTGEETLYILMLVAILLFGSGYYLTKKPNN"
FT   gene            complement(444676..444807)
FT                   /locus_tag="SP_0465"
FT   CDS             complement(444676..444807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0465"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74625"
FT                   /protein_id="AAK74625.1"
FT                   /translation="MFLPFLSASLYLQTHHFIAFPNRQSYLLRETRKSHFFLIHHPF"
FT   gene            444858..445697
FT                   /locus_tag="SP_0466"
FT   CDS             444858..445697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0466"
FT                   /product="putative sortase"
FT                   /note="identified by similarity to GP:3036999; match to
FT                   protein family HMM PF04203; match to protein family HMM
FT                   TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74626"
FT                   /protein_id="AAK74626.1"
FT                   /translation="MAVMAYPLVSRLYYRVESNQQIADFDKEKATLDEADIDERMKLAQ
FT                   AFNDSLNNVVSGDPWSEEMKKKGRAEYARMLEIHERMGHVEIPVIDVDLPVYAGTAEEV
FT                   LQQGAGHLEGTSLPIGGNSTHAVITAHTGLPTAKMFTDLTKLKVGDKFYVHNIKEVMAY
FT                   QVDQVKVIEPTNFDDLLIVPGHDYVTLLTCTPYMINTHRLLVRGHRIPYVAEVEEEFIA
FT                   ANKLSHLYRYLFYVAVGLIVILLWIIRRLRKKKKQPEKALKALKAARKEVKVEDGQQ"
FT   gene            445792..446577
FT                   /locus_tag="SP_0467"
FT   CDS             445792..446577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0467"
FT                   /product="putative sortase"
FT                   /note="identified by similarity to GP:3036999; match to
FT                   protein family HMM PF04203; match to protein family HMM
FT                   TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74627"
FT                   /protein_id="AAK74627.1"
FT                   /translation="MSRYYYRIESNEVIKEFDETVSQMDKAELEERWRLAQAFNATLKP
FT                   SEILDPFTEQEKKKGVSEYANMLKVHERIGYVEIPAIDQEIPMYVGTSEDILQKGAGLL
FT                   EGASLPVGGENTHTVITAHRGLPTAELFSQLDKMKKGDIFYLHVLDQVLAYQVDQIVTV
FT                   EPNDFEPVLIQHGEDYATLLTCTPYMINSHRLLVRGKRIPYTAPIAERNRAVRERGQFW
FT                   LWLLLGAMAVILLLLYRVYRNRRIVKGLEKQLEGRHVKD"
FT   gene            446564..447415
FT                   /locus_tag="SP_0468"
FT   CDS             446564..447415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0468"
FT                   /product="putative sortase"
FT                   /note="identified by similarity to GP:3036999; match to
FT                   protein family HMM PF04203; match to protein family HMM
FT                   TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74628"
FT                   /protein_id="AAK74628.1"
FT                   /translation="MSRTKLRALLGYLLMLVACLIPIYCFGQMVLQSLGQVKGHATFVK
FT                   SMTTEMYQEQQNHSLAYNQRLASQNRIVDPFLAEGYEVNYQVSDDPDAVYGYLSIPSLE
FT                   IMEPVYLGADYHHLGMGLAHVDGTPLPLDGTGIRSVIAGHRAEPSHVFFRHLDQLKVGD
FT                   ALYYDNGQEIVEYQMMDTEIILPSEWEKLESVSSKNIMTLITCDPIPTFNKRLLVNFER
FT                   VAVYQKSDPQTAAVARVAFTKEGQSVSRVATSQWLYRGLVVLAFLGILFVLWKLARLLR
FT                   GK"
FT   gene            complement(447488..448764)
FT                   /pseudo
FT                   /locus_tag="SP_0469"
FT                   /note="IS1167, transposase, interruption; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:2804700"
FT   gene            complement(448879..449028)
FT                   /locus_tag="SP_0470"
FT   CDS             complement(448879..449028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0470"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74629"
FT                   /protein_id="AAK74629.1"
FT                   /translation="MDKMKPVFQALNKELIQENLTLTIICVGGYVLEYHGLRATQDVDA
FT                   FMAL"
FT   gene            complement(449021..449305)
FT                   /locus_tag="SP_0471"
FT   CDS             complement(449021..449305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:35678"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74630"
FT                   /protein_id="AAK74630.1"
FT                   /translation="MDWYDYMIQASKQSQFNASHWFRYLRKVIFEDYSYLTNQDVEKLL
FT                   DSKELTRFQKISLKYAFQEHTPTHKYVISLNKPAKLTNVQKLMEKYKHG"
FT   gene            449697..449870
FT                   /locus_tag="SP_0472"
FT   CDS             449697..449870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0472"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74631"
FT                   /protein_id="AAK74631.1"
FT                   /translation="MLIINRFFSLFVLDWYRTELWINTLVSYPVPKYVGRKMKQLLRVS
FT                   VLEKILSIEFFK"
FT   gene            complement(450739..451962)
FT                   /locus_tag="SP_0473"
FT   CDS             complement(450739..451962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0473"
FT                   /product="putative regulator"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74632"
FT                   /protein_id="AAK74632.1"
FT                   /translation="MITKQSAFLQNRATILEFLYRNPATSRTDIVNETGLTPATTTNII
FT                   KELSEQSLIYETGDEFSEFSGSGRRRKTISITDNIPYVVGGIEINVLGIFLSLCDLQGK
FT                   TLFETEILNEDYPISEINSTITNMIKTAIEYVPLETKLLGFGLSIPGHYNKDSGSIITN
FT                   NPIWESFNLLNVIKRFNFPFIVKNNIDCMAIGQYLFNPHNTPDNFIFLHAGLGIYTSFF
FT                   TKEKIGASKNPYIGEIGHTIVELNGQYCECGKKGCLQTYISDAWLIKHAQLLFKNSQLT
FT                   VLKSLVKTEKDIHLDTLLTAYNLGDSALRQQIDKGVNLLATSIANLLLINPADKIYINS
FT                   QLLNYQPFTHEVRDKIQDQLHFVPFTRNIEIEILPYNKHRGSIGACALAIVAFFIEHSN
FT                   VLQDIISP"
FT   gene            452130..453452
FT                   /locus_tag="SP_0474"
FT   CDS             452130..453452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0474"
FT                   /product="PTS system, cellobiose-specific IIC component"
FT                   /note="identified by similarity to EGAD:14179; match to
FT                   protein family HMM PF02378; match to protein family HMM
FT                   TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74633"
FT                   /protein_id="AAK74633.1"
FT                   /translation="MNNILAFLETKVAPFGEKVGNQRHLKAIREGFMMAMPLILVGSLF
FT                   LILISWPQEAFTNWLNSVGLLSILTTMNQSTVAIISLVACFGIAYRLSEGYGTDGPSAG
FT                   IIALSSFVLMAPRFSSMVYDKNGEQVKQLFGGAIPFSSLNASSLFMAITIGLVTAEIYR
FT                   MFIQRGITIKMPSGVPDVVSKSFSALLSGFTTFVLWALVLKGLEAAGVAGGLNGLLGAI
FT                   VGTPLKLIAGTLPGMILCVIVNSFFWFCGVNGGQVLNAFVDPVWLQFTTENQEAVAAGQ
FT                   TLQHIITLPFKDLFVFIGGGGATIGLAICLFLFSKSRANKTLGKLAIIPSIFNINTAIL
FT                   FTFPTVLNPIMLIPFIATPTINALITYVSMAVGLVPYTTGVILPWTMPPIIGGFLATGA
FT                   SWRGALLQVVLILVSVAIYYPFFKIADKRNLEKEKATVGGK"
FT   gene            453400..455340
FT                   /locus_tag="SP_0475"
FT   CDS             453400..455340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0475"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74634"
FT                   /protein_id="AAK74634.1"
FT                   /translation="MQINAILKKKKLLLEGNKMVIRVFDQQKNTYSSFALEELSYYMNR
FT                   VFKTNIELVEEKEADIFVGLVNKEDRKDHVLISLDKGKGRIESNTIVGLLIGIYRMFHE
FT                   FGVVYTRPGRRHDFVPELRFEDFLDKQLSIDETASYYHRGVCIEGADSFENILDFIDWL
FT                   PKIGMNSFFIQFENPYSFLKRWYEHEFNPYLNKEQFSNELVQELSDRLDKELQKRGLIH
FT                   HRVGHGWTGEVLGYSSKFGWESGLSISEEKKPYVAEINGKRELFNTAPILTSLDFSNPD
FT                   VADKMVEIIKDYAKKRPDVNYLHVWLSDARNNICECENCRQELVSDQYIRILNQLDRAL
FT                   TSEGLDTKICFLLYHELLWAPQKEKLDNPERFTMMFAPITRTFEMSYADVDFDNSIPTP
FT                   KPYMRNKIILPNSLEENLSYLFEWQKAFKGDSFVYDYPLGRAHYGDLGYMKISQTIYRD
FT                   VSYLSNLHLNGYISCQELRAGFPHNFPNYVMGEMLWKKTRSYEELIEEYFSALYGENWQ
FT                   SVVEYLEKLSIYSSCDYFNAIGSRQSDVLANHYYIAYNLADNFLPIIEENISKLLNSQK
FT                   DEWKQLSYHREYVVKMAKALYLQATGKTRQAQDEWRNVLNYIRGHELLFQSNLDVYRVI
FT                   EVAKNYAGFHL"
FT   gene            455508..455852
FT                   /gene="lacF-1"
FT                   /locus_tag="SP_0476"
FT   CDS             455508..455852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacF-1"
FT                   /locus_tag="SP_0476"
FT                   /product="PTS system, lactose-specific IIA component"
FT                   /note="identified by similarity to SP:P23532; match to
FT                   protein family HMM PF02255"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74635"
FT                   /protein_id="AAK74635.1"
FT                   /translation="MKSKEEINMLGFTIVAYAGDARSDLMDALAFARDGYFEQARELVE
FT                   SANDSIVSAHREQTNLLAEEAYGDNFEVSFIMIHGQDTLMTTMLLYDQVKFFIDEYERI
FT                   RKIEEHIGLQ"
FT   gene            455862..457274
FT                   /gene="lacG-1"
FT                   /locus_tag="SP_0477"
FT   CDS             455862..457274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacG-1"
FT                   /locus_tag="SP_0477"
FT                   /product="6-phospho-beta-galactosidase"
FT                   /EC_number="3.2.1.85"
FT                   /note="identified by similarity to EGAD:17554; match to
FT                   protein family HMM PF00232; match to protein family HMM
FT                   TIGR01233"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74636"
FT                   /db_xref="GOA:Q97SA9"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR005928"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SA9"
FT                   /protein_id="AAK74636.1"
FT                   /translation="MENLQVKALPKEFLLGTATAAYQVEGATRVDGKGINMWDVYLQEN
FT                   SPFLPDPASDFYYRYEEDIALAAEHGLQALRLSISWVRIFPDIDGDANVLAVHYYHRVF
FT                   QSCLKHNVIPFVSLHHFDSPQKMLETGDWLNRENIDRFIRYARFCFQEFTEVKHWFTIN
FT                   ELMSLAAGQYIGGQFPPNHHFQLSEAIQANHNMLLAHALAVLEFHQLGIEGKVGCIHAL
FT                   KPGYPIDGQKENILAAKRYDVYNNKFLLDGTFLGYYSEDTLFHLNQILEANNSSFIIED
FT                   GDLEIMKRAAPLNTMFGMNYYRSEFIREYKGENRQEFNSTGIKGQSSFKLNALGEFVKK
FT                   PGIPTTDWDWNIYPQGLFDMLLRIKEEYPQHPVIYLTENGTALKEVKPEGENDIIDDSK
FT                   RIRYIEQHLHKVLEARDRGVNIQGYFIWSLQDQFSWANGYNKRYGLFFVDYETQKRYIK
FT                   KSALWVKGLKRN"
FT   gene            457343..459022
FT                   /gene="lacE-1"
FT                   /locus_tag="SP_0478"
FT   CDS             457343..459022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacE-1"
FT                   /locus_tag="SP_0478"
FT                   /product="PTS system, lactose-specific IIBC components"
FT                   /note="identified by similarity to EGAD:15299; match to
FT                   protein family HMM PF02302; match to protein family HMM
FT                   PF02378; match to protein family HMM TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74637"
FT                   /protein_id="AAK74637.1"
FT                   /translation="MDKLVAAIEKQQGKFEKISTNNYMMAIKDGFIATMPLIMFSSFLM
FT                   IIIMIPKNFGVELPSPAIVWMRKVYMLTMGVLGIIVSGTVGKSLVGNVNRKMPHGKVIN
FT                   DISAMLAAICSYLVLTVTLVVDEKTGSTSLSTNYLGSQGLITSFVSAFITVNVYRFCIK
FT                   RDITIHLPKEVPGAISQAFRDIFPFSFVLLISGLLDIVSRFSLDVPFAQVFQQLLTPIF
FT                   KGAESYPAMMLIWFMCALLWFVGIHGPSIVLPAVTALQLSNMEENAQLLANGQFPYHSL
FT                   TPNFGNYIAAIGGTGATFVVPFILIFFMRSKQLKSVGKATITPVLFAVNEPLLFGMPVI
FT                   LNPYLFVPFLMTPPVNVFLGKVFIDFFGMNGFYIQLPWTFPGPLGLLIGTNFQLISFVF
FT                   LSLILVVDILIYLPFCRAYDRQLLVKEDIASSNDIILEEDTSEIIPGEIDEIKSKELKV
FT                   LVLCAGSGTSAQLANAINEGANLTEVRVIANSGAYGAHYDIMGVYDLIILAPQVRSYYR
FT                   EMKVDAERLGIQIVATRGMEYIHLTKSPSKALQFVLEHYQAV"
FT   gene            complement(459148..460587)
FT                   /locus_tag="SP_0479"
FT   CDS             complement(459148..460587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0479"
FT                   /product="potassium uptake protein, Trk family"
FT                   /note="identified by similarity to EGAD:46463; match to
FT                   protein family HMM PF02386"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74638"
FT                   /protein_id="AAK74638.1"
FT                   /translation="MNKSMIRYLLSKLLLIEAVLLLVPVAIAVYYRESSQVFTALFSTI
FT                   GILVLLGGSGSLQKPKNQRIYAKEGVLIVALCWILWSFFGGLPFVFSGQIPSLIDAFFE
FT                   ISSGFTTTGASILNDVSVLSRSLLFWRSFTHLIGGMGVLVFALAIMDNAKNSHLEVMKA
FT                   EVPGPVFGKVVSKLKNTAQILYLLYLALFSLFVIIYYLAGMPLYDSFVIAMGTAGTGGF
FT                   TVYNDGIAHYGSSLITYLVSIGVLVFGVNFNLYYYLMLRRIKAFFGDEELRAYLVIVLV
FT                   STGLISLNTLYLYPGFSKSFEMTFFQVSNIITTTGFGYGDITNWPLFSQFILLFLMAIG
FT                   GSAGSTAGGLKIIRGLILSKIAKNQILSILSPHRVLTLHVNKTVIDKDTQHKILKYFVI
FT                   YAMILLALIFIVSLDSNDFLVVTSAVFSCFNNIGPILGTTSSFSIFSPISKILLSFAMI
FT                   AGRLEIYPILLLFMKRTWSKR"
FT   gene            complement(460591..461940)
FT                   /locus_tag="SP_0480"
FT   CDS             complement(460591..461940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0480"
FT                   /product="potassium uptake protein, Trk family"
FT                   /note="identified by similarity to EGAD:16153; match to
FT                   protein family HMM PF02080; match to protein family HMM
FT                   PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74639"
FT                   /protein_id="AAK74639.1"
FT                   /translation="MKIILVGGGKVGFALCRSLVAEKHDVLLIEQDEAVLNHIVSRFDI
FT                   IGILGNGADFAILEQASVQDCDIFIALTEHDEVNMIAAVLAKKMGAKETIVRVRNPEYS
FT                   NSYFKEKNILGFSLIVNPELLAARAIANIIDFPNALSVERFAGGRVSLMEFVVKSTSGL
FT                   CQMPISDFRKKFGNVIVCAIERDHQIIIPSGDMTVQDKDRIFVTGNRVDMILFHNYFKS
FT                   RAVKSLLIVGAGRIAYYLLGILKDSRIDTKVIEINPEIASFFSEKFPNLYIVQGDGTAK
FT                   DILLEESAQHYDAVATLTGVDEENLITSMFLDRVGVQKNITKVNRTSLLEIINAPDFSS
FT                   IITPKSIAVDTIMHFIRGRVNAQYSDLQAMHHLANGQIETLQFHIKEANKMTAKPLSQL
FT                   KLKKGVLIAAIIRKGKTIFPTGEDMLEVGDKLLVTTLLPNITKIYDLIAR"
FT   gene            462101..462976
FT                   /locus_tag="SP_0481"
FT   CDS             462101..462976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:89137; match to
FT                   protein family HMM PF01887"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74640"
FT                   /protein_id="AAK74640.1"
FT                   /translation="MIKDIQGDKMNNNLLVLQSDFGLVDGAVSAMIGVALEESPTLKIH
FT                   HLTHDITPYNIFEGSYRLFQTVDYWPEGTTFVSVVDPGVGSKRKSVVAKTAKNQYIVTP
FT                   DNGTLSFIKKHVGIVAIREISEVANRRQNTEHSYTFHGRDVYAYTGAKLASGHITFEEV
FT                   GPELSVEQIVELPVVATIIEDHLVKGAIDILDVRFGSLWTSITREEFYKLEPEFGDRFE
FT                   VTIYHADMLVYQNQVVYGKSFADVRIGQPILYINSLYRLGLAINQGSFAKAYNVGVGSS
FT                   WTIEIKKIEG"
FT   gene            462991..463539
FT                   /locus_tag="SP_0482"
FT   CDS             462991..463539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:6165407; match to
FT                   protein family HMM PF07155"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74641"
FT                   /db_xref="GOA:Q97SA4"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR022914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SA4"
FT                   /protein_id="AAK74641.1"
FT                   /translation="MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQA
FT                   LLSIIFGPIIGLLVGLIGHAIKDSLVGYGLWWTWIIASGLFGLVVGLFRKYVRVINGVF
FT                   DWKDILIFNLIQLLANALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGT
FT                   LLLLAYAGTQTRAGSLKKD"
FT   gene            463905..465587
FT                   /locus_tag="SP_0483"
FT   CDS             463905..465587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0483"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to GP:8250594; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74642"
FT                   /db_xref="GOA:Q97SA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97SA3"
FT                   /protein_id="AAK74642.1"
FT                   /translation="MKEAIIEWKDFSFRYETQQEPTLQGIDLTIYKGEKVLIVGPSGSG
FT                   KSTLGQCLNGIIPNIYKGQTYGEFLIKGQVAFDMSIYDKSHLVSTVLQDTDGQFIGLSV
FT                   AEDLAFALENDVTALDEMKGRVYKWAEKLDLLPLLDQRPQDLSGGQKQRVSLAGVLIDE
FT                   SPILLFDEPLANLDPKSGQDIIELIDQIHKEEGTTTLIIEHRLEDVLHRPVDRIVLIND
FT                   GRILFNGSPDQLLATDLLTQNGIREPLYLTTLRQLGVDLVKEEQLANLDNLSISKGQVQ
FT                   LQNELAKETPALQSLFRLEEVSFSYDDRPILKSLHLDIKKGEKIAIVGKNGAGKSTLAK
FT                   AISSFIQTEGRYLWEKQDIKGDSVAERAERVGYVLQNPNQMISTNMIFDEVALGLRLRG
FT                   VDEKEIETRVYETLKICGLYEFRNWPISALSFGQKKRVTIASILVLGAEIILLDEPTAG
FT                   QDQKNYTEIMEFLEELHQKGHTIVMITHDMQLMLDYSDRVLVMVDGELIADTVPASLLS
FT                   DPELLVKANLKETSIFNLAKKLDVDPLDLTAFYKERREGCKLN"
FT   gene            465572..466402
FT                   /locus_tag="SP_0484"
FT   CDS             465572..466402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0484"
FT                   /product="cobalt transport protein"
FT                   /note="identified by similarity to EGAD:108344; match to
FT                   protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74643"
FT                   /protein_id="AAK74643.1"
FT                   /translation="MQAKLIGYQHRDTVIHRLSGAGKLLFFILVSLAAMISYDTRMLLL
FT                   IAIFSVFLLYLSEIRFKDVSFVAVFATIFAVLNVLMVYLFSPEYGVGLYGERSVIWQGI
FT                   GVYTLTSQELFYLLNLAIKYLCTIPLAIIFLMTTHPSQFASSLNQIGVPYKIAYSVSLT
FT                   LRYIPDLQEEFFTIKMSQEARGMELSKKASLMQRIKGNLLIITPLIFSSLERIDTIATA
FT                   MELRRFGKEKKRTWYSYQALKKGDYITLLLATLFLVVSLLLILQNQGRFYNPWK"
FT   gene            466595..467098
FT                   /locus_tag="SP_0486"
FT   CDS             466595..467098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0486"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /note="identified by match to protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74644"
FT                   /protein_id="AAK74644.1"
FT                   /translation="MTNHIVLFEPQIPQNTGNIARTCAATNSPLHIIKPMGFPIDDRKM
FT                   KRAGLDYWDKLEIYFYESLEDFISQMKGKLYLISKFAEKVYSEVDLSTDEDHYFLFGRE
FT                   DKGLPEDFMREHPEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQNFAGLELVHTYEV
FT                   DKLK"
FT   gene            complement(467295..467513)
FT                   /locus_tag="SP_0487"
FT   CDS             complement(467295..467513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0487"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74645"
FT                   /protein_id="AAK74645.1"
FT                   /translation="MERIPLSILTFYIPKVPSYSIKEKQSKWLQSGYKSIKTDKAILSS
FT                   SPIQTILSVVESHHISLRSRTSLKRRK"
FT   gene            467551..468114
FT                   /locus_tag="SP_0488"
FT   CDS             467551..468114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:37721"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74646"
FT                   /protein_id="AAK74646.1"
FT                   /translation="MTNTRRLSTIAILSAISFVLMYFDFPLLPAASFLKIEFSILPVLV
FT                   GLVVMDLPAALGVLLLRSLLKLLLNSQGVNTYIGLPMNIVALGVFVIVFALIWKKERTT
FT                   LRFLLGSLAGTIGLTLAMLVLNYVYAVPLYAKFANFDIGKILGLSNYLMTMVLPFNLIE
FT                   GVIFSVSFWLLYVLLKPTLKHYER"
FT   gene            468104..468754
FT                   /locus_tag="SP_0489"
FT   CDS             468104..468754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0489"
FT                   /product="PAP2 family protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74647"
FT                   /protein_id="AAK74647.1"
FT                   /translation="MRDKQTFLMKGSFALLLFVILGYMVKFYPEMLVNFDQSIQTAIRG
FT                   DLPDYLTILFRALTRLIDIPVIITWVVITAFVFYRKRWKIESFFMLGNLALAGLLIVTF
FT                   KNIYQRPRPAILHLVEEKGFSFPSGHSLAVTLMVGTLIVILSQRIKDQVWRKIVQIVLG
FT                   LYLVSVLVSRVYLGVHYPSDVLASLCVGLGVLFIEFPFYDKLRFQWRFKGKQK"
FT   gene            468782..469171
FT                   /locus_tag="SP_0490"
FT   CDS             468782..469171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0490"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74648"
FT                   /protein_id="AAK74648.1"
FT                   /translation="MKVNIADLHLTQLYLSEKKLQDIQMLYQSAETIQVDPISILAFGD
FT                   CLLITDGHHRAYQALLAGRDTISAEWDRDGGDELYHLYAQACEERKIYSVFDLEDRILA
FT                   QDGYEAKWYNWCDGFNQAATLLLKR"
FT   gene            469176..469331
FT                   /locus_tag="SP_0491"
FT   CDS             469176..469331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0491"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74649"
FT                   /protein_id="AAK74649.1"
FT                   /translation="MCFVPYYKVNHCEEAFAWYQDVNLVYLVDGVKLPYSQADLGSHVF
FT                   LFGSAW"
FT   gene            469303..469626
FT                   /locus_tag="SP_0492"
FT   CDS             469303..469626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0492"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to EGAD:18596"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74650"
FT                   /protein_id="AAK74650.1"
FT                   /translation="MYSYLDRHGELFWIEVKEKGEWFPIGDITLSQDNLPIVIGNSAYQ
FT                   HRGLGKKILSALIELARVKGWKELRVKKIYTYNHASRRCFKSLGFVENGATEKGMSFIL
FT                   ELV"
FT   gene            469739..470341
FT                   /locus_tag="SP_0493"
FT   CDS             469739..470341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0493"
FT                   /product="putative DNA-directed RNA polymerase, delta
FT                   subunit"
FT                   /note="identified by similarity to EGAD:12294; match to
FT                   protein family HMM PF05066"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74651"
FT                   /db_xref="GOA:P66717"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66717"
FT                   /protein_id="AAK74651.1"
FT                   /translation="MRRNALELEVFAGQEKSELSMIEVARAILELRGRDHEMHFSDLVN
FT                   EIQNYLGTSNSDIREALPLFYTELNFDGSFISLGDNKWGLRSWYGVDEIDEEIIALEEN
FT                   DDDEVAPKAKKKRVNAFMDGDSDAIDYNADDPEDEDAYEADPALSYDDENPDDEKNEVE
FT                   AYDAEINEIAPDDLGEDVDLNEDDDEFSDDDAETSEE"
FT   gene            470731..472338
FT                   /gene="pyrG"
FT                   /locus_tag="SP_0494"
FT   CDS             470731..472338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="SP_0494"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF06418; match to protein
FT                   family HMM TIGR00337"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74652"
FT                   /db_xref="GOA:Q97S93"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S93"
FT                   /protein_id="AAK74652.1"
FT                   /translation="MSTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYI
FT                   NIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKER
FT                   RGEYLGATVQVIPHITDALKEKIKRAALTTDSDVIITEVGGTVGDIESLPFLEALRQMK
FT                   ADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGI
FT                   KNKLAQFCDVAPEAVIESLDVEHLYQIPLNLQAQGMDQIVCDHLKLDAPAADMTEWSAM
FT                   VDKVMNLKKQVKISLVGKYVELQDAYISVVEALKHSGYVNDAEVKINWVNANDVTAENV
FT                   AELLSDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEFARHVLGL
FT                   EGANSAELAPETKYPIIDIMRDQIDIEDMGGTLRLGLYPSKLKRGSKAAAAYHNQEVVQ
FT                   RRHRHRYEFNNAFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPN
FT                   RPEELYTAFVTAAVENSN"
FT   gene            complement(472994..474340)
FT                   /locus_tag="SP_0495"
FT   CDS             complement(472994..474340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0495"
FT                   /product="IS1380-Spn1, transposase"
FT                   /note="identified by similarity to GP:8163721; match to
FT                   protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74653"
FT                   /protein_id="AAK74653.1"
FT                   /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKER
FT                   ISKYLVTNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLAS
FT                   QPTLSRFLSRTDEETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAY
FT                   NAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRMDSG
FT                   FATPKLYDLIEKTGQYYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAG
FT                   SWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIKEMKEGF
FT                   FGDKTDSSTLIKNEVRMMMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVR
FT                   TGRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPRRKASLMMH"
FT   gene            complement(474605..476236)
FT                   /locus_tag="SP_0496"
FT   CDS             complement(474605..476236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0496"
FT                   /product="Na/Pi cotransporter II-related protein"
FT                   /note="identified by match to protein family HMM PF02690;
FT                   match to protein family HMM TIGR00704"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74654"
FT                   /protein_id="AAK74654.1"
FT                   /translation="MSINWQEILFHFLGGLGLFLYSIKTMGDGLQQAAGDRLRFYIDKY
FT                   TSNPFFGVLVGIGMTALIQSSSGVTVITVGLVSAGLLTLRQAIGIVMGANIGTTVTSFL
FT                   IGFKLGNYALPMLFIGAVCLFFTKNRTVNNIGRILFGVGGIFFALNLMSGAMAPLKDLQ
FT                   VFKDYMIELSKNPVLGVFVGTGLTLLIQASSATIGILQNLYAGNLIDLQGALPVLFGDN
FT                   IGTTITAIIASLGANIAAKRVAGAHVAFNVIGTVVCVIFLVPFTVLIHWFEATLNLAPE
FT                   MTIAFAHGTFNITNTIVQFPFIGALAYFVTKIIPGEDEVVKYEPLYLDEHFIKQAPSIA
FT                   LGNAKKELLHLGNYAAKAFDLSYKYIIDLDEKVAEKGHKTEEAINTIDEQLTRYLIALS
FT                   SEALSQKESEVLTNILDSSRDLERIGDHTEALLNLTDYLQRKNVEFSDAALKELEEVYR
FT                   QTSDFIKDALDSVENNDIEKARSLVERHEAINKIERVLRKTHIKRLNKGECSTQAGVNF
FT                   IDIISHYTRVSDHAMNLAEKVFAEQI"
FT   gene            476438..476548
FT                   /locus_tag="SP_0497"
FT   CDS             476438..476548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74655"
FT                   /protein_id="AAK74655.1"
FT                   /translation="MIIMVLEFDKKLQNIKRFLENNKINLLGGENEESIF"
FT   gene            476529..481508
FT                   /locus_tag="SP_0498"
FT   CDS             476529..481508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0498"
FT                   /product="putative endo-beta-N-acetylglucosaminidase"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF00754; match to protein
FT                   family HMM PF03644; match to protein family HMM PF04650;
FT                   match to protein family HMM PF07501; match to protein
FT                   family HMM PF07523; match to protein family HMM TIGR01167;
FT                   match to protein family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74656"
FT                   /protein_id="AAK74656.1"
FT                   /translation="MKNPFFERRCRYSIRKLSVGACSLMIGAVLFAGPALAEETAVPEN
FT                   SGANTELVSGESEHSTNEADKQNEGEHARENKLEKAEGVAIASETASPASNEAATTETA
FT                   EAASAAKPEEKASEVVAETPSAEAKPKSDKETEAKPEATNQGDESKPAAEANKTEKEVQ
FT                   PDVPKNTEKTLKPKEIKFNSWEELLKWEPGAREDDAINRGSVVLASRRTGHLVNEKASK
FT                   EAKVQALSNTNSKAKDHASVGGEEFKAYAFDYWQYLDSMVFWEGLVPTPDVIDAGHRNG
FT                   VPVYGTLFFNWSNSIADQERFAEALKQDADGSFPIARKLVDMAKYYGYDGYFINQETTG
FT                   DLVKPLGEKMRQFMLYSKEYAAKVNHPIKYSWYDAMTYNYGRYHQDGLGEYNYQFMQPE
FT                   GDKVPADNFFANFNWDKAKNDYTIATANWIGRNPYDVFAGLELQQGGSYKTKVKWNDIL
FT                   DENGKLRLSLGLFAPDTITSLGKTGEDYHKNEDIFFTGYQGDPTGQKPGDKDWYGIANL
FT                   VADRTPAVGNTFTTSFNTGHGKKWFVDGKVSKDSEWNYRSVSGVLPTWRWWQTSTGEKL
FT                   RAEYDFTDAYNGGNSLKFSGDVAGKTDQDVRLYSTKLEVTEKTKLRVAHKGGKGSKVYM
FT                   AFSTTPDYKFDDADAWKELTLSDNWTNEEFDLSSLAGKTIYAVKLFFEHEGAVKDYQFN
FT                   LGQLTISDNHQEPQSPTSFSVVKQSLKNAQEAEAVVQFKGNKDADFYEVYEKDGDSWKL
FT                   LTGSSSTTIYLPKVSRSASAQGTTQELKVVAVGKNGVRSEAATTTFDWGMTVKDTSLPK
FT                   PLAENIVPGATVIDSTFPKTEGGEGIEGMLNGTITSLSDKWSSAQLSGSVDIRLTKPRT
FT                   VVRWVMDHAGAGGESVNDGLMNTKDFDLYYKDADGEWKLAKEVRGNKAHVTDITLDKPI
FT                   TAQDWRLNVVTSDNGTPWKAIRIYNWKMYEKLDTESVNIPMAKAAARSLGNNKVQVGFA
FT                   DVPAGATITVYDNPNSQTPLATLKSEVGGDLASAPLDLTNQSGLLYYRTQLPGKEISNV
FT                   LAVSVPKDDRRIKSVSLETGPKKTSYAEGEDLDLRGGVLRVQYEGGTEDELIRLTHAGV
FT                   SVSGFDTHHKGEQNLTLQYLGQPVNANLSVTVTGQDEASPKTILGIEVSQEPKKDYLVG
FT                   DSLDLSEGRFAVAYSNDTMEEHSFTDEGVEISGYDAQKTGRQTLTLHYQGHEVSFDVLV
FT                   SPKAALNDEYLKQKLAEVEAAKNKVVYNFASSEVKEAFLKAIEAAEQVLKDHETSTQDQ
FT                   VNDRLNKLTEAHKALNGQEKFTEEKTELDRLTGEVQELLAAKPNHPSGSALAPLLEKNK
FT                   ALVEKVDLSPEELTTAKQSLKDLVALLKEDKPAVFSDSKTGVEVHFSNKEKTVIKGLKV
FT                   ERVQASAEEKKYFAGEDAHVFEIEGLDEKGQDVDLSYASIVKIPIEKDKKVKKVFFLPE
FT                   GKEAVELAFEQTDSHVIFTAPHFTHYAFVYESAEKPQPAKPAPQNTVLPKPTYQPTSDQ
FT                   QKAPKLEVQEEKVAFHRQEHENTEMLVGEQRVIIQGRDGLLRHVFEVDENGQRRLRSTE
FT                   VIQEAIPEIVEIGTKVKTVPAVVATQEKPAQNTAVKSEEASKQLPNTGTADANEALIAG
FT                   LASLGLASLALTLRRKREDKD"
FT   gene            481598..482794
FT                   /gene="pgk"
FT                   /locus_tag="SP_0499"
FT   CDS             481598..482794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="SP_0499"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="identified by match to protein family HMM PF00162"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74657"
FT                   /db_xref="GOA:Q97S89"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S89"
FT                   /protein_id="AAK74657.1"
FT                   /translation="MAKLTVKDVDLKGKKVLVRVDFNVPLKDGVITNDNRITAALPTIK
FT                   YIIEQGGRAILFSHLGRVKEEADKAGKSLAPVAADLAAKLGQDVVFPGVTRGAELEAAI
FT                   NALEDGQVLLVENTRYEDVDGKKESKNDPELGKYWASLGDGIFVNDAFGTAHRAHASNV
FT                   GISANVEKAVAGFLLENEIAYIQEAVETPERPFVAILGGSKVSDKIGVIENLLEKADNV
FT                   LIGGGMTYTFYKAQGIEIGNSLVEEDKLDVAKALLEKANGKLILPVDSKEANAFAGYTE
FT                   VRDTEGEAVSEGFLGLDIGPKSIAKFDEALTGAKTVVWNGPMGVFENPDFQAGTIGVMD
FT                   AIVKQPGVKSIIGGGDSAAAAINLGRADKFSWISTGGGASMELLEGKVLPGLAALTEK"
FT   gene            482930..483457
FT                   /locus_tag="SP_0500"
FT   CDS             482930..483457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0500"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74658"
FT                   /protein_id="AAK74658.1"
FT                   /translation="MSYFKKYKFDKSQFKLGMRTFKTGIAVFLVLLIFGFFGWKGLQIG
FT                   ALTAVFSLRESFDESVHFGTSRILGNSIGGLYALVFFLLNTFFHEAFWVTLVVVPICTM
FT                   LTIMTNVAMNNKAGVIGGVAAMLIITLSIPSGETILYVFVRVLETFMGVFVAIIVNYDI
FT                   DRIRLFLEKKEK"
FT   gene            483534..483890
FT                   /locus_tag="SP_0501"
FT   CDS             483534..483890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0501"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74659"
FT                   /protein_id="AAK74659.1"
FT                   /translation="MKEKEFRRNMAVFPIGSVMKLTDLSARQIRYYEDQELIKPDRNEG
FT                   NRRMYSLNDMDRLLEIKDYISEGYNIAAIKKKYAEREAKSKKAVSQTEVRRALHNELLQ
FT                   QGRFASVQSPFGRG"
FT   gene            483927..485273
FT                   /gene="glnA"
FT                   /locus_tag="SP_0502"
FT   CDS             483927..485273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="SP_0502"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /note="identified by similarity to SP:P12425; match to
FT                   protein family HMM PF00120; match to protein family HMM
FT                   PF03951; match to protein family HMM TIGR00653"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74660"
FT                   /protein_id="AAK74660.1"
FT                   /translation="MPITAADIRREVKEKNVTFIRLMFSDILGTMKNVEIPATDEQLDK
FT                   VLSNKVMFDGSSIEGFVRINESDMYLYPDLDTWTVFPWGDENGSVAGLICDVYTTEGEP
FT                   FAGDPRGNLKRALRHMEEVGFKSFNLGPEPEFFLFKLDENGDPTLEVNDKGGYFDLAPT
FT                   DLADNTRREIVNVLTKMGFEVEASHHEVAVGQHEIDFKYDEVLRACDKIQIFKLVVKTI
FT                   ARKHGLYATFMAKPKFGIAGSGMHCNMSLFDAEGNNAFFDPNDPKGMQLSETAYHFLGG
FT                   LIKHAYNYTAIMNPTVNSYKRLVPGYEAPVYIAWAGRNRSPLVRVPASRGMGTRLELRS
FT                   VDPMANPYVAMAVLLEVGLYGIENKIEAPAPIEENIYIMTAEERKEAGITDLPSTLHNA
FT                   LKALTEDEVVKAALGDHIYTSFLEAKRIEWASYATFVSQWEIDNYLDLY"
FT   gene            complement(485369..485488)
FT                   /locus_tag="SP_0503"
FT   CDS             complement(485369..485488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0503"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74661"
FT                   /protein_id="AAK74661.1"
FT                   /translation="MPDIVFEIEFFHSDSLIFFYTSDDKSNSQKSQEDFSKNK"
FT   gene            485746..485883
FT                   /locus_tag="SP_0504"
FT   CDS             485746..485883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0504"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74662"
FT                   /protein_id="AAK74662.1"
FT                   /translation="MNPDRAEEYFCRGCQGENPEDIEFYDEQLQAEKVEDLNIRLEVKN
FT                   "
FT   gene            486054..487334
FT                   /locus_tag="SP_0505"
FT   CDS             486054..487334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0505"
FT                   /product="putative type I restriction-modification system,
FT                   S subunit"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74663"
FT                   /protein_id="AAK74663.1"
FT                   /translation="MRIKSIYWNFGQNKPEKSFRYIDTSSIDRKKNIINYKNLQYLSPE
FT                   QAPSRARKLVSQNSVLFSTVRPYLKNIAVVRELKEYLIASTAFIVLDTLLNETYLKYYL
FT                   LSDNFINRVNNKSTGTSYPAINDYNFNLLLIALPPLSEQQRIVEAIESALEKVDEYAES
FT                   YNRLEQLDKEFPDKLKKSILQYAMQGKLVEQDPNDESVEVLLEKIRAEKQKLFEEGKIK
FT                   KKDLDISIVSQGDDNSYYEEVPCEIPESWEWVRLNDITSYIQRGKSPKYSNIPIYPVIA
FT                   QKCNQWSGFSIDLARFIDPETVHSYQKERLLRDGDLMWNSTGLGTLGRLAIYHENKNPY
FT                   GWAVADSHVTVIRVLSGVINCHFIYNFLSSPIVQSVIEEKASGSTKQKELLTKTIKEYL
FT                   IPLPPLPEQSRIVDKIEQFFAHIDALI"
FT   gene            487391..488188
FT                   /locus_tag="SP_0506"
FT   CDS             487391..488188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0506"
FT                   /product="integrase/recombinase, phage integrase family"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74664"
FT                   /protein_id="AAK74664.1"
FT                   /translation="MKDFELHLKKAGLAENTVRSYLYGVRFFLENYELKMEDLFEYKGY
FT                   LLDNFKPKTVNLRLQGVNKYLAFIGHDDLKLKFVKVQQKPFLEDVISHADYLFLKRSLK
FT                   KDGILKWHFVVWFLGATGARVSELIKLKVEHVEIGYFDIYSKGGKIRRLYIPKKLRNSC
FT                   LSWLESENRRSGYLFLNKFNEPITARGVAQQLKNYADKYKMNPKVIYPHSFRHLFAKNF
FT                   LAKYNDIALLADLMGHESIETTRIYLRKTATEQQNIVDKIVNW"
FT   gene            488259..488798
FT                   /locus_tag="SP_0507"
FT   CDS             488259..488798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0507"
FT                   /product="putative type I restriction-modification system,
FT                   S subunit"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74665"
FT                   /protein_id="AAK74665.1"
FT                   /translation="MNWVVIKIKDIFSINTGLSYKKGDLSINNKGVRIIRGGNIKPLEF
FT                   SLLDNDYYIDTQFISSEQVYLKHNQLITPVSTSLEHIGKFARIDKDYDGVVAGGFIFQL
FT                   TPFESSEIISKFLLFNLSSPLFYKQLKAITKLSGQALYNIPKTTLSELLIPLAPFEEQE
FT                   LITQKVEKLFEKVNQL"
FT   gene            complement(488752..490320)
FT                   /gene="hsdS"
FT                   /locus_tag="SP_0508"
FT   CDS             complement(488752..490320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="SP_0508"
FT                   /product="type I restriction-modification system, S
FT                   subunit"
FT                   /note="identified by similarity to SP:P19704; match to
FT                   protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74666"
FT                   /protein_id="AAK74666.1"
FT                   /translation="MTPEQLKASILQRAMEGKLVPQNPNDEPASELLKRIKAEKEKLIS
FT                   EGKIKRDKKETEIFRGDDGKHYGKFADGSTQEIDVPYDIPDTWEWVRFSTLVEIVRGGS
FT                   PRPIKDYLTSEVDGINWIKIGDTEKGEKYINNVKEKIKKSGLNKTRFVKKGTFLLTNSM
FT                   SFGRPYILNVDGAIHDGWLAISNYENSLNKDYLFYILSSNVVYSQFLSLISGAVVKNLN
FT                   SDKVASILIPLPPLSEQQRIVEAIESALEKVDEYAESYNRLEQLDKEFPDKLKKSILQY
FT                   AMQGKLVEQDPNDESVEVLLEKIRAEKQKLFEEGKIKKKDLDISIVSQGDDNSYYGNKD
FT                   ETTSYPIYEIPEAWRYIKFASLVNFRIGKTPPRSEATFWGTEIPWVSISDMPISGYVTN
FT                   ARESISKLALKSKKIDISPKGTLLMSFKLSIGKVAILDIPATHNEAIISIFPYANKENI
FT                   IRDYLMIFLPLISTLGDSKDAIKGKTLNSTSISELLIPISNHEEMKRIIFKVDLLFQKV
FT                   SQLFE"
FT   gene            complement(490320..491783)
FT                   /gene="hsdM"
FT                   /locus_tag="SP_0509"
FT   CDS             complement(490320..491783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdM"
FT                   /locus_tag="SP_0509"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to EGAD:20905; match to
FT                   protein family HMM PF02384; match to protein family HMM
FT                   PF02506"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74667"
FT                   /protein_id="AAK74667.1"
FT                   /translation="MSITSFVKRIQDITRNDAGVNGDAQRIEQMSWLLFLKIYDSREMV
FT                   WELEEDEYESIIPEELKWRNWAHAQNGERVLTGDELLDFVNNKLFKELKELEITSNMPI
FT                   RKTIVKSAFEDANNYMKNGVLLRQVINVIDEVDFNSPEDRHSFNDIYEKILKDIQNAGN
FT                   SGEFYTPRAATDFIAEVLDPKLGESMADLACGTGGFLTSTLNRLSSQRKTSEDTKKYNT
FT                   AVFGIEKKAFPHLLAVTNLFLHEIDDPKIVHGNTLEKNVREYTDDEKFDIIMMNPPFGG
FT                   SELETIKNNFPAELRSSETADLFMAVIMYRLKENGRVGVILPDGFLFGEGVKTRLKQKL
FT                   VDEFNLHTIIRLPHSVFAPYTGIHTNILFFDKTKKTEETWFYRLDMPDGYKNFSKTKPM
FT                   KSEHFNPVRDWWENREEILEGKFYKSKSFTPSELAELNYNLDQCDFPKEEEEILNPFEL
FT                   IQNYQAERATLNHKIDNVLADILQLLEDK"
FT   gene            complement(491796..494129)
FT                   /gene="hsdR"
FT                   /locus_tag="SP_0510"
FT   CDS             complement(491796..494129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdR"
FT                   /locus_tag="SP_0510"
FT                   /product="type I restriction-modification system, R
FT                   subunit"
FT                   /EC_number="3.1.21.3"
FT                   /note="identified by similarity to EGAD:12840; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF04313; match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74668"
FT                   /protein_id="AAK74668.1"
FT                   /translation="MVEFIKSKKEMSEEDIKANFITPAIVSKGWKNGEHIAYEEYFTDG
FT                   RIEVRGDKARRKEGKKSDYSLYYQFGTRIAIVEAKDNKHSVRAGLQQAIEYGEILDVPF
FT                   VYSSNGDGFIEHDRITREERELELDEFPTREELFSRMTKEKGLTYEITEAISTPYYTDA
FT                   FSMKTPRYYQQIAINRTIETVARGQKRVMFVMATGTGKTFMAFQIIHRLRKAGLAKRVL
FT                   FLADRNILVDQTMAEDFRPFEKVMTKITPKLLTAPEKLNSFEIYLGLYQQLTGEDGTET
FT                   HYQKFDKDFFDLIVIDEAHRGSAKENSNWRKVIDYFSSATQIGMTATLKETKNASNTEY
FT                   FGEPIYTYSLKQGIEDGFLAPYRVMRVNLDVDVDGYRPETGKVDANGQLIEDRYYGRKD
FT                   FDKTIVIDDRTQRVAKFVSDYMKQNNARFDKTIVFCVDIDHAERMRAALVKENLDLVQE
FT                   DYRYVMQVTGDNAEGKAQLDNFMDVNSNFPAIVTTSKLLTTGVNAKTCRLIVLDSNIQS
FT                   MTEFKQIIGRGTRLYPQKGKEFFTIIDFRNVTNLFADPDFDGDPVKVLETGAKTVSGST
FT                   PGFVDEEGDPVEKYIVTDKQVTILNSTVQVLDENGKLITESLTDYTRKNILGSYATLND
FT                   FITVWHTADKKKLILDELYKKGVYLDAIRESEGISEQEIDDFDLLLKLAYGQKELTKTE
FT                   RINKLKQSGYLYKYSEEARAVLEILLNKYMDKGIGELESIETLKLPEFQIYGGTFKIIN
FT                   TYFGDKKRYLQAIKELEQELFTVA"
FT   gene            complement(494480..494608)
FT                   /locus_tag="SP_0511"
FT   CDS             complement(494480..494608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0511"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74669"
FT                   /protein_id="AAK74669.1"
FT                   /translation="MKIKNTFQLKELPPVTNFEKNGSRAKKRNKIGSIRIVKIRLA"
FT   gene            494592..494702
FT                   /locus_tag="SP_0512"
FT   CDS             494592..494702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0512"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74670"
FT                   /protein_id="AAK74670.1"
FT                   /translation="MFLIFIIDWVLLIVFAIQISYIFWRLSQKWKELSNK"
FT   gene            494737..494928
FT                   /locus_tag="SP_0513"
FT   CDS             494737..494928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74671"
FT                   /protein_id="AAK74671.1"
FT                   /translation="MNSRVEFRIFTIVDLDKEEEHLHEMHLKGWRYRTSRFGLFYFDQC
FT                   QPDDVIYRIYDSRFLKKV"
FT   gene            494900..495247
FT                   /locus_tag="SP_0514"
FT   CDS             494900..495247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0514"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74672"
FT                   /protein_id="AAK74672.1"
FT                   /translation="MILDFLKKYKHELQDFRDRGWELIGAGSCSILRKSSSDLLPEDQV
FT                   YMSKGLKWEVMRSRLRSCTATFSGGLVVCMSLFREDLSMSFFLIFVLYAFLISYLIYGY
FT                   FRLKRKYRVDE"
FT   gene            495411..496445
FT                   /gene="hrcA"
FT                   /locus_tag="SP_0515"
FT   CDS             495411..496445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="SP_0515"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="identified by match to protein family HMM PF01628;
FT                   match to protein family HMM PF08220; match to protein
FT                   family HMM TIGR00331"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74673"
FT                   /db_xref="GOA:Q9X4R2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X4R2"
FT                   /protein_id="AAK74673.1"
FT                   /translation="MVTERQQDILNLIIDIFTKTHEPVGSKALQESINSSSATIRNDMA
FT                   ELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFDRLAENEVYEIVKAFDQEFFKLEDI
FT                   LQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLI
FT                   PRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVIDLFEHIFK
FT                   EMFNENIVMAGKVHLLNFANLAAYQFFDQPQKVALEIREGLREDQMQNVRVADGQESCL
FT                   ADLAVISSKFLIPYRGVGILAIIGPVNLDYQQLINQVNVVNRVLTMKLTDFYRYLSSNH
FT                   YEVH"
FT   gene            496472..496996
FT                   /gene="grpE"
FT                   /locus_tag="SP_0516"
FT   CDS             496472..496996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SP_0516"
FT                   /product="heat shock protein GrpE"
FT                   /note="identified by match to protein family HMM PF01025"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74674"
FT                   /db_xref="GOA:Q97S73"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S73"
FT                   /protein_id="AAK74674.1"
FT                   /translation="MAQDIKNEEVEEVQEEEVVKTAEETTPEKSELDLANERADEFENK
FT                   YLRAHAEMQNIQRRANEERQNLQRYRSQDLAKAILPSLDNLERALAVEGLTDDVKKGLG
FT                   MVQESLIHALKEEGIEEIAADGEFDHNYHMAIQTLPADDEHPVDTIAQVFQKGYKLHDR
FT                   ILRPAMVVVYN"
FT   gene            497485..499308
FT                   /gene="dnaK"
FT                   /locus_tag="SP_0517"
FT   CDS             497485..499308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SP_0517"
FT                   /product="dnaK protein"
FT                   /note="identified by match to protein family HMM PF00012;
FT                   match to protein family HMM TIGR02350"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74675"
FT                   /db_xref="GOA:P95829"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95829"
FT                   /protein_id="AAK74675.1"
FT                   /translation="MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKNG
FT                   EIIVGDAAKRQAVTNPDTVISIKSKMGTSEKVSANGKEYTPQEISAMILQYLKGYAEDY
FT                   LGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKTDKEEK
FT                   ILVFDLGGGTFDVSILELGDGVFDVLSTAGDNKLGGDDFDQKIIDHLVAEFKKENGIDL
FT                   STDKMAMQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAGPLHLEMTLTRAKFDDLTRD
FT                   LVERTKVPVRQALSDAGLSLSEIDEVILVGGSTRIPAVVEAVKAETGKEPNKSVNPDEV
FT                   VAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTA
FT                   ADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIPQIEVTFDIDKNGIVSVKA
FT                   KDLGTQKEQTIVIQSNSGLTDEEIDRMMKDAEANAEADKKRKEEVDLRNEVDQAIFATE
FT                   KTIKETEGKGFDAERDAAQAALDDLKKAQEDNNLDDMKTKLEALNEKAQGLAVKLYEQA
FT                   AAAQQAQEGAEGAQATGNAGDDVVDGEFTEK"
FT   gene            499310..499456
FT                   /locus_tag="SP_0518"
FT   CDS             499310..499456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74676"
FT                   /protein_id="AAK74676.1"
FT                   /translation="MSVLDEEYLKNTRKVYNDFCNQADNYRTSKDFIDNIPIEYLARYR
FT                   ELY"
FT   gene            500067..501203
FT                   /gene="dnaJ"
FT                   /locus_tag="SP_0519"
FT   CDS             500067..501203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SP_0519"
FT                   /product="dnaJ protein"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF00684; match to protein
FT                   family HMM PF01556; match to protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74677"
FT                   /db_xref="GOA:P95830"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95830"
FT                   /protein_id="AAK74677.1"
FT                   /translation="MNNTEFYDRLGVSKNASADEIKKAYRKLSKKYHPDINKEPGAEDK
FT                   YKEVQEAYETLSDDQKRAAYDQYGAAGANGGFGGAGGFGGFNGAGGFGGFEDIFSSFFG
FT                   GGGSSRNPNAPRQGDDLQYRVNLTFEEAIFGTEKEVKYHREAGCRTCNGSGAKPGTSPV
FT                   TCGRCHGAGVINVDTQTPLGMMRRQVTCDVCHGRGKEIKYPCTTCHGTGHEKQAHSVHV
FT                   KIPAGVETGQQIRLAGQGEAGFNGGPYGDLYVVVSVEASDKFEREGTTIFYNLNLNFVQ
FT                   AALGDTVDIPTVHGDVELVIPEGTQTGKKFRLRSKGAPSLRGGAVGDQYVTVNVVTPTG
FT                   LNDRQKVALKEFAAAGDLKVNPKKKGFFDHIKDAFDGE"
FT   gene            complement(501893..502180)
FT                   /locus_tag="SP_0520"
FT   CDS             complement(501893..502180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0520"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74678"
FT                   /protein_id="AAK74678.1"
FT                   /translation="MKLSNLLLFAGAAAGSYLVTKNRQTITDEVLNTTDRVQAIKDDVD
FT                   IIQNSLQIINQQKELIKEYQEDLTYKFKVLEKDIQTRLAVIKEMQGTEDK"
FT   gene            complement(502190..502600)
FT                   /locus_tag="SP_0521"
FT   CDS             complement(502190..502600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0521"
FT                   /product="HIT family protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74679"
FT                   /protein_id="AAK74679.1"
FT                   /translation="MSDCIFCKIIAGEIPASKVYEDEQVLAFLDISQVTLGHTLVVPKE
FT                   HYRNLLEMDATSASQLFAQVPKVAQKVMKVTKAAGMNIISNCEEVAGQTVFHTHVHLVP
FT                   RYSADDDLKIDFIAHEPDFDKLAQVAETIKNA"
FT   gene            502668..503399
FT                   /locus_tag="SP_0522"
FT   CDS             502668..503399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0522"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to EGAD:37771; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74680"
FT                   /protein_id="AAK74680.1"
FT                   /translation="MLEIKNLTGGYVHVPVLKDVSFTVESGQLVGLIGLNGAGKSTTIN
FT                   EIIGLLAPYSGSININGLTLQGDATSYRKQIGYIPETPSLYEELTLREHIETVAMAYGI
FT                   EQKVAFERVEPLLKMFRLEQKLDWFPVHFSKGMKQKVMIICAFVVDPSLFIVDEPFLGL
FT                   DPLAISDLIQLLEVEKQKGKSILMSTHVLDSAEKMCDAFVILHKGEVRSKGNLLQLREA
FT                   FDMPEASLNDIYLALTKEEDL"
FT   gene            503396..504445
FT                   /locus_tag="SP_0523"
FT   CDS             503396..504445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0523"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by similarity to EGAD:35133; match to
FT                   protein family HMM PF05975"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74681"
FT                   /protein_id="AAK74681.1"
FT                   /translation="MKDLFLKRKQAFRKECLGYLRYVLNDHFVLFLLVLLGFLAYQYSQ
FT                   LLQHFPENHWPILLFVGITSVLLLLWGGTATYMEAPDKLFLLVGEEEIKLHLKRQTGIS
FT                   LVFWLFVQTLFLLLFAPLFLAMGYGLPVFLLYVLLLGVGKYFHFCQKASKFFTETGLDW
FT                   DYVISQESKRKQVLLRFFALFTQVKGISNSVKRRAYLDFILKAVQKVPGKIWQNLYLRS
FT                   YLRNGDLFALSLRLLLLSLLAQVFIEQAWIATAVVVLFNYLLLFQLLALYHAFDYQYLT
FT                   QLFPLDKGQKEKGLQEVVRGLTSFVLLVELVVGLITFQEKLALLALLGAGLVLLVLYLP
FT                   YQVKRQMQD"
FT   gene            complement(504613..504942)
FT                   /gene="blpT"
FT                   /locus_tag="SP_0524"
FT   CDS             complement(504613..504942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpT"
FT                   /locus_tag="SP_0524"
FT                   /product="BlpT protein, fusion"
FT                   /note="C-terminus is fused with an incomplete box element.;
FT                   identified by similarity to GP:9798558"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74682"
FT                   /protein_id="AAK74682.1"
FT                   /translation="MTDTDPIKRAHTLITDLNKAYQACKQASADDVRFQEQLNSILGFL
FT                   AKAETVDNRFLIELEKFYQTSSLLMGLSALDPDAPTRAAWRAYDRFHFDQVKTKLILNE
FT                   NQRAN"
FT   gene            505218..505556
FT                   /gene="blpS"
FT                   /locus_tag="SP_0525"
FT   CDS             505218..505556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpS"
FT                   /locus_tag="SP_0525"
FT                   /product="BlpS protein"
FT                   /note="identified by similarity to GP:9798559; match to
FT                   protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74683"
FT                   /protein_id="AAK74683.1"
FT                   /translation="MKYMIIQTQKTVYKVNIDDIYYIQTHPTKAHTVQIVTEEASFNML
FT                   QNLSNLENQCGETLMRCHRNCLVNLDKLKSIDFQERILFLGEEGQYAVKYARRRYREIR
FT                   QKWLKEGE"
FT   gene            505561..506298
FT                   /gene="blpR"
FT                   /locus_tag="SP_0526"
FT   CDS             505561..506298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpR"
FT                   /locus_tag="SP_0526"
FT                   /product="response regulator BlpR"
FT                   /note="identified by similarity to GP:5830550; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74684"
FT                   /protein_id="AAK74684.1"
FT                   /translation="MRIFVLEDDFSQQTRIETTIEKLLKAHHIIPSSFEVFGKPDQLLA
FT                   EVHEKGAHQLFFLDIEIRNEEMKGLEVARKIRDRDPYALIVFVTTHSEFMPLSFRYQVS
FT                   ALDYIDKALSAEEFESRIETALLYANSQDSKSLAEDCFYFKSKFAQFQYPFKEVYYLET
FT                   SPRAHRVILYTKTDRLEFTASLEEVFKQEPRLLQCHRSFLINPANVVHLDKKEKLLFFP
FT                   NGGSCLIARYKVREVSEAINKLH"
FT   gene            506312..507652
FT                   /gene="blpH"
FT                   /locus_tag="SP_0527"
FT   CDS             506312..507652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpH"
FT                   /locus_tag="SP_0527"
FT                   /product="putative sensor histidine kinase BlpH"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74685"
FT                   /protein_id="AAK74685.1"
FT                   /translation="MNIAWILLYTLVTNGLEIVIFFKVDGIDLTFERIFKAFLLKILLA
FT                   FVFVMISYIVGNVYLSYFMEPLYGIGLSFLLLRGLPKKLLFFYGLFPMILVNLFYRGVS
FT                   YFVLPFLGQGQVYDGYSFTGLCIIIFNFFISLAFLKWLDYDFTSLRKEILDKAFQKSLT
FT                   QINWIMGGYYLVMESLSFFEYEQSIQSKTVRHLILVFYLLFFMGVIKKLDTYLKEKLYE
FT                   RLEQEQALRYRDMERYSRHIEELYKEVRSFRHDYTNLLTSLRLGIEEEDMEQIKEVYGS
FT                   VLKDSSQKLQNNKYDLGRLVNIRDKALKSLLAGKFLKARDKNIVFNVEVPEEIQVEGMS
FT                   LLDFLTIVSILCDNAIEASVEASQPHVSIAFLKNGAQETFIIENSIKEEGIDISEIFSF
FT                   GASSKGEERGVGLYTVMKIVESHPNTSLNTTCQNQVFRQVLTVIHTE"
FT   gene            complement(507723..507851)
FT                   /gene="blpC"
FT                   /locus_tag="SP_0528"
FT   CDS             complement(507723..507851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpC"
FT                   /locus_tag="SP_0528"
FT                   /product="peptide pheromone BlpC"
FT                   /note="identified by similarity to GP:9798562; match to
FT                   protein family HMM PF08128; match to protein family HMM
FT                   TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74686"
FT                   /protein_id="AAK74686.1"
FT                   /translation="MDKKQNLTSFQELTTTELNQITGGGLWEDLLYNINRYAHYIT"
FT   gene            complement(507908..509269)
FT                   /gene="blpB"
FT                   /locus_tag="SP_0529"
FT   CDS             complement(507908..509269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpB"
FT                   /locus_tag="SP_0529"
FT                   /product="BlpC ABC transporter"
FT                   /note="identified by similarity to GP:9798563; match to
FT                   protein family HMM TIGR01000"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74687"
FT                   /protein_id="AAK74687.1"
FT                   /translation="MNPNLFRSVEFYQRRYHNYATVLIIPLSLLFTFILIFSLVATKEI
FT                   TVTSQGEIAPTSVIASIQSTSDNPILANHLVANQVVEKGDLLIKYSETMEESQKTALAT
FT                   QLQRLEKQKEGLGILKQSLEKATDLFSGEDEFGYHNTFMNFTKQSHDIELGITKTNTEV
FT                   SNQANLSNSSSSAIEQEITKVQQQIGEYQELRDAIINNRARLPTGNPHQSILNRYLVAS
FT                   QGQTQGTAEEPFLSQINQSIAGLESSIASLKIQQAGIGSVATYDNSLATKIEVLRTQFL
FT                   QTASQQQLTVENQLTELKVQLDQATQRLENNTLTSPSKGIVHLNSEFEGKNRIPTGTEI
FT                   AQIFPVITDTREVLITYYVSSDYLPLLDKGQTVRLKLEKIGNHGTTIIGQLQTIDQTPT
FT                   RTEQGNLFKLTALAKLSNEDSKLIQYGLQGRVTSVTTKKTYFDYFKDKILTHSD"
FT   gene            complement(509280..511437)
FT                   /pseudo
FT                   /gene="blpA"
FT                   /locus_tag="SP_0530"
FT                   /note="BlpC ABC transporter, ATP-binding protein,
FT                   degenerate; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GP:9798564"
FT   gene            511719..511916
FT                   /gene="blpI"
FT                   /locus_tag="SP_0531"
FT   CDS             511719..511916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpI"
FT                   /locus_tag="SP_0531"
FT                   /product="bacteriocin BlpI"
FT                   /note="identified by similarity to GP:9798565"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74688"
FT                   /protein_id="AAK74688.1"
FT                   /translation="MNTKMMEQFSVMDNEELEIVSGGRGNLGSAIGGCIGAVLLAAATG
FT                   PITGGAATLICVGSGIMSSL"
FT   gene            512383..512652
FT                   /gene="blpJ"
FT                   /locus_tag="SP_0532"
FT   CDS             512383..512652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpJ"
FT                   /locus_tag="SP_0532"
FT                   /product="bacteriocin BlpJ"
FT                   /note="identified by similarity to GP:9798566; match to
FT                   protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74689"
FT                   /protein_id="AAK74689.1"
FT                   /translation="MNTKMLSQLEVMDTEMLAKVEGGYSSTDCQNALITGVTTGIITGG
FT                   TGAGLATLGVAGLAGAFVGAHIGAIGGGLTCLGGMVGDKLGLSW"
FT   gene            512721..512951
FT                   /gene="blpK"
FT                   /locus_tag="SP_0533"
FT   CDS             512721..512951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpK"
FT                   /locus_tag="SP_0533"
FT                   /product="bacteriocin BlpK"
FT                   /note="identified by similarity to GP:9798567; match to
FT                   protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74690"
FT                   /protein_id="AAK74690.1"
FT                   /translation="MDTKMMSQFSVMDTEMLACVEGGGCNWGDFAKAGVGGGAARGLQL
FT                   GIKTGTWQGAATGAAGGAILGGVAYAATCWW"
FT   gene            513186..513302
FT                   /locus_tag="SP_0534"
FT   CDS             513186..513302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0534"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74691"
FT                   /protein_id="AAK74691.1"
FT                   /translation="MVSIQYKEESMFFMLAFLIFTIQEVLMTIYDLSDPRSK"
FT   gene            513370..513534
FT                   /locus_tag="SP_0535"
FT   CDS             513370..513534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0535"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74692"
FT                   /protein_id="AAK74692.1"
FT                   /translation="MKKKILIIFVLYLIMSIFLYPLRESAWYQLFYTIAYVIAVMIYFA
FT                   INKKKGEKK"
FT   gene            513531..513935
FT                   /gene="blpL"
FT                   /locus_tag="SP_0536"
FT   CDS             513531..513935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpL"
FT                   /locus_tag="SP_0536"
FT                   /product="immunity protein BlpL"
FT                   /note="identified by similarity to GP:9798568"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74693"
FT                   /protein_id="AAK74693.1"
FT                   /translation="MKTFLAKKRNIFLARLFLGQLPLLVSTYLFLSRQFLNFSVVFQFL
FT                   LVVINLASILVTVYLTREMRIREFEDDDLVSPRTNQLMFIGLTGFMSIICLYRGITAGE
FT                   SYQQIIAYIGAVLCLIIMLLLMWGLKYYKK"
FT   gene            514138..514527
FT                   /locus_tag="SP_0537"
FT   CDS             514138..514527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0537"
FT                   /product="IS1381, transposase OrfA"
FT                   /note="IRleft, upstream of the start site, is interrupted
FT                   by an RUP element.; identified by similarity to EGAD:33136"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74694"
FT                   /protein_id="AAK74694.1"
FT                   /translation="MNYEASKQLTDARFKRLVGVQRTTFEEMLAVLKTAYQLKHAKGGR
FT                   KPKLSLEDLLMATLQYVREYRTYEEIAADFGVHESNLLRRSQWVEVTLVQSGVTISRTP
FT                   LSSEDTVMIDATEVKINRPKKRISE"
FT   gene            514553..514942
FT                   /locus_tag="SP_0538"
FT   CDS             514553..514942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0538"
FT                   /product="IS1381, transposase OrfB"
FT                   /note="identified by similarity to EGAD:33136; match to
FT                   protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74695"
FT                   /protein_id="AAK74695.1"
FT                   /translation="MKTQAIVTSQGRIVSLDITVNYCHDMKLFKMSRRNIGQAGKILAD
FT                   SGYQGLMKIYPQAQTSRKSSKLKPLTVEDKACNHALSKERSKVENIFAKVKTFKMFSTT
FT                   YRSHRKRFGLRMNLSAGIINHELGF"
FT   gene            515092..515346
FT                   /gene="blpM"
FT                   /locus_tag="SP_0539"
FT   CDS             515092..515346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpM"
FT                   /locus_tag="SP_0539"
FT                   /product="bacteriocin BlpM"
FT                   /note="identified by similarity to GP:9798569; match to
FT                   protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74696"
FT                   /protein_id="AAK74696.1"
FT                   /translation="MDTKIMEQFHEMDITMLSSIEGGKNNWQTNVLEGGGAAFGGWGLG
FT                   TAICAASGVGAPFMGACGYIGAKFGVDLWAGVTGATGGF"
FT   gene            515362..515565
FT                   /gene="blpN"
FT                   /locus_tag="SP_0540"
FT   CDS             515362..515565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpN"
FT                   /locus_tag="SP_0540"
FT                   /product="BlpN protein"
FT                   /note="identified by similarity to GP:9798570"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74697"
FT                   /protein_id="AAK74697.1"
FT                   /translation="MNTYCNINETMLSEVYGGNSGGAAVVAALGCAAGGVKYGRLLGPW
FT                   GAAIGGIGGAVVCGYLAYTATS"
FT   gene            515809..515958
FT                   /gene="blpO"
FT                   /locus_tag="SP_0541"
FT   CDS             515809..515958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpO"
FT                   /locus_tag="SP_0541"
FT                   /product="bacteriocin BlpO"
FT                   /note="identified by similarity to GP:9798571; match to
FT                   protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74698"
FT                   /protein_id="AAK74698.1"
FT                   /translation="MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGC
FT                   ATTV"
FT   gene            515940..516059
FT                   /locus_tag="SP_0542"
FT   CDS             515940..516059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0542"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74699"
FT                   /protein_id="AAK74699.1"
FT                   /translation="MCNNGLTFLLGPFAIGIGVTGAAGGAILGGVAYAAICWW"
FT   gene            516700..516867
FT                   /locus_tag="SP_0543"
FT   CDS             516700..516867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0543"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74700"
FT                   /protein_id="AAK74700.1"
FT                   /translation="MVSPRTNQLMFIGLADFMFVICLYRGISETEFYQQLIAYIGVFSA
FT                   CLSRFCSCGA"
FT   gene            516952..517350
FT                   /gene="blpX"
FT                   /locus_tag="SP_0544"
FT   CDS             516952..517350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpX"
FT                   /locus_tag="SP_0544"
FT                   /product="immunity protein BlpX"
FT                   /note="identified by similarity to GP:9798572"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74701"
FT                   /protein_id="AAK74701.1"
FT                   /translation="MEVFNMKYRLFFVIFLSSVLDILLGTFLQISIVSIGWLVLYSGLF
FT                   EAGVFLLANKGVAVKIKEVDIRNRFKFIFGKTLWFQILLLIFLIIKLYLGLDARLILFY
FT                   GHIFIVFNALMYLLSSSQVSLKKNKLSS"
FT   gene            517402..518091
FT                   /gene="blpY"
FT                   /locus_tag="SP_0545"
FT   CDS             517402..518091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpY"
FT                   /locus_tag="SP_0545"
FT                   /product="immunity protein BlpY"
FT                   /note="identified by similarity to EGAD:151936; match to
FT                   protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74702"
FT                   /protein_id="AAK74702.1"
FT                   /translation="MKKYQLLFKISAVFSYLFFVFSLSQLTLIVQNYWQFSSQIGNLFW
FT                   IQNILSLLFIGVMIVVLVKTGHGYLFRIPRKKWLWYSILTVLVLVFQISFNVQTAKHVQ
FT                   STAEGWAVLIGYSGTNFAELGIYIALFFLVPLMEELIYRGLLQHAFFKHSRFGLDLLLP
FT                   SILFALPHFSSLPSLLDIFVFATVGIIFAGLTRYTKSIYPSYAVHVINNIVATFPFLLT
FT                   FLHRVLG"
FT   gene            518133..518366
FT                   /gene="blpZ"
FT                   /locus_tag="SP_0546"
FT   CDS             518133..518366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpZ"
FT                   /locus_tag="SP_0546"
FT                   /product="BlpZ protein, fusion"
FT                   /note="C-terminus is fused with an incomplete BOX element.;
FT                   identified by similarity to GP:9798574"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74703"
FT                   /protein_id="AAK74703.1"
FT                   /translation="MYKHLFFLDSKTLDRLTPYILVLASDTIAFNVFVLTFVSAVVFNF
FT                   LNSMLALMAIFIGAGYVVGFWLLILNENQRAN"
FT   gene            518517..519128
FT                   /locus_tag="SP_0547"
FT   CDS             518517..519128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0547"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:6470197; similarity
FT                   to EGAD:107498; match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74704"
FT                   /protein_id="AAK74704.1"
FT                   /translation="MEFFDKFHALCFGFLVLIIVITVPYTINHGGFFQNESALILVSLL
FT                   VTSLSVAYARKFEMISFGMLSKKQLLLFIAIFLLSVLETLVYIHFFAVSSGSGVQHLAE
FT                   VSRGISLSLILTTSVFGPIQEELIFRGLLQGAVFDNSWLGLVLTSSLFSFMHGPSNVPS
FT                   FIFYLLGGLLLGFAYKKSQNLWVSTLVHMLYNSWPLLYYL"
FT   gene            complement(519222..519344)
FT                   /locus_tag="SP_0548"
FT   CDS             complement(519222..519344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0548"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74705"
FT                   /protein_id="AAK74705.1"
FT                   /translation="MPLFPGMGVSVSSLSPKSISFLRIKFPYYSTSFWPIRQPL"
FT   gene            519352..520083
FT                   /locus_tag="SP_0549"
FT   CDS             519352..520083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:7328278"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74706"
FT                   /protein_id="AAK74706.1"
FT                   /translation="MGSYPDGKRIFVKMNTSPILPGLAREQIAPQLLWSRRLADGRDMC
FT                   AQEWLTGKILTPYDMNRKQIVNILTRLHRSRPLMTQLSRLGYAMETPVDLLQSWQETAP
FT                   DALRKNHFISEVMADLRQTIPGFREDHATIVHGDVRHSNWIETDSGLIYLVDWDSVRLT
FT                   DRMFDVAHMLCHYISEHQWKEWLTYYGYKYNQTVLSKLYWYGQLSYLSQISKYYMNQDL
FT                   ENVNREIHGLRHFRDKYGKRR"
FT   gene            520080..520715
FT                   /locus_tag="SP_0550"
FT   CDS             520080..520715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108171; match to
FT                   protein family HMM PF02390; match to protein family HMM
FT                   TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74707"
FT                   /db_xref="GOA:P67506"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:1YZH"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67506"
FT                   /protein_id="AAK74707.1"
FT                   /translation="MRVRNRKGATELLEANPQYVVLNPLEAKAKWRDLFGNDNPIHVEV
FT                   GSGKGAFVSGMAKQNPDINYIGIDIQKSVLSYALDKVLEVGVPNIKLLWVDGSDLTDYF
FT                   EDGEIDRLYLNFSDPWPKKRHEKRRLTYKTFLDTFKRILPENGEIHFKTDNRGLFEYSL
FT                   VSFSQYGMKLNGVWLDLHASDFEGNVMTEYEQKFSNKGQVIYRVEAEF"
FT   gene            520841..521320
FT                   /locus_tag="SP_0552"
FT   CDS             520841..521320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0552"
FT                   /product="SP14.3 protein"
FT                   /note="identified by similarity to EGAD:9796; match to
FT                   protein family HMM PF02576"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74708"
FT                   /db_xref="GOA:Q97S61"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="PDB:1IB8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S61"
FT                   /protein_id="AAK74708.1"
FT                   /translation="MDAIATIVELVREVVEPVIEAPFELVDIEYGKIGSDMILSIFVDK
FT                   PEGITLNDTADLTEIISPVLDTIKPDPFPEQYFLEITSPGLERPLKTKDAVAGAVGKYI
FT                   HVGLYQAIDKQKVFEGTLLAFEEDELTMEYMDKTRKKTVQIPYSLVSKARLAVKL"
FT   gene            521364..522500
FT                   /gene="nusA"
FT                   /locus_tag="SP_0553"
FT   CDS             521364..522500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="SP_0553"
FT                   /product="N utilization substance protein A"
FT                   /note="identified by similarity to EGAD:8525; match to
FT                   protein family HMM TIGR01953"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74709"
FT                   /protein_id="AAK74709.1"
FT                   /translation="MSKEMLEAFRILEEDKGIKKEDIIDAVVESLRSAYRRRYGQSDSV
FT                   AIDFNEKTGDFTVYTVREVVDEVFDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGR
FT                   VAAQSAKQTIMEKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYVNLGSIEAQLSK
FT                   QDQIPGEVFASHDRIEVYVYKVEDNPRGVNVFVSRSHPEMIKRLMEQEIPEVYDGTVEI
FT                   MSVAREAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKFHPARYDAKNDRMVPIE
FT                   ENIDVIEWVADPAEFIYNAIAPAEVDQVIFDENDSKRALVVVPDNKLSLAIGRRGQNVR
FT                   LAAHLTGYRIDIKSASEFEAMEDAASVELEVENDTVEE"
FT   gene            522522..522815
FT                   /locus_tag="SP_0554"
FT   CDS             522522..522815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:8543; match to
FT                   protein family HMM PF04296"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74710"
FT                   /protein_id="AAK74710.1"
FT                   /translation="MKTRKIPLRKSVVSNEVIDKRDLLRIVKNKEGQVFIDPTGKANGR
FT                   GAYIKLDNAEALEAKKKKVFNRSFSMEVEESFYDELIAYVDHKVKRRELGLE"
FT   gene            522808..523107
FT                   /locus_tag="SP_0555"
FT   CDS             522808..523107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0555"
FT                   /product="ribosomal protein L7A family"
FT                   /note="identified by similarity to EGAD:11014; match to
FT                   protein family HMM PF01248"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74711"
FT                   /protein_id="AAK74711.1"
FT                   /translation="MNKQKISNLLGLAQRAGRIISGEELVVKAIQDGKAKLVFLAHDAG
FT                   PNLTKKIQDKSHYYQVEIVTVFSTLELSIAVGKSRKVLAVTDAGFTKKMRSLME"
FT   gene            523124..526000
FT                   /gene="infB"
FT                   /locus_tag="SP_0556"
FT   CDS             523124..526000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="SP_0556"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by similarity to EGAD:10255; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF03144; match to protein family HMM PF04760; match to
FT                   protein family HMM TIGR00231; match to protein family HMM
FT                   TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74712"
FT                   /db_xref="GOA:Q97S57"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S57"
FT                   /protein_id="AAK74712.1"
FT                   /translation="MSKKRLYEIAKELGKESKEVVARAKELGLDVKSHSSSVEEAVAAK
FT                   IAASFKPAAAPKVEAKPAAPKVSAEKKAEKSEPAKPAVAKEEAKPAAPKASAEKKAEKS
FT                   EPVKPAVAKEEAKPAEPVTPKTEKVAAKPQSRNFKAEREARAKEQAERRKQNKGNNRDQ
FT                   QQNGNRQKNDGRNGGKQGQSNRDNRRFNDQAKKQQGQQKRRNERRQQEDKRSNQAAPRI
FT                   DFKARAAALKAEQNAEYARSSEERFKQYQAAKEALAQANKRKEPEEIFEEAAKLAEQAQ
FT                   QVQAVVEVVPEKKEPAVDTRRKKQARPDKNRDDYDHEEDGPRKQQKNRSSQNQVRNQKN
FT                   SNWNNNKKNKKGNNKNNRNQTPKPVTERKFHELPTEFEYTDGMTVAEIAKRIKREPAEI
FT                   VKKLFMMGVMATQNQSLDGETIELLMVDYGIEAKQKVEVDNADIERFFVEDGYLNEDEL
FT                   VERPPVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIVENGKKITFLDTP
FT                   GHAAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAANVPIIVAINKIDKPGA
FT                   NPERVIGELAEHGVMSTAWGGDSEFVEISAKFNQNIEELLETVLLVAEIQELKADPTVR
FT                   AIGTVIEARLDKGKGAVATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPS
FT                   TPVSITGLNEAPMAGDHFAVYEDEKSARAAGEERAKRALMKQRQATQRVSLENLFDTLK
FT                   AGELKSVNVIIKADVQGSVEALSASLQKIDVEGVKVTIVHSAVGAINESDVTLAEASNA
FT                   FIVGFNVRPTPQARQQAEADDVEIRLHSIIYKVIEEMEEAMKGMLDPEFEEKVIGEAVI
FT                   RETFKVSKVGTIGGFMVINGKVARDSKVRVIRDGVVIYDGELASLKHYKDDVKEVTNGR
FT                   EGGLMIDGYNDIKMDDVIEAYVMEEIKR"
FT   gene            526251..526601
FT                   /gene="rbfA"
FT                   /locus_tag="SP_0557"
FT   CDS             526251..526601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="SP_0557"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by similarity to GP:3947715; match to
FT                   protein family HMM PF02033; match to protein family HMM
FT                   TIGR00082"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74713"
FT                   /db_xref="GOA:Q97S56"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S56"
FT                   /protein_id="AAK74713.1"
FT                   /translation="MANHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTIIDVQMLGDL
FT                   SVAKVYYTILSNLASDNQKAQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEYGN
FT                   KIDEMLRNLDKN"
FT   gene            526844..527659
FT                   /locus_tag="SP_0558"
FT   CDS             526844..527659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3483031"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74714"
FT                   /protein_id="AAK74714.1"
FT                   /translation="MIRCKKEIRSLYMAEQDLAMQVLQQVVKLPVVKVDRSKFLVDKFS
FT                   KELDPKDIPTLLEQGPTTLLSQEILDRVANACIRDNVLLASGTSVLAGLPGGLAMAITI
FT                   PADVAQFYAFSLKLAQELGYIYGYEDLWASREELSEDAQNTLLLYLGVMLGVNGTAALL
FT                   RVGSITIAKQVMKIVPNKALTKTLWYPILKKVLKIFGVNLTKGGLAKGMGKFIPILGGI
FT                   ISGGLTFATMKPMGESLQKELSKLVNYSEVQYQEDVETIRKEAEIIKGE"
FT   gene            527661..527843
FT                   /locus_tag="SP_0559"
FT   CDS             527661..527843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0559"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74715"
FT                   /protein_id="AAK74715.1"
FT                   /translation="MNPIKAFAKIYGNYFLTVQGVKVMKTIKKADHVVVGLGKLFIADK
FT                   LMDTARWLIKPEERE"
FT   gene            complement(527796..528029)
FT                   /locus_tag="SP_0560"
FT   CDS             complement(527796..528029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0560"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74716"
FT                   /protein_id="AAK74716.1"
FT                   /translation="MEFLLVLCNLDYHLDKFKEPIQYLKHYLVKQQLDCKRDDHPKEFH
FT                   NPNNRFDKKNSKKTKKISFSLLWLNEPPSRIH"
FT   gene            528291..528536
FT                   /locus_tag="SP_0561"
FT   CDS             528291..528536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0561"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to EGAD:104317"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74717"
FT                   /protein_id="AAK74717.1"
FT                   /translation="MEVVMDNIIDVSIPVAEVVDKHPEVLEILVELGFKPLANPLMRNT
FT                   VGRKVSLKQGSKLAGTPMDKIVRTLEANGYEVIGLD"
FT   gene            528536..529870
FT                   /locus_tag="SP_0562"
FT   CDS             528536..529870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:104321; match to
FT                   protein family HMM PF04282"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74718"
FT                   /protein_id="AAK74718.1"
FT                   /translation="MTDERIHILRDILLELHNGASPESVQDRFDATFTGVSAIEISLME
FT                   HELMNSDSGVTFEDVMELCDVHANLFKNAIKGVEVSDTEHPGHPVRVFKEENLALRAAL
FT                   IRIRRLLDTYESMEDEEMLAEMRKGLVRQMGLVGQFDIHYQRKEELFFPIMERYGHDSP
FT                   PKVMWGVDDQIRELFQTALTTAKSLPEVSISSVKEAFEAFATEFESMIFKEESILLMIL
FT                   LESFTQDDWLQIAEESDAYGYAIIRPSEKWVPERQSFIEEKIAEEPVQLDTAEGQVQQV
FT                   IDTPEGHFTITFTPKEKEAVLDRHSQQAFGNGYLSVEQANLILNHLPMEITFVNKEDIF
FT                   QYYNDNTPADEMIFKRTPSQVGRNVELCHPPKYLDKVKTIMKGLREGSKDKYEMWFKSE
FT                   SRGKFVHITYAAVHDEDGEFQGVLEYVQDIQPYREIDTDYFRGLE"
FT   gene            529880..530134
FT                   /locus_tag="SP_0563"
FT   CDS             529880..530134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0563"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74719"
FT                   /protein_id="AAK74719.1"
FT                   /translation="MSYEQEFMKEFEAWVNTQIMINDMAHKESQKVYEEDQDERAKDAM
FT                   IRYESRLDAYQFLLGKFENFKVGKGFHDLPEGLFGERNY"
FT   gene            530230..530625
FT                   /locus_tag="SP_0564"
FT   CDS             530230..530625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0564"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74720"
FT                   /protein_id="AAK74720.1"
FT                   /translation="MSKKLNRKKQLRNGLRRAGAFSSTVTKVVDETKKVVKRAEQSASA
FT                   AGKAVSKKVEQAVEATKEQAQKVANSVEDFAANLGGLPLDRAKTFYDEGIKSASDFKNW
FT                   TEKELLALKGIGPATIKKLKENGIKFK"
FT   gene            531038..531487
FT                   /locus_tag="SP_0565"
FT   CDS             531038..531487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0565"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:8927331"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74721"
FT                   /protein_id="AAK74721.1"
FT                   /translation="MIGVVARENAAEQIKQYQKFTVNISDETSMLAMEQAGFISHQEKL
FT                   ERLGVHYEISERTQTPILDACPLVLDCRVDRIVEEDGICHIFAKILERLVAPELLDEKG
FT                   HFKNQLFAPTYFMGDGYQRVYRYLDKRVDMKGSFIKKARKKDGKN"
FT   gene            531474..532034
FT                   /locus_tag="SP_0566"
FT   CDS             531474..532034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0566"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74722"
FT                   /protein_id="AAK74722.1"
FT                   /translation="MARTELPDKIETERLVLRVRTVVDAEDIHTYASLPEVAYPAGFPP
FT                   VKILEDEIYYLEHILPERTQKENLPAGYGIVVKGTDKVIGSVDFNHLHADDVLELGYTL
FT                   HPDYWGRGYVPEAACSLIDLAFKELGLHKIELTCFGYNLQSQRVSEKLGFTLEARIRDR
FT                   KDAQGNCCDDLRYGLLRSEWEVI"
FT   gene            532019..532612
FT                   /locus_tag="SP_0567"
FT   CDS             532019..532612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0567"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74723"
FT                   /protein_id="AAK74723.1"
FT                   /translation="MGGDLMHLFIIGAPASGKMTIGQELSRLTDATLFYNHQAIDFALE
FT                   IYQDYTEEMWEFVRGITFSFLGASARNQRSVILTDVIDFSNQYQLMYLKQIQDLLDNFH
FT                   QEILFVELETSLEECIRRNRTENRLKHKPLKRHIEVSEREILETAETLQLNSQHQPNEL
FT                   HHYFKINNTNLSAEEAAKQIQNKINKIEKGHTHV"
FT   gene            532605..535256
FT                   /gene="valS"
FT                   /locus_tag="SP_0568"
FT   CDS             532605..535256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="SP_0568"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM TIGR00422"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74724"
FT                   /db_xref="GOA:Q97S45"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S45"
FT                   /protein_id="AAK74724.1"
FT                   /translation="MSKELSPKYNPAEVEAGRYQKWLDADVFKPSGDQKAKPYSIVIPP
FT                   PNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGIT
FT                   RYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVNL
FT                   YKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPE
FT                   TMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPELGTGVVKITPAHDP
FT                   NDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRV
FT                   HSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMEN
FT                   VHDWVISRQLWWGHQIPAWYNADGEMYVGEEAPEGDGWTQDEDVLDTWFSSALWPFSTM
FT                   GWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQ
FT                   GRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWN
FT                   ISRYILMNNEGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGV
FT                   AGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHPIMPFVT
FT                   EEIFGQISEGSIVTAAYPTVNLAFEDLAAHTGVESLKDLIRAVRNARAEVNVAPSKPIT
FT                   ILVKTSDSDLEAFFNSNVNYIKRFTNPEHLEIASTIPAPELAMSSVITGAEIYLPLADL
FT                   LNVEEELARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKECDKQADYQAKYDAT
FT                   VARIDEMKKLVK"
FT   gene            535337..535501
FT                   /locus_tag="SP_0569"
FT   CDS             535337..535501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0569"
FT                   /product="type II DNA modification methyltransferase,
FT                   truncation"
FT                   /note="identified by similarity to EGAD:8482"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75785"
FT                   /protein_id="ABC75785.1"
FT                   /translation="MGKIVAIDLFNGAGGTTSGLKKSGIDVQVAVEIDSVAVKTYKLNN
FT                   PEVSVIDME"
FT   gene            535552..537156
FT                   /locus_tag="SP_0570"
FT   CDS             535552..537156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0570"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:2687741"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74725"
FT                   /protein_id="AAK74725.1"
FT                   /translation="MSEYWFSTNVDQIDEVDGKQCLIYSYYNIKASRNVEVLKGRSGTK
FT                   KGLDYWEPYAPQKQYEMERLPKNKYIGSSSTDRWDGIEKNVVFCDCKEYVSAFDLFFYH
FT                   YNFKKISTQRSKQDFIRLRSKPVADILKNNTSSYTRYKKEMVIDNVKVDDKVCEIISEI
FT                   MDESYTDIQILTHKLYSKGDDIKASKTIWMKKSGKEYSEAFAGTGEARIILLVNDIVNA
FT                   QSNSLILIDEPEISLHPSAIYKFKEFLLQECLNKKHQIIITTHSTQLIKDFPREAVKLL
FT                   VKNGEKVDVIENIDYQDAFFELGDVYHSRKMIYVEDRLAKYILEFVITHSGSENLKQNL
FT                   VVRYIPGGANQIICNNILNSSYLDSDNHYFWLDGDQNTNVSESNNLMNYLENGVVISDK
FT                   IPESDNKNLDDIIKLITGCPIKFNVSGNKGQKNNIELIAKQRSFIDYWAKYVSYLPFPT
FT                   PEFFLANLCNSVDREGYDFSKDGNGKEYFRKKTQVALGIENITSEDIFQEQRRAVSKIQ
FT                   PESSMFQCIKEKLEALF"
FT   gene            537536..538339
FT                   /locus_tag="SP_0571"
FT   CDS             537536..538339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0571"
FT                   /product="cell filamentation protein Fic-related protein"
FT                   /note="identified by similarity to GP:9106717; match to
FT                   protein family HMM PF02661"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74726"
FT                   /protein_id="AAK74726.1"
FT                   /translation="MQPTYNIDNPNLSYEAKRDLWRIGFGLQKVDNLVPSAYMESLAEK
FT                   QSRGELTYEQVYEDATAYHHTIDASTEEADLVSLRIVELLSRRGFSFSPAILLAIHKEL
FT                   FQDIFEPSIPVGQFRQTNITKNEPVLNGESVVYSDYSMIQMTLDYDFNQEKQVAYATLT
FT                   QADMVKKIQHFISGIWQIHPFREGNTRTVTVFLIQYLREFGFDIDNTPFQQHSKYFRDA
FT                   LVLDNAKILQRRPEFLTAFFENLLLGGQNDLSSEKMYLDLDLDLS"
FT   gene            complement(538454..539654)
FT                   /pseudo
FT                   /locus_tag="SP_0572"
FT                   /note="IS1167, transposase, degenerate; this gene contains
FT                   a frame shift which is not the result of sequencing error;
FT                   identified by similarity to EGAD:42453"
FT   gene            539917..540078
FT                   /locus_tag="SP_0573"
FT   CDS             539917..540078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0573"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74727"
FT                   /protein_id="AAK74727.1"
FT                   /translation="MYNFSQSCYNQPIGIKEVTLMAVFVSLDGIVVEVLDVFSSFNGDS
FT                   EFFLCIAF"
FT   gene            540202..541032
FT                   /locus_tag="SP_0574"
FT   CDS             540202..541032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0574"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74728"
FT                   /protein_id="AAK74728.1"
FT                   /translation="MERSQFEEMFQLQSSRLTTQEKLQLFTSVFAGRYDVYAKNFINEQ
FT                   GKIQYFPSYDYGWKQLPPEKRSFQTLTNSVLKSHFRGEAAIGIFPMHLDDSCYFLVLDL
FT                   DEGDWKEAGLTIRRIARERQMEAHLEISRSGHGLHIWFFFEEAIPSREARLFGKKLIEL
FT                   AMQESMQLSFDSFDRMFPNQDVLPKGGFGNLIALPFQGEAYHQGRTVFVDEQFQPYEDQ
FT                   WRYLQEIQRISTAKVALLIQEELGKQELDKELKVVLSNMIQLEKSSVTSKALFS"
FT   gene            541218..542864
FT                   /locus_tag="SP_0575"
FT   CDS             541218..542864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0575"
FT                   /product="putative helicase"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74729"
FT                   /protein_id="AAK74729.1"
FT                   /translation="MYLFGESDHYLWLPRGLLYPLQDKFKQVSVEDRRKVQRSISVEFK
FT                   GELTFEQELALSDMTSKENGLLHAETGFGKTVLGAALISERKTKTIILVHNKQLLDQWL
FT                   DRLNCFLTFEEEEAIRYTASGREKVIGYVGQYGGTKKWLSKLVDVVMIQSLFKLENSQS
FT                   LLDEYEMMIVDECHHVSALMFEKVVAQFRGKYLYGLTATPERKNGHEPIVFQRIGEILH
FT                   TADKRETDFKRQLQLRFTSFGHLEIEKTKASNFIQLSDWIATDSVRNQMILKDILAQVA
FT                   EGRNILVLVNRIQQIDVFEKLLKEKEVDDCYIISGKTKVRERTSLLETLEQLDKGFVLL
FT                   STGKYIGEGFDLPQLDTLILAAPFSWKNNLIQYAGRIHRNYKDKSLVRIFDYVDIHVPY
FT                   LEKMFQKRQVAYRKMDYRVIEGEEKQFVYVDSRYEKVLREDLAGERQECLLILPYVHQT
FT                   KLMNFLKEFRISQIEICIPETVANKAWLDQLKSQKIKVSFTQSKIVTPILLVNKTIVWY
FT                   GAMPLLGKVDEMTILRLESASIVSELVAGLR"
FT   gene            543164..544003
FT                   /gene="licT"
FT                   /locus_tag="SP_0576"
FT   CDS             543164..544003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="licT"
FT                   /locus_tag="SP_0576"
FT                   /product="transcription antiterminator Lict"
FT                   /note="identified by similarity to SP:P39805; match to
FT                   protein family HMM PF00874; match to protein family HMM
FT                   PF03123"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74730"
FT                   /protein_id="AAK74730.1"
FT                   /translation="MIIKRILNHNAVIAQSKKDIDILLFGRGIAFGRKTGDKVNPIDIE
FT                   KSFFLKNRDNMTRFTEMFINVPLELVYITEKIINLGKITLGNNFDEIIYINLTDHISSS
FT                   IERYKEGIIISNPLRWEISKYYKEEFELGKRALQIIKKELGIELPIDEAAFIALHFVNA
FT                   NLENNFQESYKITEIIMGIEKIIQDFYCTEFNQDSIDYYRFITHIKLFAHRLVENTTYC
FT                   DDDDEDLLALMKNKYPREYECGEQVAMFIQTEYNYLLTSSELVYLMAHIRRLTKNLD"
FT   gene            544021..545859
FT                   /locus_tag="SP_0577"
FT   CDS             544021..545859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0577"
FT                   /product="PTS system, beta-glucosides-specific IIABC
FT                   components"
FT                   /note="identified by match to protein family HMM PF00358;
FT                   match to protein family HMM PF00367; match to protein
FT                   family HMM PF02378; match to protein family HMM TIGR00830;
FT                   match to protein family HMM TIGR01995"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74731"
FT                   /protein_id="AAK74731.1"
FT                   /translation="MSYKDTVQKILDVIGGEKNVNRVTHCVTRLRLELKDENLVNDDDV
FT                   KKIPGVIGIMKKNGQYQIILGNDVANYYKEFVKLGNFESDSVVQGHKGNILERIIEYIA
FT                   GSMTPIIPAMLGGGMLKVLVIILPMLGILQSDSQTIAFLTFFGDAPYYFLPLLLAYSAS
FT                   QKLKVTSTLAMSVAGVLLHPNFVQMVQSGNPLSLFGAPVTPASYGSSVVPILIMVWLMK
FT                   YIEKIIAKLTLAITKSFLQPTLVLLVSSCIALVVVGPIGVIVGEGLSNLVGQMYGVAGW
FT                   LTLAILGAIMPFIVMTGMHWAFAPIFLAASIATPDVLILPAMLGSNLAQGAASMAVALK
FT                   SKNNNTKQIAFAAGFSALLAGITEPALYGVTLKYKKPLYAAMIGGGLAGLFAGLTSVKA
FT                   YLFAVPSLIALPQFIYSDVPSNIVNALIVAVISVVITFVLAYIFGIDEEESSSNLEVEA
FT                   GVSNKKMIFSPISGEIIPLSDVQDKTFSDKLIGDGVAIIPSEGKVYAPFDGKITNIFPT
FT                   KHAIGLKSDEGVELLIHIGLDTVELKGQGFISHVEEGDRVFKNQLIFEMDLNLIKTKGY
FT                   ETVTPVIVTNTNDFLDVLVLPNNQTIEHSKELLVIL"
FT   gene            545872..547287
FT                   /gene="bglA-2"
FT                   /locus_tag="SP_0578"
FT   CDS             545872..547287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA-2"
FT                   /locus_tag="SP_0578"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /note="identified by similarity to SP:P40740; match to
FT                   protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74732"
FT                   /protein_id="AAK74732.1"
FT                   /translation="MTIFPDDFLWGGAVAANQVEGAYNEDGKGLSVQDVLPKGGLGEAT
FT                   ENPTEDNLKLIGIDFYHKYKEDISLFSEMGFNVFRTSIAWSRIFPKGDEEEPNEAGLKY
FT                   YDELFDELHAHGIEPLVTLSHYETPLYLARKYHGWVDRRMIHFYEKFARTVLERYKDKV
FT                   KYWLTFNEVNSVLELPFTSGGIDIPKENLSKQELYQAIHHELVASSLVTKIAREINSEF
FT                   KVGCMVLAMPAYPMTPNPKDVWATHEYENLNYLFSDVHVRGYYPNYAKRYFKENDINIE
FT                   FAAEDAELLKNYTVDFLSFSYYMSVTQSALPTQYNSGEGNIIGGLVNPYLESSEWGWQI
FT                   DPIGLRIILNRYYDRYQIPLFIVENGLGAKDQLIKDELNNLTVQDDYRIQYMKEHLLQV
FT                   AEALQDGVEIMGYTSWGCIDCVSMSTAQLSKRYGLIYVDRNDDGSGTLNRYKKMSFTWY
FT                   KEVIESNGESLFK"
FT   gene            547769..548815
FT                   /gene="pheS"
FT                   /locus_tag="SP_0579"
FT   CDS             547769..548815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="SP_0579"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01409;
FT                   match to protein family HMM PF02912; match to protein
FT                   family HMM TIGR00468"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74733"
FT                   /db_xref="GOA:Q97S36"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S36"
FT                   /protein_id="AAK74733.1"
FT                   /translation="MSTIEEQLKALREETLASLKQITAGNEKEMQDLRVSVLGKKGSLT
FT                   EILKGMKDVSAEMRPIIGKHVNEARDVLTAAFEETAKLLEEKKVAAQLASESIDVTLPG
FT                   RPVATGHRHVLTQTSEEIEDIFIGMGYQVVDGFEVEQDYYNFERMNLPKDHPARDMQDT
FT                   FYITEEILLRTHTSPVQARAMDAHDFSKGPLKMISPGRVFRRDTDDATHSHQFHQIEGL
FT                   VVGKNISMADLQGTLQLIVQKMFGEERQIRLRPSYFPFTEPSVEVDVSCFKCGGEGCNV
FT                   CKKTGWIEIMGAGMVHPRVLEMSGIDATVYSGFAFGLGQERVAMLRYGINDIRGFYQGD
FT                   VRFSEQFK"
FT   gene            548815..549324
FT                   /locus_tag="SP_0580"
FT   CDS             548815..549324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0580"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74734"
FT                   /protein_id="AAK74734.1"
FT                   /translation="MIRKVEMADVEVLAKIAKQTFRETFAYDNTEEQLQEYFEEAYSLK
FT                   TLSTELGNPDSETYFIMHEEEIAGFLKVNWGSAQTERELEDAFEIQRLYVLQKFQGFGL
FT                   GKQLFEFALELATKNSFSWAWLGVWEHNTKAQAFYNRYGFEKFSQHHFMVGQKVDTDWL
FT                   LRKKLR"
FT   gene            549401..551806
FT                   /gene="pheT"
FT                   /locus_tag="SP_0581"
FT   CDS             549401..551806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="SP_0581"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01588;
FT                   match to protein family HMM PF03147; match to protein
FT                   family HMM PF03483; match to protein family HMM PF03484;
FT                   match to protein family HMM TIGR00472"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74735"
FT                   /db_xref="GOA:Q97S34"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S34"
FT                   /protein_id="AAK74735.1"
FT                   /translation="MLVSYKWLKELVDIDVPSQELAEKMSTTGIEVEGVESPAAGLSKI
FT                   VVGEVLSCEDVPETHLHVCQINVGEEEERQIVCGAPNVRAGIKVMVALPGARIADNYKI
FT                   KKGKIRGLESLGMICSLGELGISDSVVPKEFADGIQILPEDAVPGEEVFSYLDLDDEII
FT                   ELSITPNRADALSMCGVAHEVAAIYDKAVNFKKFTLTETNEAAADALSVSIETDKAPYY
FT                   AARILDNVTIAPSPQWLQNLLMNEGIRPINNVVDVTNYILLYFGQPMHAFDLDTFEGTD
FT                   IRVREARDGEKLVTLDGEERDLAETDLVITVADKPVALAGVMGGQATEISEKSSRVILE
FT                   AAVFNGKSIRKTSGRLNLRSESSSRFEKGINVATVNEALDAAASMIAELAGATVRKGIV
FT                   SAGELDTSDVEVSSTLADVNRVLGTELSYADVEDVFRRLGFGLSGNADSFTVSVPRRRW
FT                   DITIEADLFEEIARIYGYDRLPTSLPKDDGTAGELTVIQKLRRQVRTIAEGAGLTEIIT
FT                   YALTTPEKAVEFTAQPSNLTELMWPMTVDRSVLRQNMISGILDTVAYNVARKNKNLALY
FT                   EIGKVFEQTGNPKEELPNEINSFAFALTGLVAEKDFQTAAVPVDFFYAKGILEALFTRL
FT                   GLQVTYTATSEIVSLHPGRTAVISLGDQVLGFLGQVHPVTAKAYDIPETYVAELNLSAI
FT                   EGALQPAVPFVEITKFPAVSRDVALLLKAEVTHQEVVDAIQAAGVKRLTDIKLFDVFSG
FT                   EKLGLGMKSMAYSLTFQNPEDSLTDEEVARYMEKIQASLEEKVNAEVR"
FT   gene            complement(551874..552875)
FT                   /locus_tag="SP_0582"
FT   CDS             complement(551874..552875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0582"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74736"
FT                   /protein_id="AAK74736.1"
FT                   /translation="MIKTFLSALSVILFSIPIITYSFFPSSNLNIWLSTQPILAQIYAF
FT                   PLATATMAAILSFLFFFLSFYKKNKQIRFYSGILLLLSLILLLFGTDKTLSSASNKTKT
FT                   LKLVTWNVANQIEAQHIERIFSHFDADMAIFPELATNIRGEQENQRIKLLFHQVGLSMA
FT                   NYDIFTSPPTNSGIAPVTVIVKKSYGFYTEAKTFHTTRFGTIVLHSRKQNIPDIIALHT
FT                   APPLPGLMEIWKQDLNIIHNQLASKYPKAIIAGDFNATMRHGALAKISSHRDALNALPP
FT                   FERGTWNSQSPKLFNATIDHILLPKNHYYVKDLDIVSFQNSDHRCIFTEITF"
FT   gene            553031..553449
FT                   /pseudo
FT                   /locus_tag="SP_0583"
FT                   /note="putative IS1239, transposase, degenerate; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to EGAD:19448"
FT   gene            553626..553838
FT                   /locus_tag="SP_0584"
FT   CDS             553626..553838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0584"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by similarity to EGAD:97130; match to
FT                   protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74737"
FT                   /protein_id="AAK74737.1"
FT                   /translation="MRVAIMSELIEARYEQGISQKKLEEVSGISQPVIARMETGKTSPQ
FT                   LDTVLKVLASLGKTLAIVPLEQGKS"
FT   gene            554099..556348
FT                   /gene="metE"
FT                   /locus_tag="SP_0585"
FT   CDS             554099..556348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="SP_0585"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="identified by similarity to SP:P05694; match to
FT                   protein family HMM PF01717; match to protein family HMM
FT                   TIGR01371"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74738"
FT                   /db_xref="GOA:Q97S31"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S31"
FT                   /protein_id="AAK74738.1"
FT                   /translation="MSTTIIGFPRLGEFRELKFTTEKYFRKEISEEELLAAAKDLRAKH
FT                   WNIVKEKGITEIPSNDFSHYDNFLDAAFLFNVVPASVQNLDLSDLERYFALGRGYQGEK
FT                   GDVRALPMKKWFNTNYHYIVPKFEKDTQVKLAGHKIFDEFQEAKELGLNTRPVLVGPFT
FT                   FLQLSDFEEGVKADDFVDSLVAAYQEVFAKLAELGATRIQLDEAALVKDLTAEEKALFL
FT                   NLYNKLLADKKGLEVLLQTYFGDVRDVYADLVNLPVDAIGLDFVEGKKTLELVKGGFPA
FT                   DKTLYVGIVNGKNIWRNNYEKSLAVLEQIPAENIVLTSSCSLLHVPFTTANEEFEPALL
FT                   NHFAFAVEKLDEIRDLDAIRNGQGSEALAANKELFATERVGENAELRARIAGLTDADYT
FT                   RLPAFAEREAIQEEAFKLPALPTTTIGSFPQTKEVRAKRLAYRKGELSQKEYDAFLAET
FT                   IDEWIKWQEDIDFDVLVHGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGMRGVKPPIIW
FT                   GDVTRLNPITVKWSSYAQSRTNKPVKGMLTGPVTILNWSFPREDISIKDSTLQIALAIK
FT                   DEVLDLEAAGVKIIQIDEAALREKLPLRRSDWYEDYLDWAIPAFRLVHSTVAPDTQIHT
FT                   HMCYSEFTDIIPAIDNMDADVISFEANRSNLEILDELKAKNFQTEVGPGVYDIHSPRVP
FT                   NEGEIDNTIEAILAKVPSKKVWINPDCGLKTRGIPETKESLIRLVEAAKAAREKL"
FT   gene            556412..557278
FT                   /locus_tag="SP_0586"
FT   CDS             556412..557278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0586"
FT                   /product="putative 5,10-methylenetetrahydrofolate
FT                   reductase"
FT                   /note="identified by similarity to EGAD:20689; match to
FT                   protein family HMM PF02219; match to protein family HMM
FT                   TIGR00676"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74739"
FT                   /protein_id="AAK74739.1"
FT                   /translation="MSRQTPSLSFEVFPPNPAVGNDNIISALQDMQELAPHFISVTASN
FT                   NKFNIKETTVRLADFIQNDLAIPTIAHLPAIYLTKDKVAETIADLDKVGVQKILALRGD
FT                   IIPDVEPQKDFRYATDLIEFIKEQTPHFDIIGACYPEGHPDSPNQISDIQNLKKKVDAG
FT                   CSSLVTQLFFDNERFYDFQDKCILAGIDVPIHAGIMPILNRNQALRLLKTCENIHLPRK
FT                   FKAILDKYEHDPESLRAAGLAYAVDQIVDLVTQDVAGVHLYTMNNADTAKYIHQATHAL
FT                   FNHQSLG"
FT   gene            complement(557460..557729)
FT                   /locus_tag="SP_0587"
FT   CDS             complement(557460..557729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0587"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74740"
FT                   /protein_id="AAK74740.1"
FT                   /translation="MLGSLSFFLRNETKIQVIKIPSRQATQRKIGNRTTERLLLGRFIF
FT                   FHRVVGKFSFQDTSLERFNTKVSKAFTLIAIGRLAKCFTNSLVK"
FT   gene            557963..560176
FT                   /gene="pnp"
FT                   /locus_tag="SP_0588"
FT   CDS             557963..560176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="SP_0588"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="identified by similarity to SP:P50849; match to
FT                   protein family HMM PF00013; match to protein family HMM
FT                   PF00575; match to protein family HMM PF01138; match to
FT                   protein family HMM PF03725; match to protein family HMM
FT                   PF03726"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74741"
FT                   /db_xref="GOA:Q97S28"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S28"
FT                   /protein_id="AAK74741.1"
FT                   /translation="MAKQVFQTTFAGRELIVETGQVAKQANGSVVVRYGESTVLTAAVM
FT                   SKKMATGDFFPLQVNYEEKMYAAGKFPGGFMKREGRPSTDATLTARLIDRPIRPMFAEG
FT                   FRNEVQVINTVLSYDENASAPMAAMFGSSLALSISDIPFDGPIAGVQVGYVDGQIIINP
FT                   SQEQAEQSLLELTVAGTKHAINMVESGAKELSEEIMLEALLKGHEAVKELIAFQEEIVA
FT                   AVGKEKAEVELLHVDAELQAEIIAAYNSDLQKAVQVEEKLAREAATQVVKDQVTAVYEE
FT                   KYADHEEFDRIMRDVAEILEQMEHAEVRRLITEDKVRPDGRKVDEIRPLDAVVDFLPRV
FT                   HGSGLFTRGQTQALSVLTLAPMGETQIIDGLDPEYKKRFMHHYNFPQYSVGETGRYGAP
FT                   GRREIGHGALGERALAQVLPSLEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGV
FT                   PIKAPVAGIAMGLISDGNNYTVLTDIQGLEDHFGDMDFKVAGTRDGITALQMDIKIQGI
FT                   TAEILTEALAQAKKARFEILDVIEATIPEVRPELAPTAPKIDTIKIDVDKIKIVIGKGG
FT                   ETIDKIIAETGVKIDIDEEGNVSIYSSDQDAINRAKEIIAGLVREAKVDEVYRAKVVRI
FT                   EKFGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKA
FT                   LLPRPPKPEHDEKGEKSERPHRPRHQKDYKPKKEFTETSKDSE"
FT   gene            560192..560809
FT                   /gene="cysE"
FT                   /locus_tag="SP_0589"
FT   CDS             560192..560809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="SP_0589"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by similarity to EGAD:23933; match to
FT                   protein family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74742"
FT                   /protein_id="AAK74742.1"
FT                   /translation="MGWWRETIDIVKENDPAARTTLEVLLTYPGVKALAAHRLSHFLWK
FT                   HGFKLLARMYSQFWRFWTQIEIHPGAQIDSGVFIDHGSGLVIGETAIVEKGVLLYHGVT
FT                   LGGTGKDCGKRHPTVRKGALISAHAQVIGPVEIGENAKVGAAAVVVADVPSDVTVVGIP
FT                   AKIVRLHGKKDEPVIHEVEEKREYYVNKLEQAKDASHRSSGL"
FT   gene            560821..561705
FT                   /locus_tag="SP_0590"
FT   CDS             560821..561705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0590"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74743"
FT                   /protein_id="AAK74743.1"
FT                   /translation="MIQARNKLSQEELSEAKKVINCCQNYDGTYRDPYLSNMLNFDPNM
FT                   PAFFLYYEKGELVGLLTVYADDQDVEVTILVHPGHRRQGIARALFTSFERETASFPIRS
FT                   VTFQTERIFLENHPDFASNWGLIEDEETETWLGKDRRPYPLANVSHLEVLLADSSYQDQ
FT                   ISQLKFQAFSEEHESREVVDRYVAEALKDPESRLYILLKAGQVIGTCTVDLSTNTNYLY
FT                   GLAILEPERGKGYGSYLAKSLVNQLIEQNDKEFQIAVEDSNVGAKRLYEKIGFVKQTQV
FT                   VYLNEKGARDSEV"
FT   gene            561787..563130
FT                   /gene="cysS"
FT                   /locus_tag="SP_0591"
FT   CDS             561787..563130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SP_0591"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74744"
FT                   /db_xref="GOA:Q97S25"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S25"
FT                   /protein_id="AAK74744.1"
FT                   /translation="MIKIYDTMSRDLREFVPIEDGKIKMYVCGPTVYNYIHVGNARSTV
FT                   AFDTIRRYFEYRGYKVAYISNFTDVDDKIINRAREEGITPQEVADKYIAAFREDVTALG
FT                   VKPATRHPRVVEFMADIIRFVEDLIEKGFAYESQGDVYFRVEKSHNYAKLANKTLEDLE
FT                   LGASGRTDEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDT
FT                   IDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHD
FT                   ALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLKYLKNTYEQPFTGNVDAQELQN
FT                   FKDKFVAAMDEDFNAANGITVVFEMAKWINSGNYDASVKQALADMLEIFGIVFVEEVLD
FT                   AEIEDLIQKRQEARANRDFATADQIRDQLVTQGIKLLDTKDGVRWTRD"
FT   gene            563123..563509
FT                   /locus_tag="SP_0592"
FT   CDS             563123..563509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108189; match to
FT                   protein family HMM PF05948"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74745"
FT                   /protein_id="AAK74745.1"
FT                   /translation="MIDVNLINGIALAFEGDAVYSMYIRRHLILKGMTKPNKLHQEATK
FT                   YVSAKAQARLIALMLEEQVLTEKEEEIYKRGRNTNSHTKAKNADVVTYRMSTGFEAVMG
FT                   YLHMTENLERLESLVSWCIQKVEG"
FT   gene            563513..564397
FT                   /gene="lrp"
FT                   /locus_tag="SP_0593"
FT   CDS             563513..564397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="SP_0593"
FT                   /product="leucine-rich protein"
FT                   /note="identified by similarity to EGAD:14491; match to
FT                   protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74746"
FT                   /protein_id="AAK74746.1"
FT                   /translation="MRAKELQDWFPEARISDQPVEKEGYLTLPLASQQWILLEEAGLSE
FT                   REKQLVALLTQQEQARSLNPWYSYLVEGKGQAPQVFKKIQLVYCHLSYFQQENLASWLD
FT                   MMRTLFPNCQTVLQVGAQDYVFVLQQDKYTSVRDILSDTIEAVEYDFGLRLSIMLGQVW
FT                   SQTGHQALSDLIKAERDLFKTWWRQGHQGVHTFSQLYLWSMGERLVDLKPIKECLHQMI
FT                   LDQDQIQEIILSLWENSAVLTKTAQQLYLHRNSLQYKIDKWEELTGLQLKELTDLTLCY
FT                   QLILGSLSTIVGL"
FT   gene            564534..564989
FT                   /locus_tag="SP_0595"
FT   CDS             564534..564989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0595"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74748"
FT                   /protein_id="AAK74748.1"
FT                   /translation="MQILCYFTITVVAKPNNSGEVHLDVSIEDNQGGSGYNFSSVSSSS
FT                   QTAKYEGTVYNNNSSLYITIDKTSDATALLKLKLNNVDNQPATEVPSSGITVKLNAKDN
FT                   AGNWTSASNKKEVTVKIVSAKPTYPDKILVKNPDNIKDTEKMPLLKN"
FT   gene            564986..565132
FT                   /locus_tag="SP_0596"
FT   CDS             564986..565132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0596"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74749"
FT                   /protein_id="AAK74749.1"
FT                   /translation="MKEANKNHPAGAPTFAKGEGEHANDIVATYSDGTTYYVPLNDVTK
FT                   YAR"
FT   gene            565278..565664
FT                   /pseudo
FT                   /locus_tag="SP_0597"
FT                   /note="Although this gene is truncated, 2 full length (1974
FT                   bp) copies fold into the secondary structures expected for
FT                   a group II intron. Left end = TTTTTTGCGGTACGACGGGC. Right
FT                   end = GAGATTATCCCCTACTCGAT.; group II intron, maturase,
FT                   degenerate; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   EGAD:135254"
FT   gene            565789..565953
FT                   /locus_tag="SP_0598"
FT   CDS             565789..565953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0598"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74750"
FT                   /protein_id="AAK74750.1"
FT                   /translation="MEVTNESNPKILGLCQQKATEKFYFISDFIGLIGRNFSLFDSDEV
FT                   QQNSRKQSL"
FT   gene            565916..567079
FT                   /gene="vex1"
FT                   /locus_tag="SP_0599"
FT   CDS             565916..567079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vex1"
FT                   /locus_tag="SP_0599"
FT                   /product="transmembrane protein Vexp1"
FT                   /note="identified by similarity to GP:5712667; match to
FT                   protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74751"
FT                   /protein_id="AAK74751.1"
FT                   /translation="MKSNKTVESNLYKSLNTSFSIKKIENGQTFKLSDLASVSKIKGLE
FT                   NVSPELETVAKLKDKEAVTGEQSVERDDLSAADNNLVSLTALEDSSKDVTFTSSAFNLK
FT                   EGRHLQKGDSKKILIHEELAKKNGLSLHDKIGLDAGQSESGKGQTVEFEIIGIFSGKKQ
FT                   EKFTGLSSDFSENQVFTDYESSQTLLGNSEAQVSAARFYVENPKEMDGLMKQVENLALE
FT                   NQGYQVEKENKAFEQIKDSVATFQTFLTIFLYGMLIAGAGALILVLSLWLRERVYEVGI
FT                   LLALGKGKSSIFLQFCLEVVLVSLGALLPAFVAGNAITTYLLQTLLASGDQASLQDTLA
FT                   KASSLSTSILSFAESYVFLVLLSCLSVALCFLFLFRKSPKEILSSIS"
FT   gene            567092..567739
FT                   /gene="vex2"
FT                   /locus_tag="SP_0600"
FT   CDS             567092..567739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vex2"
FT                   /locus_tag="SP_0600"
FT                   /product="ABC transporter, ATP-binding protein Vexp2"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74752"
FT                   /protein_id="AAK74752.1"
FT                   /translation="MTLLQLQDVTYRYKNTAEAVLYQINYNFEPGKFYSIIGESGAGKS
FT                   TLLSLLAGLDSPVEGSILFQGEDIRKKGYSYHRMHHISLVFQNYNLIDYLSPLENIRLV
FT                   NKKASKNTLLELGLDESQIKRNVLQLSGGQQQRVAIARSLVSEAPVILADEPTGNLDPK
FT                   TAGDIVELLKSLAQKTGKCVIVVTHSKEVAQASDITLELKDKKLTETRNTSK"
FT   gene            567791..569170
FT                   /gene="vex3"
FT                   /locus_tag="SP_0601"
FT   CDS             567791..569170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vex3"
FT                   /locus_tag="SP_0601"
FT                   /product="transmembrane protein Vexp3"
FT                   /note="identified by similarity to GP:5712669; match to
FT                   protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74753"
FT                   /protein_id="AAK74753.1"
FT                   /translation="MLHNAFAYVTRKFFKSIVIFLIILLMASLSLVGLSIKGATAKASQ
FT                   ETFKNITNSFSMQINRRVNQGTPRGAGNIKGEDIKKITENKAIESYVKRINAIGDLTGY
FT                   DLIETPETKKNLTADRAKRFGSSLMITGVNDSSKEDKFVSGSYKLVEGEHLTNDDKDKI
FT                   LLHKDLAAKHGWKVGDKVKLDSNIYDADNEKGAKETVEVTIKGLFDGHNKSAVTYSQEL
FT                   YENTAITDIHTAAKLYGYTEDTAIYGDATFFVTADKNLDDVMKELNGISGINWKSYTLV
FT                   KSSSNYPALEQSISGMYKMANLLFWGSLSFSVLLLALLLSLWINARRKEVGILLSIGLK
FT                   QASILGQFITESILIAIPALVSAYFLANYTARAIGNTVLANVTSGVAKQASKAAQASNL
FT                   GGGAEVDGFSKTLSSLDISIQTSDFIIIFVLALVLVVLVMALASSNLLRKQPKELLLDG
FT                   E"
FT   gene            569350..569433
FT                   /gene="pep27"
FT                   /locus_tag="SP_0602"
FT   CDS             569350..569433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pep27"
FT                   /locus_tag="SP_0602"
FT                   /product="pep27 protein"
FT                   /note="identified by similarity to GP:5712670"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74754"
FT                   /protein_id="AAK74754.1"
FT                   /translation="MRKEFHNVLSSGQLLADKRPARDYNRK"
FT   gene            569482..570138
FT                   /gene="vncR"
FT                   /locus_tag="SP_0603"
FT   CDS             569482..570138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vncR"
FT                   /locus_tag="SP_0603"
FT                   /product="DNA-binding response regulator VncR"
FT                   /note="identified by similarity to GP:5830544; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74755"
FT                   /protein_id="AAK74755.1"
FT                   /translation="MKILIVEDEEMIREGVSDYLTDCGYETIEAADGQEALEQFSSYEV
FT                   ALVLLDIQMPKLNGLEVLAEIRKTSQVPVLMLTAFQDEEYKMSAFASLADGYLEKPFSL
FT                   SLLKVRVDAIFKRYYDTGRIFSYKDTKVDFESYSASLAGQEVPINAKELEILDYLVKNE
FT                   GRALTRSQIIDAVWKATDEVPFDRVIDVYIKELRKKLDLDCILTVRNVGYKLERK"
FT   gene            570135..571463
FT                   /gene="vncS"
FT                   /locus_tag="SP_0604"
FT   CDS             570135..571463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vncS"
FT                   /locus_tag="SP_0604"
FT                   /product="sensor histidine kinase VncS"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by similarity to GP:5830545; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74756"
FT                   /protein_id="AAK74756.1"
FT                   /translation="MKRTGLFAKIFIYTFSIFSVLVICLHLAIYFLFPSTYLSHRQETI
FT                   GQKATAIAQSLEGKDRQSIEQVLDLYSQTSDIKGTVKGEMTEDKLEVKDSLPLDTDRQT
FT                   TSLFIEEREVKTQDGGTMILQFLASMDLQKEAEQISLQFLPYTLLASFLISLLVAYIYA
FT                   RTIVAPILEIKRVTRRMMDLDSQVRLRVDSKDEIGNLKEQINSLYQHLLTVIADLHEKN
FT                   EAILQLEKMKVEFLRGASHELKTPLASLKILIENMRENIGRYKDRDQYLGVALGIVDEL
FT                   NHHVLQILSLSSVQELRDDRETIDLLQMTQNLVKDYALLAKERELQIDNSLTHQQAYLN
FT                   PSVMKLILSNLISNAIKHSVPGGLVRIGEREGELFIENSCSSEEQEKLAQSFSDNASRK
FT                   VKGSGMGLFVVKSLLEHEKLAYRFEMEENSLTFFIDFPKVVQD"
FT   gene            571604..572485
FT                   /gene="fba"
FT                   /locus_tag="SP_0605"
FT   CDS             571604..572485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="SP_0605"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167; match to protein
FT                   family HMM TIGR01859"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74757"
FT                   /db_xref="GOA:P0A4S1"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4S1"
FT                   /protein_id="AAK74757.1"
FT                   /translation="MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPV
FT                   LIQTSMGAAKYMGGYKVARNLIANLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIM
FT                   FDGSHLPVEENLKLAKEVVEKAHAKGISVEAEVGTIGGEEDGIIGKGELAPIEDAKAMV
FT                   ETGIDFLAAGIGNIHGPYPVNWEGLDLDHLQKLTEALPGFPIVLHGGSGIPDEQIQAAI
FT                   KLGVAKVNVNTECQIAFANATRKFARDYEANEAEYDKKKLFDPRKFLADGVKAIQASVE
FT                   ERIDVFGSEGKA"
FT   gene            complement(572806..574008)
FT                   /locus_tag="SP_0606"
FT   CDS             complement(572806..574008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0606"
FT                   /product="putative oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00175"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74758"
FT                   /protein_id="AAK74758.1"
FT                   /translation="MEFSMKSVKGLLFIIASFILTLLTWMNTSPQFMIPGLALTSLSLT
FT                   FILATRLPLLESWFHSLEKVYTVHKFTAFLSIILLIFHNFSMGGLWGSRLAAQFGNLAI
FT                   YIFASIILVAYLGKYIQYEAWRWIHRLVYLAYILGLFHIYMIMGNRLLTFNLLSFLVGS
FT                   YALLGLLAGFYIIFLYQKISFPYLGKITHLKRLNHDTREIQIHLSRPFNYQSGQFAFLK
FT                   IFQEGFESAPHPFSISGGHGQTLYFTVKTSGDHTKNIYDNLQAGSKVTLDRAYGHMIIE
FT                   EGRENQVWIAGGIGITPFISYIREHPILDKQVHFYYSFRGDENAVYLDLLRNYAQKNPN
FT                   FELHLIDSTKDGYLNFEQKEVPEHATVYMCGPISMMKALAKQIKKQNPKTELIYEGFKF
FT                   K"
FT   gene            complement(574254..574913)
FT                   /locus_tag="SP_0607"
FT   CDS             complement(574254..574913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0607"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by similarity to EGAD:37775; match to
FT                   protein family HMM PF00528; match to protein family HMM
FT                   TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74759"
FT                   /protein_id="AAK74759.1"
FT                   /translation="MESILEVLTPDNLVFIFKGFGLTLYISLIAIILSTIIGTVLAVTR
FT                   NGKNPVLRIISSIYIEFVRNVPNLLWIFTIFLVFKMKSTPAGITAFTLFTSAALAEIIR
FT                   GGLNAVDKGQYEAGMSQGFTSAQILYYIILPQAIRKMLPAIISQFVTVIKDTSLLYSVI
FT                   ALQELFGASQILMGRYFEPEQVFSLYILIALIYFSFNLAISSLSHMLAKRWQQAAE"
FT   gene            complement(574923..575600)
FT                   /locus_tag="SP_0608"
FT   CDS             complement(574923..575600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0608"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by similarity to EGAD:45958; match to
FT                   protein family HMM PF00528; match to protein family HMM
FT                   TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74760"
FT                   /protein_id="AAK74760.1"
FT                   /translation="MTDLSSWTAYFQDFGQFFNGFLFTLALAVGSFILAMVLGIFFGAM
FT                   STSKRPILRILARIFVEFYQNTPLLVQFVIVFYGLPLISDHIIMIPIYWTAVLCVGLYH
FT                   GAYIAEVIRSGIQSIPSGQMEAALSQGFTYISAMRLIILPQAFRIILPPLTNQIVNLIK
FT                   NTSTVAIISGVDLMFVTKSWSALNGNYIPAFLGAALLYFALCFPVAQFGRKMEQANKKA
FT                   YSL"
FT   gene            complement(575613..576377)
FT                   /locus_tag="SP_0609"
FT   CDS             complement(575613..576377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0609"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein"
FT                   /note="identified by similarity to EGAD:17088; match to
FT                   protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74761"
FT                   /protein_id="AAK74761.1"
FT                   /translation="MISLFGLAAAKPVQADTSIADIQKRGELVVGVKQDVPNFGYKDPK
FT                   TGTYSGIETDLAKMVADELKVKIRYVPVTAQTRGPLLDNEQVDMDIATFTITDERKKLY
FT                   NFTSPYYTDASGFLVNKSAKIKKIEDLNGKTIGVAQGSITQRLITELGKKKGLKFKFVE
FT                   LGSYPELITSLHAHRIDTFSVDRSILSGYTSKRTALLDDSFKPSDYGIVTKKSNTELND
FT                   YLDNLVTKWSKDGSLQKLYDRYKLKPSSHTAD"
FT   gene            complement(576417..577175)
FT                   /locus_tag="SP_0610"
FT   CDS             complement(576417..577175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0610"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P27675; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74762"
FT                   /protein_id="AAK74762.1"
FT                   /translation="MALVEFKNVEKYYGDYHAFRNINLRFEKGQVVVLLGPSGSGKSTL
FT                   IRTINGLETVDKGSLLVNGHQVAGASQKDLVPLRKEVGMVFQHFNLYPHKAVLENVTLA
FT                   PIEVLGIDKKEAEKTAQKYLEFVNMWDKKDSYPAMLSGGQKQRIAIARGLAMHPELLLF
FT                   DEPTSALDPETIGDVLAVMQKLAHDGMNMIIVTHEMGFAREVADRIIFMADGEVLVDTT
FT                   DVDNFFDNPSEPRAQQFLSKIINHESDKVK"
FT   gene            577452..579674
FT                   /gene="recJ"
FT                   /locus_tag="SP_0611"
FT   CDS             577452..579674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="SP_0611"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by similarity to EGAD:24228; match to
FT                   protein family HMM PF01368; match to protein family HMM
FT                   PF02272; match to protein family HMM TIGR00644"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74763"
FT                   /protein_id="AAK74763.2"
FT                   /translation="MITPTYEWQFALQVEDADFTKIAKKAGLGPEVARLLFERGIQNQE
FT                   SLKKFLEPSLEDLHDAYLLHDMDKAVERIRQAIEEGENILVYGDYDADGMTSASIVKES
FT                   LEQLGAECRVYLPNRFTDGYGPNASVYKYFIEQEGISLIVTVDNGVAGHEAIALAQSMG
FT                   VDVIVTDHHSMPETLPDAYAIVHPEHPDADYPFKYLAGCGVAFKLACALLEEVQVELLD
FT                   LVAIGTIADMVSLTDENRILVQYGLEMLGHTQRIGLQEMLDMAGIAANEVTEETVGFQI
FT                   APRLNALGRLDDPNPAIDLLTGFDDEEAHEIALMIHQKNEERKEIVQSIYEEAKTMVDP
FT                   EKKVQVLAKEGWNPGVLGIVAGRLLEELGQTVIVLNIEDGRAKGSARSVEAVDIFEALD
FT                   PHRDLFIAFGGHAGAAGMTLEVEQLSDLSQVLEDYVREKGADAGGKNKLNLDEELDLEA
FT                   LSLETVKSFERLAPFGMDNQKPIFYIKNFQVESARTMGAGNAHLKLKISKGEASFEVVA
FT                   FGQGRWATEFSQTKNLELAVKLSVNQWNGQTALQLMMVDARVEGVQLFNIRGKNAVLPE
FT                   GVPVLDFPGELPNLAASEAVVVKNIPEDITQLKTIFQEQHFSAVYFKNDIDKAYYLTGY
FT                   GTRDQFAKLYKTIYQFPEFDIRYKLKDLAAYLNIQQILLVKMIQVFEELGFVTIKDGVM
FT                   TVNKEAPKREIGESQIYQNLKQTVKDQEMMALGTVQEIYDFLMEKE"
FT   gene            579708..579806
FT                   /locus_tag="SP_0612"
FT   CDS             579708..579806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0612"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74764"
FT                   /protein_id="AAK74764.1"
FT                   /translation="MKTDLHFENHQKNGIMVGKDSAESIRTFRIRG"
FT   gene            579849..581510
FT                   /locus_tag="SP_0613"
FT   CDS             579849..581510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0613"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="identified by similarity to EGAD:30422; match to
FT                   protein family HMM PF00753; match to protein family HMM
FT                   PF07521"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74765"
FT                   /protein_id="AAK74765.1"
FT                   /translation="MSNISLTTLGGVRENGKNMYIAEIGESIFVLNVGLKYPENEQLGV
FT                   DVVIPNMDYLFENSDRIAGVFLTHGHADAIGALPYLLAEAKVPVFGSELTIELAKLFVK
FT                   GNDAVKKFNDFHVIDENTEIDFGGTVVSFFPTTYSVPESLGIVLKTSEGSIVYTGDFKF
FT                   DQTASESYATDFARLAEIGRDGVLALLSDSANADSNIQVASESEVRDEITQTIADWEGR
FT                   IIVAAVSSNLSRIQQIFDAADKTGRRIVLTGFDIENIVRTAIRLKKLSLANEILLIKPK
FT                   DMSRFEDHELIILETGRMGEPINGLRKMSIGRHRYVEIKDGDLVYIATAPSIAKEAFVA
FT                   RVENMIYQAGGVVKLITQSLHVSGHGNVRDLQLMINLLQPKYLFPVQGEYRELDAHAKA
FT                   AMAVGMLPERIFIPKKGTTMAYENGDFVPAGSVSAGDILIDGNAIGDVGNVVLRDRKVL
FT                   SEDGIFIVAITVNRREKKIVARARVHTRGFVYLKKSRDILRESSELINQTVEEYLQGDD
FT                   FDWADLKGKVRDNLTKYLFDQTKRRPAILPVVMEAK"
FT   gene            581579..582358
FT                   /gene="estA"
FT                   /locus_tag="SP_0614"
FT   CDS             581579..582358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="estA"
FT                   /locus_tag="SP_0614"
FT                   /product="tributyrin esterase"
FT                   /note="identified by similarity to GP:7453516; match to
FT                   protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74766"
FT                   /protein_id="AAK74766.1"
FT                   /translation="MAVMKIEYYSQVLDMEWGVNVLYPDANRVEEPECEDIPVLYLLHG
FT                   MSGNHNSWLKRTNVERLLRGTNLIVVMPNTSNGWYTDTQYGFDYYTALAEELPQVLKRF
FT                   FPNMTSKREKTFIAGLSMGGYGCFKLALTTNRFSHAASFSGALSFQNFSPESQNLGSPA
FT                   YWRGVFGEIRDWTTSPYSLESLAKKSDKKTKLWAWCGEQDFLYEANNLAVKNLKKLGFD
FT                   VTYSHSAGTHEWYYWEKQLEVFLTTLPIDFKLEERLT"
FT   gene            582470..583690
FT                   /gene="fibA"
FT                   /locus_tag="SP_0615"
FT   CDS             582470..583690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fibA"
FT                   /locus_tag="SP_0615"
FT                   /product="beta-lactam resistance factor"
FT                   /note="identified by similarity to GP:7649681; match to
FT                   protein family HMM PF02388"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74767"
FT                   /protein_id="AAK74767.1"
FT                   /translation="MYRYQIGIPTLEYDQFVKEHELANVLQSSAWEEVKSNWQHEKFGV
FT                   YREEKLLATASILIRTLPLGYKMFYIPRGPILDYGDKELLNFAIQSIKSYARSKRAVFV
FT                   TFDPSICLSQSLINQEKTEFPENLAIIDSLQQMGVRWSGKTEEMGDTIQPRIQAKIYKE
FT                   NFEEDKLSKSTKQAIRTARNKGLEIQYGGLELLDSFSELMKKTEKRKEIHLRNEAYYKK
FT                   LLDNFKDKAYITLATLDVSKRSQELEEQLAKNRALEETFTESTRTSKVEAQKKEKERLL
FT                   EELTFLQEYIDVGQARVPLAATLSLEFGTTSVNIYAGMDDDFKRYNAPILTWYETARYA
FT                   FERGMIWQNLGGVENSLNGGLYHFKEKFNPTIEEYLGEFTMPTHPLYPLLRLALDFRKT
FT                   LRKKHRK"
FT   gene            583695..584927
FT                   /gene="fibB"
FT                   /locus_tag="SP_0616"
FT   CDS             583695..584927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fibB"
FT                   /locus_tag="SP_0616"
FT                   /product="beta-lactam resistance factor"
FT                   /note="identified by similarity to GP:7649683; match to
FT                   protein family HMM PF02388"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74768"
FT                   /protein_id="AAK74768.1"
FT                   /translation="MALTTLTKEEFQTYSDQVSSRSFMQSVQMGDLLEKRGARIVYLAL
FT                   KQEGEIQVAALVYSLPMLGGLHMELNSGPIYTQQDALPVFYAELKEYAKQNGVLELLVK
FT                   PYETYQTFDSQGNPIDAEKKSIIQDLTDLGYQFDGLTTGYPGGEPDWLYYKDLTELTEK
FT                   SLLKSFSKKGKPLVKKAETFGIRLKKLKREELSIFKNITKETSERREYSDKSLEYYEHF
FT                   YDTFGEQAEFLIASLNFSDYMSKLQGEQSKLEENLDKLRLDLSKNPHSEKKQNQLREYS
FT                   SQFETFEVRKAEARDLIEKYGEEDIVLAGSLFVYMPQETTYLFSGSYTEFNKFYAPALL
FT                   QKYVMLESIKRGIPKYNFLGIQGIFDGSDGVLRFKQNFNGYIVRKAGTFRYHPSPLKYK
FT                   AIQLLKKIVGR"
FT   gene            584985..585707
FT                   /locus_tag="SP_0617"
FT   CDS             584985..585707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0617"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF00413"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74769"
FT                   /protein_id="AAK74769.1"
FT                   /translation="MLERWRDMRWLFRLIGAFFSFVWRLFWRLVWIVVLLCVLAFGLLW
FT                   YLNGDFQGALKQAERSVKIGQQSIDQWEKTGQLPKLSQTDSHQHSEGRWAQASARIYLD
FT                   PQMDSRFQEAYLEAIQNWNQTGAFNFELVTESSKADITATEMNDGGTPVAGEAESQTNL
FT                   LTGQFLSVTVRLNHYYLSNPYYGYSYERLVHTAEHELGHAIGLDHTDEKSVMQPAGSFY
FT                   GIQEEDVANLRKIYETSE"
FT   gene            585747..587591
FT                   /gene="uvrC"
FT                   /locus_tag="SP_0618"
FT   CDS             585747..587591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="SP_0618"
FT                   /product="excinuclease ABC, subunit C"
FT                   /note="identified by similarity to EGAD:18538; match to
FT                   protein family HMM PF01541; match to protein family HMM
FT                   PF02151; match to protein family HMM TIGR00194"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74770"
FT                   /db_xref="GOA:Q97S07"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027299"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97S07"
FT                   /protein_id="AAK74770.1"
FT                   /translation="MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF
FT                   RGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKI
FT                   TNERYPRLIITRQVKKDGGLYFGPYPDVGAANEIKRLLDRIFPFRKCTNPPSKVCFYYH
FT                   IGQCMAHTICKKDEAYFKSMAQEVSDFLKGQDDKIIDDLKSKMAVAAQSMEFERAAEYR
FT                   DLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFN
FT                   DPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDSKILKPQRGEKKQLVNLA
FT                   IKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMV
FT                   VFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQ
FT                   VNIAKQVIQEELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDE
FT                   VHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMKHFKSLTKIKEASVDEIVEVGV
FT                   PRVVAEAVQRKLNPQGEALPQVAEERVDYQTEGNHNEP"
FT   gene            587581..588414
FT                   /locus_tag="SP_0619"
FT   CDS             587581..588414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0619"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:165239; match to
FT                   protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74771"
FT                   /protein_id="AAK74771.1"
FT                   /translation="MNHKIAILSDVHGNATALEAVIADAKNQGASEYWLLGDIFLPGPG
FT                   ANDLVALLKDLPITASVRGNWDDRVLEALDGQYGLEDPQEVQLLRMTQYLMERMDPATI
FT                   VWLRSLPLLEKKEIDGLRFSISHNLPDKNYGGDLLVENDTEKFDQLLDAETDVAVYGHV
FT                   HKQLLRYGSQGQQIINPGSIGMPYFNWEALKNHRSQYAVIEVEDGELLNIQFRKVAYDY
FT                   EAELELAKSKGLPFIEMYEELRRDDNYQGHNLELLASLIEKHGYVEDVKNFFDFL"
FT   gene            complement(588596..589396)
FT                   /locus_tag="SP_0620"
FT   CDS             complement(588596..589396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0620"
FT                   /product="putative amino acid ABC transporter, amino
FT                   acid-binding protein"
FT                   /note="identified by similarity to EGAD:45957; match to
FT                   protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74772"
FT                   /protein_id="AAK74772.1"
FT                   /translation="MKKFSLLLAILPFLVACENQATPKETSAQKTIVLATAGDVPPFDY
FT                   EDKGNLTGFDIEVLKAVDEKLSDYEIQFQRTAWESIFPGLDSGHYQAAANNLSYTKERA
FT                   EKYLYSLPISNNPLVLVSNKKNPLTSLDQIAGKTTQEDTGTSNAQFINNWNQKHTDNPA
FT                   TINFSGEDIGKRILDLANGEFDFLVFDKVSVQKIIKDRGLDLSVVDLPSADSPSNYIIF
FT                   SSDQKEFKEQFDKALKELYQDGTLEKLSNTYLGGSYLPDQSQLQ"
FT   gene            589470..589580
FT                   /locus_tag="SP_0621"
FT   CDS             589470..589580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0621"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74773"
FT                   /protein_id="AAK74773.1"
FT                   /translation="MSVIEKLNHEKSLQALSNYGRMEAVELEKEIDYEIS"
FT   gene            589567..590172
FT                   /locus_tag="SP_0622"
FT   CDS             589567..590172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0622"
FT                   /product="nitroreductase family protein"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74774"
FT                   /protein_id="AAK74774.1"
FT                   /translation="MKFLELNKKRHATKHFTDKLVDPKDVRTAIEIATLAPSAHNSQPW
FT                   KFVVVREKNAELAKLAYGSNFEQVSSAPVTIALFTDTDLAKRARKIARVGGANNFSEEQ
FT                   LQYFMKNLPAEFARYSEQQVSDYLALNAGLVAMNLVLALTDQGIGSNIILGFDKSKVNE
FT                   VLEIEDRFRPELLITVGYTDEKLEPSYRLPVDEIIEKR"
FT   gene            590185..591585
FT                   /gene="pepV"
FT                   /locus_tag="SP_0623"
FT   CDS             590185..591585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepV"
FT                   /locus_tag="SP_0623"
FT                   /product="dipeptidase"
FT                   /note="identified by similarity to EGAD:128687; match to
FT                   protein family HMM PF01546; match to protein family HMM
FT                   TIGR01886; match to protein family HMM TIGR01887"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74775"
FT                   /protein_id="AAK74775.1"
FT                   /translation="MTAIDFTAEVEKRKEDLLADLFSLLEINSERDDSKADAQHPFGPG
FT                   PVKALEKFLEIADRDGYPTKNVDNYAGHFEFGDGEEVLGIFAHMDVVPAGSGWDTDPYT
FT                   PTIKDGRLYARGASDDKGPTTACYYGLKIIKELGLPTSKKVRFIVGTDEESGWADMDYY
FT                   FEHVGLAKPDFGFSPDAEFPIINGEKGNITEYLHFAGENTGVARLHSFTGGLRENMVPE
FT                   SATAVVSGDLADLQAKLDAFVAEHKLRGELQEEAGKYKVTIIGKSAHGAMPASGVNGAT
FT                   YLALFLSQFGFAGPAKDYLDIAGKILLNDHEGENLKIAHVDEKMGALSMNAGVFHFDET
FT                   SADNTIALNIRYPKGTSPEQIKSILENLPVVSVSLSEHGHTPHYVPMEDPLVQTLLNIY
FT                   EKQTGFKGHEQVIGGGTFGRLLERGVAYGAMFPDSIDTMHQANEFIALDDLFRAAAIYA
FT                   EAIYELIK"
FT   gene            591639..592217
FT                   /locus_tag="SP_0624"
FT   CDS             591639..592217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0624"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:162574; match to
FT                   protein family HMM PF03167"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74776"
FT                   /protein_id="AAK74776.1"
FT                   /translation="MSQIERIKQAIMADSQNASYTERGIEPLFAAPKTARINIIGQAPG
FT                   LKTQEAGLYWKDKSGDRLRDWLGVDEDTFYNSGYFAVLPMDFYFPGHGKSGDLPPRTGF
FT                   AEKWHPQVLQELPDIQLTLLIGQYAQAYYLQEKISGKVTERVKHYKDYLPAYFPLVHPS
FT                   PRNQIWMAKNPWFEAEVVPDLKKRIKTIL"
FT   gene            592377..592664
FT                   /pseudo
FT                   /locus_tag="SP_0625"
FT                   /note="conserved hypothetical protein, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   OMNI:NT01BS3531"
FT   gene            592820..594160
FT                   /gene="brnQ"
FT                   /locus_tag="SP_0626"
FT   CDS             592820..594160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="SP_0626"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by similarity to EGAD:22109; match to
FT                   protein family HMM PF05525; match to protein family HMM
FT                   TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74777"
FT                   /protein_id="AAK74777.1"
FT                   /translation="MKEIFMAKKGTLTGLLLFGIFFGAGNLIFPPSLGALSGEHFLPAI
FT                   AGFVFSGVGIAVLTLIIGTLNPKGYIYEISTKIAPWFATLYLSVLYLSIGPFFATPRTA
FT                   TTAYEVGISPLLSDANKGLGLIVFTVLYFAAAYLISLNPSKILDRIGRILTPVFAILIV
FT                   ILVVLGAIKYGGTSPQAASAAYQASAFGTGFLEGYNTLDALASVAFSVIAVQTLKQLGF
FT                   SSKKEYISTIWVVGIVVALAFSALYIGLGFLGNHFPVPAEAMKGGTPGVYILSQATQEI
FT                   FGSTAQLFLAAMVTVTCFTTTVGLIVSTAEFFNERFPQISYKVYATAFTLIGFAIANLG
FT                   LDAIIKYSIPVLVILYPITIAIVMIVIVNKFVALSKPGMQLTIAVVTVIAIASVLGSSF
FT                   KVEFLANLVSVLPFAKASLPWLVPAIVGILLSLVLPNKQESDVFEME"
FT   gene            594258..595295
FT                   /locus_tag="SP_0627"
FT   CDS             594258..595295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05343"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74778"
FT                   /protein_id="AAK74778.1"
FT                   /translation="MNQTVEYIKELTAIASPTGFTREIADYLVKTLEGFGYQPVRTSKG
FT                   GVNVTIKGQNDEQHRYVTAHVDTLGAIVRAVKPDGRLKMDRIGGFPWNMIEGENCTIHV
FT                   ASTGEKVSGTILIHQTSCHVYKDAGTAERTQDNMEVRLDAKVTSEKETRALGIEVGDFI
FT                   SFDPRTVVTETGFIKSRHLDDKVSAAILLNLLRIYKEEKIELPVTTHFAFSVFEEVGHG
FT                   ANSNIPAQVVEYLAVDMGAMGDDQQTDEYTVSICVKDASGPYHYDFRQHLVALAKEQDI
FT                   PFKLDIYPFYGSDASAAMSAGAEVKHALLGAGIESSHSYERTHIDSVIATERMVDAYLK
FT                   STLVD"
FT   gene            595264..595767
FT                   /locus_tag="SP_0628"
FT   CDS             595264..595767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0628"
FT                   /product="HIT family protein"
FT                   /note="identified by similarity to EGAD:51393; match to
FT                   protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74779"
FT                   /protein_id="AAK74779.1"
FT                   /translation="MLILRARWWTNMCLICQRIDLIKKEENPYFVKELETGYLVVGDHQ
FT                   YFEGYSLFLAKEHVSELHHLKKETRLRFLEEMSLVQEAVAKAFAAEKMNIELLGNGDAH
FT                   LHWHLFPRRTGDMNGHGLKGRGPVWWVPFEEMTAETCQAKPDEIKRLVKRLSSEVDKLL
FT                   EIKE"
FT   gene            595770..596486
FT                   /locus_tag="SP_0629"
FT   CDS             595770..596486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0629"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:109297; match to
FT                   protein family HMM PF02557"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74780"
FT                   /protein_id="AAK74780.1"
FT                   /translation="MKKRYLVLTALLALSLAACSQEKTKNEDGETKTEQTAKADGTVGS
FT                   KSQGAAQKKAEVVNKGDYYSIQGKYDEIIVANKHYPLSKDYNPGENPTAKAELVKLIKA
FT                   MQEAGFPISDHYSGFRSYETQTKLYQDYVNQDGKAAADRYSARPGYSEHQTGLAFDVIG
FT                   TDGDLVTEEKAAQWLLDHAADYGFVVRYLKGKEKETGYMAEEWHLRYVGKEAKEIAASG
FT                   LSLEEYYGFEGGDYVD"
FT   gene            596795..597220
FT                   /gene="rplK"
FT                   /locus_tag="SP_0630"
FT   CDS             596795..597220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="SP_0630"
FT                   /product="ribosomal protein L11"
FT                   /note="identified by similarity to EGAD:13156; match to
FT                   protein family HMM PF00298; match to protein family HMM
FT                   PF03946; match to protein family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74781"
FT                   /db_xref="GOA:Q97RZ6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RZ6"
FT                   /protein_id="AAK74781.1"
FT                   /translation="MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNAR
FT                   TADQAGMIIPVVISVYEDKSFTFVTKTPPAAVLLKKAAGVEKGSGTPNKTKVATVTRAQ
FT                   VQEIAETKMPDLNAANVESAMRMIEGTARSMGFTVVD"
FT   gene            597427..598116
FT                   /gene="rplA"
FT                   /locus_tag="SP_0631"
FT   CDS             597427..598116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="SP_0631"
FT                   /product="ribosomal protein L1"
FT                   /note="identified by similarity to EGAD:13176; match to
FT                   protein family HMM PF00687; match to protein family HMM
FT                   TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74782"
FT                   /db_xref="GOA:P66095"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66095"
FT                   /protein_id="AAK74782.1"
FT                   /translation="MAKKSKQLRAALEKIDSTKAYSVEEAVALAKETNFAKFDATVEVA
FT                   YNLNIDVKKADQQIRGAMVLPNGTGKTSRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   NDGWLDFDVVIATPDMMALVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADRAGNVQAIIGKVSFEAEKLVENFKAFNETIQKAKPATAKGTYVTNLTITTTQGVGI
FT                   KVDVNSL"
FT   gene            598230..598343
FT                   /pseudo
FT                   /locus_tag="SP_0632"
FT                   /note="Although this gene is truncated, 2 full length (1974
FT                   bp) copies fold into the secondary structures expected for
FT                   a group II intron. Left end = TTTTTTGCGGTACGACGGGC. Right
FT                   end = GAGATTATCCCCTACTCGAT.; group II intron, maturase,
FT                   truncation; comparison of this gene to its homologs
FT                   suggests this gene has been truncated; identified by
FT                   similarity to GP:2804734"
FT   gene            598658..599020
FT                   /locus_tag="SP_0633"
FT   CDS             598658..599020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0633"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74783"
FT                   /protein_id="AAK74783.1"
FT                   /translation="MLEVGLNFLISLFTFTFDILYPIVKVGHTDDYSHGAVKLSVSLVD
FT                   KDAMKKIFVTVIGYFEINIDENITDILYVNGTAILYLYLRSIVSIVSAIDSSEAMLLPI
FT                   INVLELLDKSQPFEEE"
FT   gene            599323..599664
FT                   /locus_tag="SP_0634"
FT   CDS             599323..599664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0634"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:7160903"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74784"
FT                   /protein_id="AAK74784.1"
FT                   /translation="MFSSYFNPLYIMVSNLHQNDKINQLISDYKQNMKAFYITIEKFIR
FT                   DDESLKCYFIKVISSRSKVTSLDQIEADKTIQRKYSSELKKFIGFYNEIICEENSFLHV
FT                   RKRWSSWFR"
FT   gene            complement(599592..599759)
FT                   /locus_tag="SP_0635"
FT   CDS             complement(599592..599759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0635"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74785"
FT                   /protein_id="AAK74785.1"
FT                   /translation="MLRMIVSKQYLLFYLIHEKEVHTLRIINSRIDYLNQLDHLFRTCR
FT                   KLFSSQIISL"
FT   gene            600065..601057
FT                   /locus_tag="SP_0636"
FT   CDS             600065..601057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0636"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74786"
FT                   /protein_id="AAK74786.1"
FT                   /translation="MAMIEVEHLQKNFVKTVKEPGLKGALRSFIHPEKQTFEAVKDLTF
FT                   EVPKGQILGFIGANGAGKSTTIKMLTGILKPTSGFCRINGKIPQDNRQDYVKDIGVVFG
FT                   QRTQLWWDLALQETYTVLKEIYDVPDSLFHKRMDFLNEVLDLKDFIKDPVRTLSLGQRM
FT                   RADIAASLLHNPKVLFLDEPTIGLDVSVKDNIRRAITQINQEEETTILLTTHDLSDIEQ
FT                   LCDRIFMIDKGQEIFDGTVSQLKETFGKMKTLSFELLPGQSHLVSHYDGLSDMTIDRQG
FT                   NSLNIEFDSSRYQSADIIKQTLSDFEIRDLKMVDTDIEDIIRRFYRKEL"
FT   gene            601059..601877
FT                   /locus_tag="SP_0637"
FT   CDS             601059..601877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0637"
FT                   /product="membrane protein"
FT                   /note="identified by similarity to GP:7636000; match to
FT                   protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74787"
FT                   /protein_id="AAK74787.1"
FT                   /translation="MIKLWRRYKPFINAGVQELITYRVNFILYRIGDVMGAFVAFYLWK
FT                   AVFDSSQESLIQGFSMADITLYIIMSFVTNLLTRSDSSFMIGEEVKDGSIIMRLLRPVH
FT                   FAASYLFTELGSKWLIFISVGLPFLSVIVLMKIISGQGIVEVLGLTVIYLFSLTLAYLI
FT                   NFFFNICFGFSAFVFKNLWGSNLLKTSIVAFMSGSLIPLAFFPKVVSDILSFLPFSSLI
FT                   YTPVMIIVGKYDASQILQALLLQFFWLLVMVGLSQLIWKRVQSFITIQGG"
FT   gene            601879..602664
FT                   /locus_tag="SP_0638"
FT   CDS             601879..602664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0638"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:173491; match to
FT                   protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74788"
FT                   /protein_id="AAK74788.1"
FT                   /translation="MKKYQRMHLIFIRQYIKQIMEYKVDFVVGVLGVFLTQGLNLLFLN
FT                   VIFQHIPFLEGWTFQEIAFIYGFSLIPKGMDHLFFDNLWALGQRLVRKGEFDKYLTRPI
FT                   NPLFHILVETFQIDALGELLVGGILLGTTVTSIVWTLPKFLLFLVCIPFATLIYTSLKI
FT                   ATASIAFWTKQSGAMIYIFYMFNDFAKYPISIYNSLLRWLISFIVPFAFTAYYPASYFL
FT                   QEKDVFFNVGGLMLISLVFFVISLKLWDKGLDSYESAGS"
FT   gene            602700..602981
FT                   /locus_tag="SP_0639"
FT   CDS             602700..602981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0639"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74789"
FT                   /protein_id="AAK74789.1"
FT                   /translation="MMFVIEEVKDENQKKAVVAEVLKDLPEWFGIPESTQAYIEGTTTL
FT                   QVWTAYQESDLTRFVSLSYSSEDCAEIDCLGVKKLIKVEKLGANCLLL"
FT   gene            602918..603163
FT                   /locus_tag="SP_0640"
FT   CDS             602918..603163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0640"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74790"
FT                   /protein_id="AAK74790.1"
FT                   /translation="MSRRKKAYQGRKIGSQLLATLESEARKKVGYLQVKTVAEGSNKDY
FT                   DRTNDFYRGLGFKKLEIFPQLWNPQNPCQILIKKLE"
FT   gene            603895..610317
FT                   /locus_tag="SP_0641"
FT   CDS             603895..610317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0641"
FT                   /product="serine protease, subtilase family"
FT                   /note="identified by match to protein family HMM PF00082;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF02225; match to protein family HMM PF06280;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74791"
FT                   /protein_id="AAK74791.1"
FT                   /translation="MKKSTVLSLTTAAVILAAYAPNEVVLADTSSSEDALNISDKEKVA
FT                   ENKEKHENIHSAMETSQDFKEKKTAVIKEKEVVSKNPVIDNNTSNEEAKIKEENSNKSQ
FT                   GDYTDSFVNKNTENPKKEDKVVYIAEFKDKESGEKAIKELSSLKNTKVLYTYDRIFNGS
FT                   AIETTPDNLDKIKQIEGISSVERAQKVQPMMNHARKEIGVEEAIDYLKSINAPFGKNFD
FT                   GRGMVISNIDTGTDYRHKAMRIDDDAKASMRFKKEDLKGTDKNYWLSDKIPHAFNYYNG
FT                   GKITVEKYDDGRDYFDPHGMHIAGILAGNDTEQDIKNFNGIDGIAPNAQIFSYKMYSDA
FT                   GSGFAGDETMFHAIEDSIKHNVDVVSVSSGFTGTGLVGEKYWQAIRALRKAGIPMVVAT
FT                   GNYATSASSSSWDLVANNHLKMTDTGNVTRTAAHEDAIAVASAKNQTVEFDKVNIGGES
FT                   FKYRNIGAFFDKSKITTNEDGTKAPSKLKFVYIGKGQDQDLIGLDLRGKIAVMDRIYTK
FT                   DLKNAFKKAMDKGARAIMVVNTVNYYNRDNWTELPAMGYEADEGTKSQVFSISGDDGVK
FT                   LWNMINPDKKTEVKRNNKEDFKDKLEQYYPIDMESFNSNKPNVGDEKEIDFKFAPDTDK
FT                   ELYKEDIIVPAGSTSWGPRIDLLLKPDVSAPGKNIKSTLNVINGKSTYGYMSGTSMATP
FT                   IVAASTVLIRPKLKEMLERPVLKNLKGDDKIDLTSLTKIALQNTARPMMDATSWKEKSQ
FT                   YFASPRQQGAGLINVANALRNEVVATFKNTDSKGLVNSYGSISLKEIKGDKKYFTIKLH
FT                   NTSNRPLTFKVSASAITTDSLTDRLKLDETYKDEKSPDGKQIVPEIHPEKVKGANITFE
FT                   HDTFTIGANSSFDLNAVINVGEAKNKNKFVESFIHFESVEEMEALNSNGKKINFQPSLS
FT                   MPLMGFAGNWNHEPILDKWAWEEGSRSKTLGGYDDDGKPKIPGTLNKGIGGEHGIDKFN
FT                   PAGVIQNRKDKNTTSLDQNPELFAFNNEGINAPSSSGSKIANIYPLDSNGNPQDAQLER
FT                   GLTPSPLVLRSAEEGLISIVNTNKEGENQRDLKVISREHFIRGILNSKSNDAKGIKSSK
FT                   LKVWGDLKWDGLIYNPRGREENAPESKDNQDPATKIRGQFEPIAEGQYFYKFKYRLTKD
FT                   YPWQVSYIPVKIDNTAPKIVSVDFSNPEKIKLITKDTYHKVKDQYKNETLFARDQKEHP
FT                   EKFDEIANEVWYAGAALVNEDGEVEKNLEVTYAGEGQGRNRKLDKDGNTIYEIKGAGDL
FT                   RGKIIEVIALDGSSNFTKIHRIKFANQADEKGMISYYLVDPDQDSSKYQKLGEIAESKF
FT                   KNLGNGKEGSLKKDTTGVEHHHQENEESIKEKSSFTIDRNISTIRDFENKDLKKLIKKK
FT                   FREVDDFTSETGKRMEEYDYKYDDKGNIIAYDDGTDLEYETEKLDEIKSKIYGVLSPSK
FT                   DGHFEILGKISNVSKNAKVYYGNNYKSIEIKATKYDFHSKTMTFDLYANINDIVDGLAF
FT                   AGDMRLFVKDNDQKKAEIKIRMPEKIKETKSEYPYVSSYGNVIELGEGDLSKNKPDNLT
FT                   KMESGKIYSDSEKQQYLLKDNIILRKGYALKVTTYNPGKTDMLEGNGVYSKEDIAKIQK
FT                   ANPNLRALSETTIYADSRNVEDGRSTQSVLMSALDGFNIIRYQVFTFKMNDKGEAIDKD
FT                   GNLVTDSSKLVLFGKDDKEYTGEDKFNVEAIKEDGSMLFIDTKPVNLSMDKNYFNPSKS
FT                   NKIYVRNPEFYLRGKISDKGGFNWELRVNESVVDNYLIYGDLHIDNTRDFNIKLNVKDG
FT                   DIMDWGMKDYKANGFPDKVTDMDGNVYLQTGYSDLNAKAVGVHYQFLYDNVKPEVNIDP
FT                   KGNTSIEYADGKSVVFNINDKRNNGFDGEIQEQHIYINGKEYTSFNDIKQIIDKTLNIK
FT                   IVVKDFARNTTVKEFILNKDTGEVSELKPHRVTVTIQNGKEMSSTIVSEEDFILPVYKG
FT                   ELEKGYQFDGWEISGFEGKKDAGYVINLSKDTFIKPVFKKIEEKKEEENKPTFDVSKKK
FT                   DNPQVNHSQLNESHRKEDLQREEHSQKSDSTKDVTATVLDKNNISSKSTTNNPNKLPKT
FT                   GTASGAQTLLAAGIMFIVGIFLGLKKKNQD"
FT   gene            complement(610613..610947)
FT                   /pseudo
FT                   /locus_tag="SP_0642"
FT                   /note="IS1167, transposase, truncation; this gene contains
FT                   a frame shift which is not the result of sequencing error;
FT                   identified by similarity to GP:2804700"
FT   gene            complement(611051..611197)
FT                   /locus_tag="SP_0643"
FT   CDS             complement(611051..611197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0643"
FT                   /product="transposase family protein, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75783"
FT                   /protein_id="ABC75783.1"
FT                   /translation="MDNAIWHKSSTLKIPTNIGFAFIPPYTPEMNPIEQVWKEIRKRGF
FT                   IVK"
FT   gene            611267..612350
FT                   /pseudo
FT                   /locus_tag="SP_0644"
FT                   /note="This gene has an N-terminal truncation, and is
FT                   interrupted by an RUP element. IRleft = deleted. IRright =
FT                   GTAACCGCCCAATAACGAAG.; IS66 family element, Orf3,
FT                   degenerate; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GP:6009427"
FT   gene            612684..613181
FT                   /locus_tag="SP_0645"
FT   CDS             612684..613181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0645"
FT                   /product="putative PTS system IIA component"
FT                   /note="identified by similarity to EGAD:10467; match to
FT                   protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74792"
FT                   /protein_id="AAK74792.1"
FT                   /translation="MERREKLMVLDYFFDKNLVFCLEADSQEQLFDQVATLLEEREIVT
FT                   PTYREALITREKSFPTGLDMEFLGKDLPNVAIPHTDIVHNLAEKVVVVRLEKPITFHNM
FT                   IAPDKEVEVSLLFFIINNSSSSQTNILAQLMDFFTGNGHLEDLSKISEPEALYTYIAEA
FT                   TA"
FT   gene            613219..613524
FT                   /locus_tag="SP_0646"
FT   CDS             613219..613524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0646"
FT                   /product="putative PTS system, IIB component"
FT                   /note="identified by similarity to EGAD:7759"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74793"
FT                   /protein_id="AAK74793.1"
FT                   /translation="MIKILAACGAGVNSSHQIKSALEEELSNRGYDVHCDAVMVKDVNE
FT                   DLMKGYDIFTPIAATDLGFEPGIPVIEAGPILFRIPAMSAPVFDNIEAAIKEHGLS"
FT   gene            613572..615047
FT                   /locus_tag="SP_0647"
FT   CDS             613572..615047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0647"
FT                   /product="putative PTS system, IIC component"
FT                   /note="identified by similarity to EGAD:91348; match to
FT                   protein family HMM PF03611"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74794"
FT                   /protein_id="AAK74794.1"
FT                   /translation="MDAIFDLIGKVFNPILEMGGPVIMLIILTVLALLFGVKFSKALEG
FT                   GIKLAIALTGIGAIIGMLNTAFSASLAKFVENTGIQLSITDVGWAPLATITWGSAWTLY
FT                   FLLIMLIVNIVMLAMKKTDTLDVDIFDIWHLSITGLLIKWYADNNGVSQGVSLFIATAA
FT                   IVLVGVLKIINSDLMKPTFDDLLNAPSSSPMTSTHMNYMMNPVIMVLDKIFEKFFPGLD
FT                   KYDFDAAKLNKKIGFWGSKFFIGFILGIVIGIMGTPHPIAGVADADKWRLVIKGWLSLG
FT                   LTAGVSLELFSLIGSWFIAAVEPLSQGITNVATKRLQGRKFNIGLDWPFIAGRAEIWAC
FT                   ANVLAPIMLIEAVLLSKVGNGILPLAGIIAMGVTPALLVVTRGKLLRMIIFGTLLLPLF
FT                   LLSGTLIAPFATELAKGVGAFPEGVSQTQLITHSTLEGPIEKLLGWTIGNTTTGDIKAI
FT                   LGAVVFLVFYIGIFAWYRKQMIKRNEEYAAKAK"
FT   gene            615442..622143
FT                   /gene="bgaA"
FT                   /locus_tag="SP_0648"
FT   CDS             615442..622143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bgaA"
FT                   /locus_tag="SP_0648"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="identified by similarity to GP:9664865; match to
FT                   protein family HMM PF00703; match to protein family HMM
FT                   PF00746; match to protein family HMM PF02836; match to
FT                   protein family HMM PF02837; match to protein family HMM
FT                   PF04650; match to protein family HMM PF07501; match to
FT                   protein family HMM PF07532; match to protein family HMM
FT                   TIGR01167; match to protein family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74795"
FT                   /protein_id="AAK74795.1"
FT                   /translation="MGKGHWNRKRVYSIRKFAVGACSVMIGTCAVLLGGNIAGESVVYA
FT                   DETLITHTAEKPKEEKMIVEEKADKALETKNIVERTEQSEPSSTEAIASEKKEDEAVTP
FT                   KEEKVSAKPEEKAPRIESQASNQEKPLKEDAKAVTNEEVNQMIEDRKVDFNQNWYFKLN
FT                   ANSKEAIKPDADVSTWKKLDLPYDWSIFNDFDHESPAQNEGGQLNGGEAWYRKTFKLDE
FT                   KDLKKNVRLTFDGVYMDSQVYVNGQLVGHYPNGYNQFSYDITKYLQKDGRENVIAVHAV
FT                   NKQPSSRWYSGSGIYRDVTLQVTDKVHVEKNGTTILTPKLEEQQHGKVETHVTSKIVNT
FT                   DDKDHELVAEYQIVERGGHAVTGLVRTASRTLKAHESTSLDAILEVERPKLWTVLNDKP
FT                   ALYELITRVYRDGQLVDAKKDLFGYRYYHWTPNEGFSLNGERIKFHGVSLHHDHGALGA
FT                   EENYKAEYRRLKQMKEMGVNSIRTTHNPASEQTLQIAAELGLLVQEEAFDTWYGGKKPY
FT                   DYGRFFEKDATHPEARKGEKWSDFDLRTMVERGKNNPAIFMWSIGNEIGEANGDAHSLA
FT                   TVKRLVKVIKDVDKTRYVTMGADKFRFGNGSGGHEKIADELDAVGFNYSEDNYKALRAK
FT                   HPKWLIYGSETSSATRTRGSYYRPERELKHSNGPERNYEQSDYGNDRVGWGKTATASWT
FT                   FDRDNAGYAGQFIWTGTDYIGEPTPWHNQNQTPVKSSYFGIVDTAGIPKHDFYLYQSQW
FT                   VSVKKKPMVHLLPHWNWENKELASKVADSEGKIPVRAYSNASSVELFLNGKSLGLKTFN
FT                   KKQTSDGRTYQEGANANELYLEWKVAYQPGTLEAIARDESGKEIARDKITTAGKPAAVR
FT                   LIKEDHAIAADGKDLTYIYYEIVDSQGNVVPTANNLVRFQLHGQGQLVGVDNGEQASRE
FT                   RYKAQADGSWIRKAFNGKGVAIVKSTEQAGKFTLTAHSDLLKSNQVTVFTGKKEGQEKT
FT                   VLGTEVPKVQTIIGEAPEMPTTVPFVYSDGSRAERPVTWSSVDVSKPGIVTVKGMADGR
FT                   EVEARVEVIALKSELPVVKRIAPNTDLNSVDKSVSYVLIDGSVEEYEVDKWEIAEEDKA
FT                   KLAIPGSRIQATGYLEGQPIHATLVVEEGNPAAPAVPTVTVGGEAVTGLTSQKPMQYRT
FT                   LAYGAKLPEVTASAKNAAVTVLQASAANGMRASIFIQPKDGGPLQTYAIQFLEEAPKIA
FT                   HLSLQVEKADSLKEDQTVKLSVRAHYQDGTQAVLPADKVTFSTSGEGEVAIRKGMLELH
FT                   KPGAVTLNAEYEGAKDQVELTIQANTEKKIAQSIRPVNVVTDLHQEPSLPATVTVEYDK
FT                   GFPKTHKVTWQAIPKEKLDSYQTFEVLGKVEGIDLEARAKVSVEGIVSVEEVSVTTPIA
FT                   EAPQLPESVRTYDSNGHVSSAKVAWDAIRPEQYAKEGVFTVNGRLEGTQLTTKLHVRVS
FT                   AQTEQGANISDQWTGSELPLAFASDSNPSDPVSNVNDKLISYNNQPANRWTNWNRTNPE
FT                   ASVGVLFGDSGILSKRSVDNLSVGFHEDHGVGVPKSYVIEYYVGKTVPTAPKNPSFVGN
FT                   EDHVFNDSANWKPVTNLKAPAQLKAGEMNHFSFDKVETYAVRIRMVKADNKRGTSITEV
FT                   QIFAKQVAAAKQGQTRIQVDGKDLANFNPDLTDYYLESVDGKVPAVTASVSNNGLATVV
FT                   PSVREGEPVRVIAKAENGDILGEYRLHFTKDKSLLSHKPVAAVKQARLLQVGQALELPT
FT                   KVPVYFTGKDGYETKDLTVEWEEVPAENLTKAGQFTVRGRVLGSNLVAEITVRVTDKLG
FT                   ETLSDNPNYDENSNQAFASATNDIDKNSHDRVDYLNDGDHSENRRWTNWSPTPSSNPEV
FT                   SAGVIFRENGKIVERTVTQGKVQFFADSGTDAPSKLVLERYVGPEFEVPTYYSNYQAYD
FT                   ADHPFNNPENWEAVPYRADKDIAAGDEINVTFKAIKAKAMRWRMERKADKSGVAMIEMT
FT                   FLAPSELPQESTQSKILVDGKELADFAENRQDYQITYKGQRPKVSVEENNQVASTVVDS
FT                   GEDSFPVLVRLVSESGKQVKEYRIHLTKEKPVSEKTVAAVQEDLPKIEFVEKDLAYKTV
FT                   EKKDSTLYLGETRVEQEGKVGKERIFTAINPDGSKEEKLREVVEVPTDRIVLVGTKPVA
FT                   QEAKKPQVSEKADTKPIDSSEASQTNKAQLPSTGSAASQAAVAAGLTLLGLSAGLVVTK
FT                   GKKED"
FT   gene            complement(622391..623247)
FT                   /pseudo
FT                   /locus_tag="SP_0649"
FT                   /note="conserved hypothetical protein, degenerate; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:8918792"
FT   gene            complement(623457..623777)
FT                   /locus_tag="SP_0650"
FT   CDS             complement(623457..623777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0650"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74796"
FT                   /protein_id="AAK74796.1"
FT                   /translation="MILTLVVCIILTKLFRLKKLGRNFADLAFPVLVFEYYLITAKTFT
FT                   HNFLPRLGLALSILAIILVFFFLLKKRSFYYPKFIKFFWRAGFLLTLIMYIEMIVELFL
FT                   MK"
FT   gene            623839..624864
FT                   /pseudo
FT                   /locus_tag="SP_0651"
FT                   /note="conserved hypothetical protein, authentic point
FT                   mutation; this gene contains a frame shift which is not the
FT                   result of sequencing error; identified by similarity to
FT                   EGAD:108408"
FT   gene            624848..625405
FT                   /locus_tag="SP_0652"
FT   CDS             624848..625405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0652"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:176766; match to
FT                   protein family HMM PF06962"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74797"
FT                   /protein_id="AAK74797.1"
FT                   /translation="MKRPLEMAHDFLAEVVTKEDVVVDATMGNGHDTLFLAKLAKQVYA
FT                   FDIQKQALEKTQERLHQADLTNAQLILQGHETLDQFVIKAKAGIFNLGYLPAADKSVIT
FT                   RPQTTIEALEKLCGLLVKGGRIAIMIYYGHEGGDLERDAVLDFVIQLNQQEYTAAIYRT
FT                   LNQVNNPPFLVMIEKLERYRHG"
FT   gene            625398..625652
FT                   /locus_tag="SP_0653"
FT   CDS             625398..625652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0653"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74798"
FT                   /protein_id="AAK74798.1"
FT                   /translation="MDKQYLHEKLDAMRQNFVESTHHERAMGVLDQAHMSKKMLKIKKK
FT                   LVALEMERCQRKIEHKDCSKIDQKIKEQKEIFESCCKKD"
FT   gene            625627..625728
FT                   /locus_tag="SP_0654"
FT   CDS             625627..625728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0654"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74799"
FT                   /protein_id="AAK74799.1"
FT                   /translation="MNPVVKKIKEDVRGITDLPHPIFTGFDCLKYNQ"
FT   gene            625664..627718
FT                   /locus_tag="SP_0655"
FT                   /note="SP06565"
FT   CDS             625664..627718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0655"
FT                   /product="transporter, monovalent cation:proton
FT                   antiporter-2 (CPA2) family"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74800"
FT                   /protein_id="AAK74800.2"
FT                   /translation="MELLIYLILFLLVLIVSSTTNKLLPFLPLPLVQILLGIVIGLFLP
FT                   NTDFHLNTELFLALVIGPLLFREAEEADVTAILKHWRIIVYLIFPVIFISTLSLGGLAH
FT                   LLWFSLPLAACLAVGAALGPTDLVAFASLSERFSFPKRVSNILKGEGLLNDASGLVAFQ
FT                   VALTAWTTGAFSLGQASSSLIFSILGGFLIGFLTAMTNRFLHTFLLSVRATDIASELLL
FT                   ELSLPLVTFFLAEEVHVSGIIAVVVAGILKASRFKKITLLEAQVDTVTETVWHTVTFML
FT                   NGSVFVILGMELEMIAEPILTNPIYNPLLLLLSLIALTFVLFVIRFIMIYGYYAYRTRR
FT                   LKKKLNKYMKDMFLLTFSGVKGTVSIATILLIPSNLEQEYPLLLFLVAGVTLVSFLTGL
FT                   LVLPHLSDEEEESKDYLMHIAILNEVTLELEKELEDTRNKLPLYAAIDNYHGRIENLIL
FT                   SQENQDDQEDWAALKLLILSIESDGLEQAYEEGNISNRAYRVYQRYLKNIEQGINRKLA
FT                   SRLTYYFLVSLRILRFLLHEVFTLGKTFRSWKNKEQSRLRALDYDQIAELYLANTEMII
FT                   ESLENLKGVYRRSLISFMQESRLRETAIISSGAFVERVINRVKPNNIDEMLRGYYLERK
FT                   LIFEYEEKRLITTKYAKKLRQNVNNLENYSLKEAANTLPYDMVELVRRN"
FT   gene            627897..628757
FT                   /locus_tag="SP_0657"
FT   CDS             627897..628757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0657"
FT                   /product="putative ribonuclease BN"
FT                   /note="identified by similarity to OMNI:NT03PA3143; match
FT                   to protein family HMM PF03631"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74802"
FT                   /protein_id="AAK74802.1"
FT                   /translation="MKKWWKELIDKPLLKAFLHYYQASDSELTSVAVAYYWLISIFPLL
FT                   LVVVNILPYFQIPVGEFLGFMKDVLPPSLYEGVEKIAREVLTQPSTGLLSFSVLSALWS
FT                   FSKSMNFLQKAFNKAYGVEKSRGLISHQMLSLLVSFGLQLLFAFALFLILFGQMILALL
FT                   AHYWTKDGIIYQALQGLAGPLIYALLFAILVMLYYFLPNLSNRKISYTLPGSAFVLLVI
FT                   LGLLTLFSSYLNYYVHHLVDVRILGSVLLVVMMFWFILIAKIVILGAVINASMQSLKDP
FT                   VFKKD"
FT   gene            628968..629678
FT                   /gene="ccdA-1"
FT                   /locus_tag="SP_0658"
FT   CDS             628968..629678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA-1"
FT                   /locus_tag="SP_0658"
FT                   /product="cytochrome c-type biogenesis protein CcdA"
FT                   /note="identified by similarity to GP:6714962; match to
FT                   protein family HMM PF02683"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74803"
FT                   /protein_id="AAK74803.1"
FT                   /translation="MGHIFFFLSVFLAGILSFFSPCILPLLPVYTGVLLDDKDGAQASS
FT                   GKFSISVTSLLRTLAFIAGISFIFILLGYGAGFLGDLLYASWFQYLTGAIIILLGLHQM
FT                   EILHFKGLYKEKRLQLQGQGQNGKGYSQAFLLGLTFSFAWTPCVGPVLGSVLALAASGG
FT                   SGAWQGAGLMLVYTLGLALPFLLLALTSSYVLKHFRKLHPYLGILKKVGGFLIIVMGFL
FT                   VLFGNASILSQLFE"
FT   gene            629698..630264
FT                   /locus_tag="SP_0659"
FT   CDS             629698..630264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0659"
FT                   /product="thioredoxin family protein"
FT                   /note="identified by similarity to EGAD:28452"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74804"
FT                   /protein_id="AAK74804.1"
FT                   /translation="MKKWQTCVLGAGSLLCLTACSGKSVTSEHQTKDEMKTEQTASKTS
FT                   AAKGKEVADFELMGVDGKTYRLSDYKGKKVYLKFWASWCSICLASLPDTDEIAKEAGDD
FT                   YVVLTVVSPGHKGEQSEADFKNWYKGLDYKNLPVLVDPSGKLLETYGVRSYPTQAFIDK
FT                   EGKLVKTHPGFMEKDAILQTLKELA"
FT   gene            630452..631387
FT                   /gene="msrA-1"
FT                   /locus_tag="SP_0660"
FT   CDS             630452..631387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA-1"
FT                   /locus_tag="SP_0660"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="identified by similarity to SP:P35593; match to
FT                   protein family HMM PF01625; match to protein family HMM
FT                   PF01641; match to protein family HMM TIGR00357; match to
FT                   protein family HMM TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74805"
FT                   /db_xref="GOA:P65443"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65443"
FT                   /protein_id="AAK74805.1"
FT                   /translation="MHEIYLAGGCFWGVEEYFSRVPGVTDAVSGYANGRGETTKYELIN
FT                   QTGHAETVHVTYDAKQISLKEILLHYFRIINPTSKNKQGNDVGTQYRTGVYYTDDKDLE
FT                   VINQVFDEVAKKYDQPLAVEKENLKNFVVAEDYHQDYLKKNPNGYCHINVNQAAYPVID
FT                   ASKYPKPSDEELKKTLSPEEYAVTQENQTERAFSNRYWDKFESGIYVDIATGEPLFSSK
FT                   DKFESGCGWPSFTQPISPDVVTYKEDKSYNMTRMEVRSRVGDSHLGHVFTDGPQDKGGL
FT                   RYCINSLSIRFIPKDQMEEKGYAYLLDYVD"
FT   gene            631655..632392
FT                   /locus_tag="SP_0661"
FT   CDS             631655..632392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0661"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74806"
FT                   /protein_id="AAK74806.1"
FT                   /translation="MTYTILIVEDEYLVRQGLTKLVNVAAYDMEIIGQAENGRQAWELI
FT                   QKQVPDIILTDINMPHLNGIQLASLVRETYPQVHLVFLTGYDDFDYALSAVKLGVDDYL
FT                   LKPFSRQDIEEMLGKIKQKLDKEEKEEQLQDLLTNRFEGNMAQKIQSHLADSQFSLKSL
FT                   ASDLGFSPTYLSSLIKKELGLPFQDYLVRERVKQAKLLLLTTDLKIYEIAEKVGFEDMN
FT                   YFTQRFKQIAGVTPRQFKKGEDR"
FT   gene            632389..634080
FT                   /locus_tag="SP_0662"
FT   CDS             632389..634080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0662"
FT                   /product="putative sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00672;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF02743; match to protein family HMM PF06580"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74807"
FT                   /protein_id="AAK74807.1"
FT                   /translation="MKRSSLLVRMVISIFLVFLILLALVGTFYYQSSSSAIEATIEGNS
FT                   QTTISQTSHFIQSYIKKLETTSTGLTQQTDVLAYAENPSQDKVEGIRDLFLTILKSDKD
FT                   LKTVVLVTKSGQVISTDDSVQMKTSSDMMAEDWYQKAIHQGAMPVLTPARKSDSQWVIS
FT                   VTQELVDAKGANLGVLRLDISYETLEAYLNQLQLGQQGFAFIINENHEFVYHPQHTVYS
FT                   SSSKMEAMKPYIDTGQGYTPGHKSYVSQEKIAGTDWTVLGVSSLEKLDQVRSQLLWTLL
FT                   GASVTSLLVCLCLVWFSLKRWIAPLKDLRETMLEIASGAQNLRAKEVGAYELREVTRQF
FT                   NAMLDQIDQLMVAIRSQEETTRQYQLQALSSQINPHFLYNTLDTIIWMAEFHDSQRVVQ
FT                   VTKSLATYFRLALNQGKDLICLSDEINHVRQYLFIQKQRYGDKLEYEINENVAFDNLVL
FT                   PKLVLQPLVENALYHGIKEKEGQGHIKLSVQKQDSGLVIRIEDDGVGFQDAGDSSQSQL
FT                   KRGGVGLQNVDQRLKLHFGANYHMKIDSRPQKGTKVEIYINRIETS"
FT   gene            634196..634759
FT                   /locus_tag="SP_0663"
FT   CDS             634196..634759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0663"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:30371; match to
FT                   protein family HMM PF04260; match to protein family HMM
FT                   TIGR01440"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74808"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RX2"
FT                   /protein_id="AAK74808.1"
FT                   /translation="MNETQIQRETRQVVEDVLEKTNLKQGALFVLGLSSSEVLGGHIGK
FT                   ESSQEIGELIVETILDILGSRGIHLAVQGCEHVNRALVVERQVAEQFGLEIVSVHPTLH
FT                   AGGSGQLAAFKFMQDPVEVEFIKAHAGLDIGDTAIGMHVKHVQVPIRPILREIGHAHVT
FT                   ALASRPKLIGGARAHYPQDAIRKF"
FT   gene            634856..640501
FT                   /gene="zmpB"
FT                   /locus_tag="SP_0664"
FT   CDS             634856..640501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zmpB"
FT                   /locus_tag="SP_0664"
FT                   /product="zinc metalloprotease ZmpB"
FT                   /note="identified by similarity to GP:6911257; match to
FT                   protein family HMM PF00746; match to protein family HMM
FT                   PF05342; match to protein family HMM PF07554; match to
FT                   protein family HMM PF07580; match to protein family HMM
FT                   PF07581; match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74809"
FT                   /db_xref="GOA:Q9L7Q2"
FT                   /db_xref="InterPro:IPR008006"
FT                   /db_xref="InterPro:IPR011505"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9L7Q2"
FT                   /protein_id="AAK74809.1"
FT                   /translation="MAPSVVDAATYHYVNKEIISQEAKDLIQTGKPDRNEVVYGLVYQK
FT                   DQLPQTGTEASVLTAFGLLTVGSLLLIYKRKKIASVFLVGAMGLVVLPSAGAVDPVATL
FT                   ALASREGVVEMEGYRYVGYLSGDILKTLGLDTVLEETSAKPGEVTVVEVETPQSITNQE
FT                   QARTENQVVETEEAPKEEAPKTEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPAPVEE
FT                   VGGEVESKPEEKVAVKPESQPSDKPAEESKVEQAGEPVAPREDEKAPVEPEKQPEAPEE
FT                   EKAVEETPKQEESTPDTKAEETVEPKEETVNQSIEQPKVETPAVEKQTEPTEEPKVEQA
FT                   GEPVAPREDEQAPTAPVEPEKQPEVPEEEKAVEETPKPEDKIKGIGTKEPVDKSELNNQ
FT                   IDKASSVSPTDYSTASYNALGPVLETAKGVYASEPVKQPEVNSETNKLKTAIDALNVDK
FT                   TELNNTIADAKTKVKEHYSDRSWQNLQTEVTKAEKVAANTDAKQSEVNEAVEKLTATIE
FT                   KLVELSEKPILTLTSTDKKILEREAVAKYTLENQNKTKIKSITAELKKGEEVINTVVLT
FT                   DDKVTTETISAAFKNLEYYKEYTLSTTMIYDRGNGEETETLENQNIQLDLKKVELKNIK
FT                   RTDLIKYENGKETNESLITTIPDDKSNYYLKITSNNQKTTLLAVKNIEETTVNGTPVYK
FT                   VTAIADNLVSRTADNKFEEEYVHYIEKPKVHEDNVYYNFKELVEAIQNDPSKEYRLGQS
FT                   MSARNVVPNGKSYITKEFTGKLLSSEGKQFAITELEHPLFNVITNATINNVNFENVEIE
FT                   RSGQDNIASLANTMKGSSVITNVKITGTLSGRNNVAGFVNNMNDGTRIENVAFFGKLHS
FT                   TSGNGSHTGGIAGTNYRGIVRKAYVDATITGNKTRASLLVPKVDYGLTLDHLIGTKALL
FT                   TESVVKGKIDVSNPVEVGAIASKTWPVGTVSNSVSYAKIIRGEELFGSNDVDDSDYASA
FT                   HIKDLYAVEGYSSGNRSFRKSKTFTKLTKEQADAKVTTFNITADKLESDLSPLAKLNEE
FT                   KAYSSIQDYNAEYNQAYKNLEKLIPFYNKDYIVYQGNKLNKEHHLNTKEVLSVTAMNNN
FT                   EFITNLDEANKIIVHYADGTKDYFNLSSSSEGLSNVKEYTITDLGIKYTPNIVQKDNTT
FT                   LVNDIKSILESVELQSQTMYQHLNRLGDYRVNAIKDLYLEESFTDVKENLTNLITKLVQ
FT                   NEEHQLNDSPAARQMIRDKVEKNKAALLLGLTYLNRYYGVKFGDVNIKELMLFKPDFYG
FT                   EKVSVLDRLIEIGSKENNIKGSRTFDAFGQVLAKYTKSGNLDAFLNYNRQLFTNIDNMN
FT                   DWFIDATEDHVYIAERASEVEEIKNSKHRAFDNLKRSHLRNTILPLLNIDKAHLYLISN
FT                   YNAIAFGSAERLGKKSLEDIKDIVNKAADGYRNYYDFWYRLASDNVKQRLLRDAVIPIW
FT                   EGYNAPGGWVEKYGRYNTDKVYTPLREFFGPMDKYYNYNGTGAYAAIYPNSDDIRTDVK
FT                   YVHLEMVGEYGISVYTHETTHVNDRAIYLGGFGHREGTDAEAYAQGMLQTPVTGSGFDE
FT                   FGSLGINMVFKRKNDGNQWYITDPKTLKTREDINRYMKGYNDTLTLLDEIEAESVISQQ
FT                   NKDLNSAWFKKIDREYRDNNKLNQWDKIRNLSQEEKNELNIQSVNDLVDQQLMTNRNPG
FT                   NGIYKPEAISYNDQSPYVGVRMMTGIYGGNTSKGAPGAVSFKHNAFRLWGYYGYENGFL
FT                   GYASNKYKQQSKTDGESVLSDEYIIKKISNNTFNTIEEFKKAYFKEVKDKATKGLTTFE
FT                   VNGSSVSSYDDLLTLFKEAVKKDAETLKQEANGNKTVSMNNTVKLKEAVYKKLLQQTNS
FT                   FKTSIFK"
FT   gene            640562..642283
FT                   /locus_tag="SP_0665"
FT   CDS             640562..642283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0665"
FT                   /product="chorismate binding enzyme"
FT                   /note="identified by match to protein family HMM PF00425;
FT                   match to protein family HMM TIGR00553"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74810"
FT                   /protein_id="AAK74810.1"
FT                   /translation="MHRKTVIDFRTLGERYTFTQPIKELKTRNVEEVADLLAQVESYQE
FT                   QGYYVVGYVSYEAAPAFEEKLAVHKDPLLGEYLLYFTVHDIVETSPIPLTYEDIDLPSN
FT                   WQEVTSAADYEKAIAQIHHHLRQGDTYQVNYTVQLKQKLNANPFAIYNRMVVEQEAGYN
FT                   AYVEHDEMTVISMSPELFFEQNDRELTTRPMKGTTQRGVTDQEDLEQASWLEQDPKNRS
FT                   ENMMIVDLLRNDMNRISEVGSEHVERLCQVEQYSTVWQMTSTIKSQLREDVDLVEIFRS
FT                   LFPCGSITGAPKIATMEIIKDLEPQPRGVYCGTIGLLLPNGRRIFNVAIRTIQLHKGQA
FT                   IYGVGGGITWDSTWESEYREVHQKAAVLYRKQARFQLITTGKISQKQLMFEEQHLERLR
FT                   KASRYFAFPFDAEDLGHKIEEECQDCEANRDYRLRISLSKSGEIEVNRQVLTPLSTSFC
FT                   QAQVCLQEAALNQSFTYFKTTHRPHLSLGEQEKIYHNKSGELLETSIGNLVLKIAGKLY
FT                   TPPIRLGILPGIYRQHLLETGQVEEKVLTLADLTQAEAIYGCNAVRGLYELSLEEN"
FT   gene            642284..642901
FT                   /locus_tag="SP_0666"
FT   CDS             642284..642901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0666"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4704711"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74811"
FT                   /protein_id="AAK74811.1"
FT                   /translation="MKLIFLHGLGQSAESWKEVRNLLTDYPSEAIELFPSGVSNYQQAK
FT                   ERVYQHLAQETEPFVLIGLSLGAALTLELSSYDLPNLRALILSGCPLKLAGNILFYLQL
FT                   LIFKLLPKRVFEKQGADKTLMVGVSEELKTLDLTDIAGTYPYPTLLICGSKDKPNLSSM
FT                   KALHRLLTDSQFQIIPDGPHVLNKAKPKEFVEKTRSFLELLK"
FT   gene            642951..643949
FT                   /locus_tag="SP_0667"
FT   CDS             642951..643949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0667"
FT                   /product="putative pneumococcal surface protein"
FT                   /note="identified by match to protein family HMM PF01473;
FT                   match to protein family HMM PF05901; match to protein
FT                   family HMM PF07553"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74812"
FT                   /protein_id="AAK74812.1"
FT                   /translation="MNKRLFSKMSLVTLPILALFSQSVLAEENIHFSSCKEAWANGYSD
FT                   IHEGEPGYSAKLDRDHDGVACELKNAPKGAFKAKQSTAIQINTSSATTSGWVKQDGAWY
FT                   YFDGNGNLVKNAWQGSYYLKADGKMAQSEWIYDSSYQAWYYLKSDGSYAKNAWQGAYYL
FT                   KSNGKMAQGEWVYDSSYQAWYYLKSDGSYARNAWQGNYYLKSDGKMAKGEWVYDATYQA
FT                   WYYLTSDGSYAYSTWQGNYYLKSDGKMAVNEWVDGGRYYVGADGVWKEVQASTASSSND
FT                   SNSEYSAALGKAKSYNSLFHMSKKRMYRQLTSDFDKFSNDAAQYAIDHLDD"
FT   gene            644073..645035
FT                   /gene="gki"
FT                   /locus_tag="SP_0668"
FT   CDS             644073..645035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gki"
FT                   /locus_tag="SP_0668"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="identified by similarity to EGAD:130279; match to
FT                   protein family HMM PF00480; match to protein family HMM
FT                   TIGR00744"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74813"
FT                   /protein_id="AAK74813.2"
FT                   /translation="MMSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIV
FT                   DDMIESIQHRLDLLGLAAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIKQKIEK
FT                   ALGIPFFIDNDANVAALGERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAG
FT                   ELGHITVDFDQPISCTCGKKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEV
FT                   TAKTVFDLAKEGDDLALIVYRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQG
FT                   VQKVYDENSFPQVRTSTKLALATLGNDAGVIGAASLVLQ"
FT   gene            645132..645971
FT                   /gene="thyA"
FT                   /locus_tag="SP_0669"
FT   CDS             645132..645971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="SP_0669"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="identified by match to protein family HMM PF00303"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74814"
FT                   /db_xref="GOA:P67049"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67049"
FT                   /protein_id="AAK74814.1"
FT                   /translation="MTKADTIFKENIERILKEGVFSEQARPKYKDGTVANSKYVTGAFS
FT                   EYDLSKGEFPITTLRPIAIKSAIKEVLWIYQDQSNSLEVLNDKYNVHYWNDWEVGDTGT
FT                   IGERYGAVVKKHDIINKLLKQLETNPWNRRNIISLWDYQAFEETDGLLPCAFQTMFDVR
FT                   RVDGEIYLDATLTQRSNDMLVAHHINAMQYVALQMMIAKHFGWKVGKFFYFINNLHIYD
FT                   NQFEQAQELLRREPSNCQPRLVLNVPDGTNFFDIKAEDFELVDYDPVKPQLKFDLAI"
FT   gene            complement(646019..646189)
FT                   /locus_tag="SP_0670"
FT   CDS             complement(646019..646189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0670"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74815"
FT                   /protein_id="AAK74815.1"
FT                   /translation="MAKGFAKGLVTGVAGTVAAVAGAVYAFKKKVIEPEEQKAAFIEEN
FT                   RKKAARRRVSR"
FT   gene            646310..647194
FT                   /gene="miaA"
FT                   /locus_tag="SP_0671"
FT   CDS             646310..647194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="SP_0671"
FT                   /product="tRNA isopentenylpyrophosphate transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="identified by match to protein family HMM PF01715;
FT                   match to protein family HMM TIGR00174"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0671"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74816"
FT                   /db_xref="GOA:Q97RW5"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RW5"
FT                   /protein_id="AAK74816.1"
FT                   /translation="MKTKIIVIVGPTAVGKTALAIEVAKRFNGEVVSGDSQQVYRGLDI
FT                   GTAKASPEEQAAVPHHLIDVREITESYSAFDFVSEAKMTIEGIHNRGKLAIIAGGTGLY
FT                   IQSLLEGYHLGGETPHEEILAYRASLEPYSDEELAHLVDQAGLEIPQFNRRRAMRALEI
FT                   AHFGQDLENQETLYEPLIICLDDERSQLYERINHRVDLMFEAGLLDEAKWLFDHSPNVQ
FT                   AAKGIGYKELFPYFRGEQTLEEASESLKQATRRFAKRQLTWFRNRMQVTFYQIGESGVQ
FT                   DRILSQIEEFLDD"
FT   gene            647187..648425
FT                   /gene="hflX"
FT                   /locus_tag="SP_0672"
FT   CDS             647187..648425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="SP_0672"
FT                   /product="GTP-binding protein HflX"
FT                   /note="identified by similarity to EGAD:6528; match to
FT                   protein family HMM TIGR00231"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0672"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74817"
FT                   /protein_id="AAK74817.1"
FT                   /translation="MIETEKKEERVLLIGVELQGMDSFDLSMEELASLAKTAGAVVVDS
FT                   YRQKREKYDSKTFVGSGKLEEIALMVDAEEITTVIVNNRLTPRQNVNLEEVLGVKVIDR
FT                   MQLILDIFAMRARSHEGKLQVHLAQLKYLLPRLVGQGIMLSRQAGGIGSRGPGESQLEL
FT                   NRRSVRNQITDIERQLKVVEKNRATVREKRLESSTFKIGLIGYTNAGKSTIMNILTSKT
FT                   QYEADELFATLDATTKSIHLGGNLQVTLTDTVGFIQDLPTELVSSFKSTLEESKHVDLL
FT                   VHVIDASNPYHEEHEKTVLSIMKDLDMEDIPHLTLYNKADLVEDFTPTQTPYTLISAKS
FT                   EDSRENLQALLLDKIKEIFEAFTLRVPFSKSYKIHDLESVAILEERDYQEDGEVITGYI
FT                   SEKNKWRLEEFYD"
FT   gene            648418..649041
FT                   /locus_tag="SP_0673"
FT   CDS             648418..649041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0673"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74818"
FT                   /protein_id="AAK74818.1"
FT                   /translation="MTDIKTLALKYGGYTSLDKVYLDQLLAGKTDQEQLTLITPPPSVV
FT                   NAYFAELYQKKSPQAATDYFAELSQELNLYNTEPSFTLENKPFIRLNLSGKSFGFCYES
FT                   DGLGRIFFENEEKISDDLLFEIAQIFPHQLVFEESGKIYMKPVEDEEVISLESLTALTD
FT                   LERLADGRKRLKGYSQEDLLQEAAAFSGKRYFRSENRTAMLYID"
FT   gene            649056..649985
FT                   /locus_tag="SP_0674"
FT   CDS             649056..649985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0674"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM TIGR02651"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74819"
FT                   /db_xref="GOA:Q97RW2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RW2"
FT                   /protein_id="AAK74819.1"
FT                   /translation="MDIQFLGTGAGQPSKARNVSSLALKLLDEINEVWLFDCGEGTQNR
FT                   ILETTIRPRKVSKIFITHLHGDHIFGLPGFLSSRAFQANEEQTDLEIYGPQGIKSFVLT
FT                   SLRVSGSRLPYRIHFHEFDQDSLGKILETDKFTVYAEELDHTIFCVGYRVMQKDLEGTL
FT                   DAEKLKAAGVPFGPLFGKIKNGQDLVLEDGTEIKAADYISAPRPGKIITILGDTRKTGA
FT                   SVRLAVNADVLVHESTYGKGDEKIARNHGHSTNMQAAQVAVEAGAKRLLLNHISARFLS
FT                   KDISKLKKDAATIFENVHVVKDLEEVEI"
FT   gene            650006..650761
FT                   /locus_tag="SP_0675"
FT   CDS             650006..650761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0675"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0675"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74820"
FT                   /protein_id="AAK74820.1"
FT                   /translation="MPTILITGASGGLAQEMVKLLPNDQLILLGRNKEKLAQLYGNYSH
FT                   AELIEIDITDDSALEALVTDLYLRYGKIDVLINNAGYGIFEGFDQIADKDIHQMFEVNT
FT                   FALMNLSRHLAARMKESSKGHIINIVSMAGLIATGKSSLYSATKFAAIGFSNALRLELM
FT                   PYGVYVTTVNPGPIRTGFFDQADPDGTYLKSVDRFLLEPDAVAKKIVKIIGKNKRELNL
FT                   PILLNLAHKFYTLFPKLADKLAGETFNYK"
FT   gene            complement(650815..651783)
FT                   /locus_tag="SP_0676"
FT   CDS             complement(650815..651783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0676"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by similarity to EGAD:6257; match to
FT                   protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74821"
FT                   /protein_id="AAK74821.1"
FT                   /translation="MLLIFLSSLAILRQVWYNKNMRIQQLHYIIKIVETGSMNEAAKQL
FT                   FITQPSLSNAVRDLENEMGIEIFIRNPKGITLTRDGMEFLSYARQVVEQTQLLEERYKN
FT                   PVAHRELFSVSSQHYAFVVNAFVSLLKKSDMEKYELFLRETRTWEIIDDVKNFRSEVGV
FT                   LFLNSYNRDVLTKMLDDNHLLAHHLFTAQPHIFVSKTNPLAKKDKVKLSDLENFPYLSY
FT                   DQGTHNSFYFSEEILSQEHHKKSIVVSDRATLFNLLIGLDGYTIATGILNSNLNGDNIV
FT                   SIPLDIDDPIELVYIQHEKTSLSKMGERFIDYLLEEVQFDS"
FT   gene            651835..652056
FT                   /locus_tag="SP_0677"
FT   CDS             651835..652056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0677"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:137181; match to
FT                   protein family HMM PF06014"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0677"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74822"
FT                   /protein_id="AAK74822.1"
FT                   /translation="MKTFYDVQQFLKRFGIIVYMGKRLYDIELMKLELSRIYDAGLMDK
FT                   LDYLEAEAVLRREHKVELDYIEKNGEKN"
FT   gene            652056..652436
FT                   /locus_tag="SP_0678"
FT   CDS             652056..652436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0678"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:45852; match to
FT                   protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0678"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74823"
FT                   /protein_id="AAK74823.1"
FT                   /translation="MVTWILWALILAMLAWMGFNYLRIRRAAKIVDNEEFEALIRTGQL
FT                   IDLRDPAEFHRKHILGARNIPSSQLKTSLAALRKDKPVLLYENQRAQRVTNAALYLKKQ
FT                   GFSEIYILSYGLDSWKGKVKTS"
FT   gene            652555..652752
FT                   /locus_tag="SP_0679"
FT   CDS             652555..652752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0679"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0679"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74824"
FT                   /protein_id="AAK74824.1"
FT                   /translation="MGILSIILGLLFPIVGLILGIIGLVLAISYQKESQLDYKIEKILN
FT                   ILGIVISVVNWIVAIALIFR"
FT   gene            complement(652792..653517)
FT                   /gene="rsuA-2"
FT                   /locus_tag="SP_0680"
FT   CDS             complement(652792..653517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA-2"
FT                   /locus_tag="SP_0680"
FT                   /product="ribosomal small subunit pseudouridine synthase A"
FT                   /note="identified by similarity to EGAD:9371; match to
FT                   protein family HMM PF00849; match to protein family HMM
FT                   PF01479; match to protein family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74825"
FT                   /protein_id="AAK74825.1"
FT                   /translation="MRLDNLLAQEKISRKAMKQALLRGEILVDGCPARSLAQNIDTGLQ
FT                   ELLFQDRIIQGYEHTYLMLHKPAGAVTANKDKELPTVMDLLPSNIQSDKLYAVGRLDRD
FT                   TTGLLLLTDNGPLGFQLLHPQYHVDKTYQVEVNGLLTPDHIQTFQKGIVFLDDTVCKPA
FT                   KLEILSASPSLSQASITISEGKFHQIKKMFLSVGVKVTSLKRIQFGDFTLNPDLAEGNY
FT                   RPLNQKELQIIKNYLEMSR"
FT   gene            653679..655520
FT                   /locus_tag="SP_0681"
FT   CDS             653679..655520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0681"
FT                   /product="elongation factor Tu family protein"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR01394"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0681"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74826"
FT                   /protein_id="AAK74826.1"
FT                   /translation="MTKLREDIRNIAIIAHVDHGKTTLVDELLKQSETLDARTELAERA
FT                   MDSNDIEKERGITILAKNTAVAYNGTRINIMDTPGHADFGGEVERIMKMVDGVVLVVDA
FT                   YEGTMPQTRFVLKKALEQDLVPIVVVNKIDKPSARPAEVVDEVLELFIELGADDDQLDF
FT                   PVVYASAINGTSSLSDDPADQEATMAPIFDTIIDHIPAPVDNSDEPLQFQVSLLDYNDF
FT                   VGRIGIGRVFRGTVKVGDQVTLSKLDGTTKNFRVTKLFGFFGLERREIQEAKAGDLIAV
FT                   SGMEDIFVGETITPTDAVEALPILHIDEPTLQMTFLVNNSPFAGKEGKWVTSRKVEERL
FT                   QAELQTDVSLRVDPTDSPDKWTVSGRGELHLSILIETMRREGYELQVSRPEVIVKEIDG
FT                   IKCEPFERVQIDTPEEYQGSVIQSLSERKGEMLDMISTGNGQTRLVFLVPARGLIGYST
FT                   EFLSMTRGYGIMNHTFDQYLPLIPGEIGGRHRGALVSIDAGKATTYSIMSIEERGTIFV
FT                   NPGTEVYEGMIIGENSRENDLTVNITKAKQMTNVRSATKDQTAVIKTPRILTLEESLEF
FT                   LNDDEYMEVTPESIRLRKQILNKAEREKANKKKKSAE"
FT   gene            655540..655794
FT                   /locus_tag="SP_0682"
FT   CDS             655540..655794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0682"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0682"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74827"
FT                   /protein_id="AAK74827.1"
FT                   /translation="MVYLVLGILLLLLYVFATPESIKGTVNIVAMVCILVALLILLVLS
FT                   FLKIFQLPTEIFLAIAMLILAYFSVRDITLMPVKKSKRR"
FT   gene            complement(655988..656086)
FT                   /locus_tag="SP_0683"
FT   CDS             complement(655988..656086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0683"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0683"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74828"
FT                   /protein_id="AAK74828.1"
FT                   /translation="MKPLSYVIRITFLLFVVKEKIEFFRYFTILPL"
FT   gene            656249..656344
FT                   /locus_tag="SP_0684"
FT   CDS             656249..656344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0684"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0684"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74829"
FT                   /protein_id="AAK74829.1"
FT                   /translation="MEEYGHMEKVQEVVRLFQITIMVKNIIIHLS"
FT   gene            656341..656433
FT                   /locus_tag="SP_0685"
FT   CDS             656341..656433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0685"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0685"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74830"
FT                   /protein_id="AAK74830.1"
FT                   /translation="MSRWDGHSDKGEAPAGKPPMHGFGLNGENK"
FT   gene            656527..658548
FT                   /locus_tag="SP_0686"
FT   CDS             656527..658548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0686"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:9795228; match to
FT                   protein family HMM PF07242; match to protein family HMM
FT                   TIGR01654"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0686"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74831"
FT                   /protein_id="AAK74831.1"
FT                   /translation="MKKLFILLSTFFLSFFLAWIIVLRAPQYLYASYDSVSLLRVKKDT
FT                   QEPTREVFEQELENFANSEQSLIARRIVEPSKDGTTHFTYATYGQGTLPKEFQEASQES
FT                   RERSDPLNSYLLLSGSLTKEKLADKLGDLGYKASADRKIPPYFLAFRILLNPLILISLA
FT                   IFGLSFFALVIITRIKEMRAAGIKLFSGQTLLSIMGHSLSTDIKWLLLSALLSFLGGGV
FT                   VLFSQGLFYPILLATYGFGISFYLLFLLAISILLMLLYLMSLSYKALVPVIKGRLPLKR
FT                   LMALTLLCQLVAVFTVGYAVKTGLTSYQRLKELEISKQAWQDRADYYQISFGLGDRGKD
FT                   TENQSKWYAFAKEAIEEEQALYVKDNLLHFANPQGKNEQGETLDTYSSDANTLYVSPSY
FT                   LDKEKVVVDAETKQKLAHLQKGEFILLLPEHLRSREAELKKVFEERLSYYGKSGEEASA
FT                   PLDYEMKAHVSYLSMGEKRFVYNNGENPVSTQYLTDPILVVFTPTSTGDSFISLSSWSI
FT                   NAGKQLFIKGYESGLELLKKAGIYEQVSYLKEGRSVYLTRYNEVQTETATLILGAIVGI
FT                   ASSLLLFYSVNLLYFEQFRRDILIKRISGLRFFETHAQYMVSQFASFVFGASLFILSSR
FT                   DLVIGLLTLLVFLASAVLTLYRQAQKESRVSMTIMKGK"
FT   gene            658550..659191
FT                   /locus_tag="SP_0687"
FT   CDS             658550..659191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0687"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0687"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74832"
FT                   /protein_id="AAK74832.1"
FT                   /translation="MIELKNISKKFGSRQLFSDMNLHFEGGKIYALIGTSGCGKTTLLN
FT                   MIGRLEPYDKGQIIYDGTSLKDIKPSVFFRDYLGYLFQDFGLIESQTVKENLNLGLVGK
FT                   KLKEKEKISLMKQALNRVNLSYLDLKQPIFELSGGEAQRVALAKIILKDPPLILADEPT
FT                   ASLDPKNSEELLSILESLKNPNRTIIIATHNPLIWEQVDQVIRVTDLSHR"
FT   gene            659295..660647
FT                   /gene="murD"
FT                   /locus_tag="SP_0688"
FT   CDS             659295..660647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="SP_0688"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="identified by similarity to GP:4009480; match to
FT                   protein family HMM PF01225; match to protein family HMM
FT                   PF02875; match to protein family HMM TIGR01087"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0688"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74833"
FT                   /db_xref="GOA:Q97RU8"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RU8"
FT                   /protein_id="AAK74833.1"
FT                   /translation="MKVIDQFKNKKVLVLGLAKSGESAARLLDKLGAIVTVNDGKPFED
FT                   NPAAQSLLEEGIKVITGGHPLELLDEEFALMVKNPGIPYNNPMIEKALAKGIPVLTEVE
FT                   LAYLISEAPIIGITGSNGKTTTTTMIGEVLTAAGQHGLLSGNIGYPASQVAQIASDKDT
FT                   LVMELSSFQLMGVQEFHPEIAVITNLMPTHIDYHGSFSEYVAAKWNIQNKMTAADFLVL
FT                   NFNQDLAKDLTSKTEATVVPFSTLEKVDGAYLEDGQLYFRGEVVMAANEIGVPGSHNVE
FT                   NALATIAVAKLRDVDNQTIKETLSAFGGVKHRLQFVDDIKGVKFYNDSKSTNILATQKA
FT                   LSGFDNSKVVLIAGGLDRGNEFDELVPDITGLKKMVILGQSAERVKRAADKAGVAYVEA
FT                   TDIADATRKAYELATQGDVVLLSPANASWDMYANFEVRGDLFIDTVAELKE"
FT   gene            660649..661707
FT                   /gene="murG"
FT                   /locus_tag="SP_0689"
FT   CDS             660649..661707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="SP_0689"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by similarity to SP:Q9ZHA9; match to
FT                   protein family HMM PF03033; match to protein family HMM
FT                   PF04101"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0689"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74834"
FT                   /db_xref="GOA:P0CB60"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CB60"
FT                   /protein_id="AAK74834.1"
FT                   /translation="MKKIVFTGGGTVGHVTLNLLLMPKFIEDGWEVHYIGDKCGIEHQE
FT                   ILKSGLDVTFHSIATGKLRRYFSWQNMLDVFKVGWGIVQSLFIMLRLRPQTLFSKGGFV
FT                   SVPPVIAARVSGVPVFIHESDLSMGLANKIAYKFATKMYSTFEQASSLAKVEHVGAVTK
FT                   VSDKNTPEPDELVDIQTHFNPKLPTVLFVGGSAGARVFNQLVTDHKKELTERYNIINLT
FT                   GDSSLNELRQNLFRVDYVTDLYQPLMELADIVVTRGGANTIFELLAIAKLHVIVPLGRE
FT                   ASRGDQIENAAYFVKKGYAEDLQESDLTLDSLEEKLSHLLSHKEDYQAKMKASKELKSL
FT                   ADFYQLLKKDLS"
FT   gene            661717..662916
FT                   /gene="divIB"
FT                   /locus_tag="SP_0690"
FT   CDS             661717..662916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIB"
FT                   /locus_tag="SP_0690"
FT                   /product="cell division protein DivIB"
FT                   /note="identified by similarity to GP:4009482; match to
FT                   protein family HMM PF03799"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0690"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74835"
FT                   /db_xref="GOA:Q97RU7"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026580"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RU7"
FT                   /protein_id="AAK74835.1"
FT                   /translation="MSKDKKNEDKETLEELKELSEWQKRNQEYLKKKAEEEAALAEEKE
FT                   KERQARMGEESEKSEDKQDQESETDQEDSESAKEESEEKVASSEADKEKEEKEEPESKE
FT                   KEEQDKKLAKKATKEKPAKAKIPGIHILRAFTILFPSLLLLFVSAYLLSPYATMKDIRV
FT                   EGTVQTTADDIRQASGIQDSDYTINLLLDKAKYEKQIKSNYWVESAQLVYQFPTKFTIK
FT                   VKEYDIVAYYISGENHYPILSSGQLETSSVSLNSLPETYLSVLFNDSEQIKVFVSELAQ
FT                   ISPELKAAIQKVELAPSKVTSDLIRLTMNDSDEVLVPLSEMSKKLPYYSKIKPQLSEPS
FT                   VVDMEAGIYSYTVADKLIMEAEEKAKQEAKEAEKKQEEEQKKQEEESNRNQTTQRSSRR
FT                   "
FT   gene            663026..663172
FT                   /locus_tag="SP_0691"
FT   CDS             663026..663172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0691"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0691"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74836"
FT                   /protein_id="AAK74836.1"
FT                   /translation="MMKKVTHMSDEVFLFEEIEEIVAPTDGEFLGEVLLGTGVVLLIGV
FT                   ACC"
FT   gene            663184..663315
FT                   /locus_tag="SP_0692"
FT   CDS             663184..663315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0692"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0692"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74837"
FT                   /protein_id="AAK74837.1"
FT                   /translation="MIIMQDNFLFEEIEEISVPVNDFSAGLATGIGFGLAILALAGC"
FT   gene            663498..663614
FT                   /locus_tag="SP_0693"
FT   CDS             663498..663614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0693"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0693"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74838"
FT                   /protein_id="AAK74838.1"
FT                   /translation="MRIVDKIKILPTPYEGHYHLYIPSSKKHVLVGKQEKNG"
FT   gene            663748..664311
FT                   /locus_tag="SP_0694"
FT   CDS             663748..664311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0694"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF02163"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0694"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74839"
FT                   /protein_id="AAK74839.1"
FT                   /translation="MKKSYLVVIIFATIHEISHAIIANNYQIEIPNCGIMLLLFNLAFF
FT                   VDLSGVQFLKNKKQFLKIMLAGIASNSILSLTGLLVLLFTSYKLLGLLFFIINLGMIFI
FT                   NSIPFFQYDSGIILRYLNSNNNNLNFQYIVQLLIAFVIIYFPLSQLLQFLTPNIIVRSI
FT                   GGVVVSILLSILYMIGRTKYVLRK"
FT   gene            664654..665289
FT                   /locus_tag="SP_0695"
FT   CDS             664654..665289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0695"
FT                   /product="HesA/MoeB/ThiF family protein"
FT                   /note="identified by match to protein family HMM PF00899"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0695"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74840"
FT                   /protein_id="AAK74840.1"
FT                   /translation="MYGVRKLIVADYDIIEPSNLNRQILYTESDVGKEKINVLSEKIHK
FT                   YNSDVQVVPISIKVSSVEELEKIVAEYGSIDFIVKAIDTPIDIIKIVNQFAVSHKISYI
FT                   SGGFNGCYLIIDNIYIPTIGSCFGCRNINKDINKYTLSDKTKWPTTPEMPAILGGIMTN
FT                   LIIKIFLGCYNEILIDNAYVYNMRNHALSQEKYVLENGECPICKKIIK"
FT   gene            665286..665666
FT                   /locus_tag="SP_0696"
FT   CDS             665286..665666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0696"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0696"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74841"
FT                   /protein_id="AAK74841.1"
FT                   /translation="MKDNNIRAKTFIRSVCFCLLSGGVAFLSAIGQFTVIETQLIVLFL
FT                   GIIFAIYYAYYNKNIQTSLENIVWLFSSFEILFLLVNFRTFIQLPVDIFIGMIIFLMLW
FT                   IFIMLGIVCLSYYITLLFSKEA"
FT   gene            665834..666709
FT                   /pseudo
FT                   /locus_tag="SP_0697"
FT                   /note="ABC transporter, ATP-binding protein, authentic
FT                   point mutation; this gene contains a premature stop which
FT                   is not the result of sequencing error; identified by
FT                   similarity to GP:10176518"
FT   gene            666702..667415
FT                   /locus_tag="SP_0698"
FT   CDS             666702..667415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0698"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0698"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74842"
FT                   /protein_id="AAK74842.1"
FT                   /translation="MLKRFLALVWLRCQIILSNKSILLQVLVPFAFTYFYKYLMETQGK
FT                   VNDQQALVLLMMCLPFSFSLAVGSPITIILSEEKEKYNLQTLLLSGVKGSEYILSTMFL
FT                   PFLLTFVIMGTTPLILGVTIVHTFNYITIVLLTSLSIILFYLLIGLTAKSQVVAQVISL
FT                   PAMILVAFLPMLSGLDKTVAKITDYSFMGLFTKFFTKWEEFSWNKTLIPNLTLLIWIVL
FT                   LLTLITITIRKKKIS"
FT   gene            667416..667514
FT                   /locus_tag="SP_0699"
FT   CDS             667416..667514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0699"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0699"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74843"
FT                   /protein_id="AAK74843.1"
FT                   /translation="MSYFNDYKHKWEGKNELIFLTAILQNSLIAIF"
FT   gene            complement(667618..667953)
FT                   /pseudo
FT                   /locus_tag="SP_0700"
FT                   /note="transposase, IS30 family, degenerate; this gene
FT                   contains a premature stop which is not the result of
FT                   sequencing error; identified by similarity to EGAD:9451"
FT   gene            668161..668862
FT                   /gene="pyrF"
FT                   /locus_tag="SP_0701"
FT   CDS             668161..668862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="SP_0701"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="identified by similarity to EGAD:16927; match to
FT                   protein family HMM PF00215; match to protein family HMM
FT                   TIGR01740"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0701"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74844"
FT                   /db_xref="GOA:P0CB75"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CB75"
FT                   /protein_id="AAK74844.1"
FT                   /translation="MREHRPIIALDFPSFEAVKEFLALFPAEESLYLKVGMELYYAAGP
FT                   EIVSYLKGLGHSVFLDLKLHDIPNTVKSAMKILSQLGVDMTNVHAAGGVEMMKAAREGL
FT                   GSQAKLIAVTQLTSTSEAQMQEFQNIQTSLQESVIHYAKKTAEAGLDGVVCSAQEVQVI
FT                   KQATNPDFICLTPGIRPAGVAVGDQKRVMTPADAYQIGSDYIVVGRPITQAEDPVAAYH
FT                   AIKDEWTQDWN"
FT   gene            668896..669528
FT                   /gene="pyrE"
FT                   /locus_tag="SP_0702"
FT   CDS             668896..669528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="SP_0702"
FT                   /product="orotate phosphoribosyltransferase PyrE"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by similarity to EGAD:33620; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR00336"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0702"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74845"
FT                   /db_xref="GOA:P0CB78"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CB78"
FT                   /protein_id="AAK74845.1"
FT                   /translation="MTLAKDIASHLLKIQAVYLKPEEPFTWASGIKSPIYTDNRVTLAY
FT                   PETRTLIENGFVEAIKEAFPEVEVIAGTATAGIPHGAIIADKMDLPFAYIRSKPKDHGA
FT                   GNQIEGRVAQGQKMVVVEDLISTGGSVLEAVAAAKREGADVLGVVAIFSYQLPKADKNF
FT                   ADAGVKLVTLSNYSELIHLAQEEGYITPEGLDLLKRFKEDQENWQEG"
FT   gene            669761..670111
FT                   /locus_tag="SP_0703"
FT   CDS             669761..670111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0703"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0703"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74846"
FT                   /protein_id="AAK74846.1"
FT                   /translation="MFLPTVLARQIGDYDLTSPRWGSDTTSELEKENSSAGINNNDSTG
FT                   GGKRLNTSIRSAYSGSDITPVYSLGSGSRIVMYYNGGGDNYIGSGTRLAMAPQFGNHVR
FT                   IHTSGSWNPDSY"
FT   gene            670207..670971
FT                   /locus_tag="SP_0704"
FT   CDS             670207..670971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0704"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0704"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74847"
FT                   /protein_id="AAK74847.1"
FT                   /translation="MEFFICNLVRVVQSPRFYMSLFLTLLCMSLGNFLAFNGIYKIEGL
FT                   SIFFAASSIRGFSPISLVAALICTLPYSSQIIEDAESHFLTAQLCRISKKKYLAIVGST
FT                   VIISSFLVFFLPYLLLLGINLLVTPYQEIYIGDYSGALKELFDSNQFLYSLVTTLWYGV
FT                   WGAVFSIFGLASALLVKKKIGAIFIPVAYMMVGGIFWAILGLSYLEPVTTLALGYQKDI
FT                   SLSLVSAHLAFILFVSCLVVYGTFFLHSEDYV"
FT   gene            670920..671723
FT                   /locus_tag="SP_0705"
FT   CDS             670920..671723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0705"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0705"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74848"
FT                   /protein_id="AAK74848.1"
FT                   /translation="MFGCLWYIFSTFRGLCIMKQFVQFYKKDFLAVLVYFILLLSCVLS
FT                   STVYLLRCRQYSIHPNVLEWILVLLQDMTTGVYCFPFTYILFFFYLMNNYFNRLECRIR
FT                   LKSIKHFTSFSFKLAALSTGIWTATLFLLIFLIAFSNGFSFSLEIKEVDFLREFYGISI
FT                   ANNASFFIGFFFSYIAYYFFLSLLTISSFSWFKKSNMSLVFLFTFLFVESLFWIYQLDN
FT                   GIIGLLPIFQYMVNSNPYALIYWLTLLSIIIPLTVFSVHRNWRRV"
FT   gene            671727..672431
FT                   /locus_tag="SP_0706"
FT   CDS             671727..672431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0706"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0706"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74849"
FT                   /protein_id="AAK74849.1"
FT                   /translation="MEMGKLSSHMWRLNQIIYTKYFWGYVLFWILICLGLWYWLEGNDR
FT                   LVIEILKGPNLSQNSFLVLSIWLLHWFIIHTFFLAVVYRRRASDFFMEVIRFSSIKLWI
FT                   RYQIWTCFLYGLILIMVKVLVIQFMLQLPNWDIGVLFIVDSLNACVLVLFCFMLYALGA
FT                   NVQMNFACVSFFLLMIVFGGLFVGNRTNYLFYILNRGNGDIGRDLFLQLLFLVFLFQSI
FT                   FYFTRQKRRFIE"
FT   gene            672428..673075
FT                   /locus_tag="SP_0707"
FT   CDS             672428..673075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0707"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0707"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74850"
FT                   /protein_id="AAK74850.1"
FT                   /translation="MNEIITLKNIELKLKKTCVFQNLNFSCKQGEIIGITGANGSGKSV
FT                   LFKLIAGLYSPSYGEVLINGENIVPERKIPANLGALIEEPGFINYYSGFKNLQYLASIR
FT                   GVVGNQEINDTLKIVGLYEQKDQKVKTYSLGMRKKLGIAQAIMENPSILLLDEPMNALD
FT                   KSSVENMRTLFRKLSSEKGTTILIASHSEEDIRILCDKVYAIEDKVCTLCSD"
FT   gene            complement(673162..674033)
FT                   /pseudo
FT                   /locus_tag="SP_0708"
FT                   /note="amino acid ABC transporter, amino acid-binding
FT                   protein, authentic frameshift; this gene contains a frame
FT                   shift which is not the result of sequencing error;
FT                   identified by similarity to EGAD:17088"
FT   gene            complement(674045..674803)
FT                   /locus_tag="SP_0709"
FT   CDS             complement(674045..674803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0709"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to EGAD:6883; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0709"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74851"
FT                   /protein_id="AAK74851.1"
FT                   /translation="MSETILEIKELKKSFGDNPILQGLSLEIKKGEVVVILGPSGCGKS
FT                   TLLRCLNGLESIQGGDILLDGQSIVENKKDFHLVRQKIGMVFQSYELFPHLDVLQNLIL
FT                   GPIKAQGRDKKEVTEEALQLLERVGLLDKQHSFARQLSGGQKQRVAIVRALLMHPEIIL
FT                   FDEVTASLDPEMVREVLELINDLAQEGRTMILVTHEMQFAQAITDRIIFLDQGKIAEEG
FT                   TAQAFFTNPQTKRAQEFLNVFDFSQFGSYL"
FT   gene            complement(674804..675481)
FT                   /locus_tag="SP_0710"
FT   CDS             complement(674804..675481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0710"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0710"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74852"
FT                   /protein_id="AAK74852.1"
FT                   /translation="MQDSGIQVLFQGNNLLRILQGLGVTIGISILSVLLSMMFRTVMGI
FT                   IMTSHSRIIRFLTRLYLEFIRIMPQLVLLFIVYFGLARNFNINISGETSAIIVFTLWGT
FT                   AEMGDLVRGAITSLPKHQFESGQALGLTNVQLYYHIIIPQVLRRLLPQAINLVTRMIKT
FT                   TSLVVLIGVVEVTKVGQQIIDSNRLTIPTASFWIYGTILILYFAVCYPISKLSTHLEKH
FT                   WRN"
FT   gene            complement(675441..676061)
FT                   /locus_tag="SP_0711"
FT   CDS             complement(675441..676061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0711"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0711"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74853"
FT                   /protein_id="AAK74853.1"
FT                   /translation="MHIAVWGILGSFLLGLIVSIIRHYRILVLAQVATAYIELSRNTPL
FT                   LIQLFFLYFGLPRIGIVLSSEVCATLGLVFLGGSYMAESFRSGLEAISQTQQEIGLAIG
FT                   LTPLQVFYYVVLPQATAVALPSFSANVIFLIKETSVFSAVALADLMYVAKDLIGLYYET
FT                   DIALAMLVVAYLIMLLPISLVFSWIERRLRHAGFGNPSTLSRK"
FT   gene            676335..676481
FT                   /gene="lctO-1"
FT                   /locus_tag="SP_0712"
FT   CDS             676335..676481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctO-1"
FT                   /locus_tag="SP_0712"
FT                   /product="lactate oxidase, truncation"
FT                   /note="identified by similarity to GP:2239174"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75797"
FT                   /protein_id="ABC75797.1"
FT                   /translation="MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAGDTFT
FT                   SFQ"
FT   gene            676624..678099
FT                   /gene="lysS"
FT                   /locus_tag="SP_0713"
FT   CDS             676624..678099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SP_0713"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0713"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74854"
FT                   /db_xref="GOA:Q97RS9"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RS9"
FT                   /protein_id="AAK74854.1"
FT                   /translation="MEELNDQQIVRREKMAALREQGIDPFGKRFERTANSQELKDKYAN
FT                   LDKEQLHDKNETATIAGRLITKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENYEIFKK
FT                   ADLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRKRYLDL
FT                   ISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHNAQNID
FT                   MVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADFQDIMD
FT                   LTEGIIQHAAKSVKGDGPVNYQGTEIKINEPFKRVHMVDAIREITGVDFWQDMTLEEAK
FT                   AIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNPEDQRF
FT                   TDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEALEYGM
FT                   PPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK"
FT   gene            complement(678711..680057)
FT                   /locus_tag="SP_0714"
FT   CDS             complement(678711..680057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0714"
FT                   /product="IS1380-Spn1, transposase"
FT                   /note="identified by similarity to GP:8163721; match to
FT                   protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0714"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74855"
FT                   /protein_id="AAK74855.1"
FT                   /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKER
FT                   ISKYLVTNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLAS
FT                   QPTLSRFLSRTDEETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAY
FT                   NAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRMDSG
FT                   FATPKLYDLIEKTGQYYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAG
FT                   SWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIKEMKEGF
FT                   FGDKTDSSTLIKNEVRMMMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVR
FT                   TGRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPRRKASLMMH"
FT   gene            680430..681566
FT                   /gene="lctO-2"
FT                   /locus_tag="SP_0715"
FT   CDS             680430..681566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctO-2"
FT                   /locus_tag="SP_0715"
FT                   /product="lactate oxidase"
FT                   /note="identified by similarity to GP:2239174; match to
FT                   protein family HMM PF01070; match to protein family HMM
FT                   TIGR02708"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0715"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74856"
FT                   /protein_id="AAK74856.1"
FT                   /translation="MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFT
FT                   LRENIRAFNHKLIVPHTLCNVENPSTEIEFAGEKLSSPIIMAPVAAHKLANEQGEVATA
FT                   RGVHEFGSLYTTSSYSTVDLPEISEALQGTPHWFQFYFSKDDGINRHIMDRVKAEGYKA
FT                   IVLTADATVGGNREVDKRNGFVFPVGMPIVEEYLPEGAGKSMDFVYKSAKQRLSPRDVE
FT                   FIAEYSGLPVYVKGPQCREDVERSLAAGASGIWVTNHGGRQIDGGPAAFDSLQEVAEAV
FT                   DRRVPIVFDSGVRRGQHVFKALASGADLVAIGRPVIYGLALGGSVGVRQVFEHLNAELK
FT                   TVMQLSGTQTIEDVKHFKLRHNPYNPTFPVDPRDLKLY"
FT   gene            682123..682791
FT                   /locus_tag="SP_0716"
FT   CDS             682123..682791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0716"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0716"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74857"
FT                   /protein_id="AAK74857.1"
FT                   /translation="METQDYAFQPGLTVGELLKSSQKDWQAAINHRFVKELFAGTIENK
FT                   VLKDYLIQDYHFFDAFLSMLGACVAHADKLESKLRFAKQLGFLEADEDGYFQKAFKELK
FT                   VAENDYLEVTLHPVTKAFQDLMYSAVASSDYAHLLVMLVIAEGLYLDWGSKDLALPEVY
FT                   IHSEWINLHRGPFFAEWVQFLVDELNRVGKNREDLTELQQRWNQAVALELAFFDIGYDV
FT                   "
FT   gene            683028..683810
FT                   /gene="thiM"
FT                   /locus_tag="SP_0717"
FT   CDS             683028..683810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="SP_0717"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="identified by similarity to EGAD:90780; match to
FT                   protein family HMM PF02110; match to protein family HMM
FT                   TIGR00694"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0717"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74858"
FT                   /db_xref="GOA:Q97RS6"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RS6"
FT                   /protein_id="AAK74858.1"
FT                   /translation="MTSLKLLKEKAPLVICITNDVVKNFTANGLVALGASPAMSEFPAD
FT                   LEDLLKYAGGLLINIGTLTDENWKLYQAALKIAEKYNVPAVLDPVACGAGEYRKKVADD
FT                   LINNYKLAAIRGNAGEIASLVGIDVASKGVDSAGVDNIDEIALAANEKFNIPIVVTGEV
FT                   DAIAVNGEVVMIHNGSAMMPKVIGTGCLLGAVVASFIGLEKGQELKSLKTAVLVYNIAG
FT                   EIAEKRPNGHLPGTFKVEFINALYEITDEDVKEFKRVK"
FT   gene            683812..684441
FT                   /gene="thiE-1"
FT                   /locus_tag="SP_0718"
FT   CDS             683812..684441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE-1"
FT                   /locus_tag="SP_0718"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by similarity to EGAD:22506; match to
FT                   protein family HMM PF02581; match to protein family HMM
FT                   TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0718"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74859"
FT                   /db_xref="GOA:Q97RS5"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RS5"
FT                   /protein_id="AAK74859.1"
FT                   /translation="MFHKELLKLYFICGTTTCQGKNLYTVVEEALKGGITLFQFREKGE
FT                   GALEGLEKLELAIQIKELCKKYNVPFIVNDDIDLAMEIDADGVHVGQDDIGVDEIRKLM
FT                   PDKIIGLSIRNEEEFQQSKVEYVDYVGVGPVFGTQSKDDAGGTIGYEGLELMRKLLPQM
FT                   PLVAIGGIQTKHIKDIIKTNMDGVSIISAISYAKNIEKTVREMSEQ"
FT   gene            685000..685560
FT                   /locus_tag="SP_0719"
FT   CDS             685000..685560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0719"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:107484"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0719"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74860"
FT                   /protein_id="AAK74860.1"
FT                   /translation="MLKKWQLKDVILLAFLSIFFGGVFVGSGYVYNILSLLLTPLGLQA
FT                   FANEILFGLWCMAAPIAAIFVPRVGSATIGEVLAALAEVLYGSQFGLGALLSGFVQGLG
FT                   SEFGFIVTKNRYESWLSLTANSIGITLVSFVYEYIKLGYYAFSLPFVLSLLVVRFISVY
FT                   FFCTILVRAIVKLYHQFATGGKA"
FT   gene            685561..686946
FT                   /locus_tag="SP_0720"
FT   CDS             685561..686946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0720"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0720"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74861"
FT                   /protein_id="AAK74861.1"
FT                   /translation="MGLELRAIQSPIFSEPFDFTFHAQAFTLLVGSSGSGKSSLFQMIA
FT                   QVSSLPYSGQVLIDGSEVSQLSIVERVQTVGILLQNPNHQFTMESLFEELVFTMENIGY
FT                   HLQEIDSKIAEVVQQCRCKDILHRLIHHLSGGEKQKAALAVLFAMNPRVYLLDEPFASI
FT                   DRKSRIEILEILKELVYDGKTVILCDHDLSDYKAYIDHMVELRDGKLREVFQIPSYEMT
FT                   QVASKEVASSPELFHMNRVTGELGNRPLFSIADFTFYQGISCILGDNGVGKSTLFRSIL
FT                   QFQKYKGSITWKGSVLKKKKSLYRDLTGVVQEAEKQFIRVSLREELQLDGPDSERNQRI
FT                   FQALRYFDLEQAVDKSPYQLSGGQQKILQLLTILTSKASVILLDEPFAGLDDRACHYFC
FT                   KWIVEERNQGRSFLLISHRLDPLISVVDYWIEMTSQGLRHVKEVTITKPLTSQSSNTQG
FT                   EVR"
FT   gene            686948..687598
FT                   /locus_tag="SP_0721"
FT   CDS             686948..687598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0721"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:137252"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0721"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74862"
FT                   /protein_id="AAK74862.1"
FT                   /translation="MVKVATQTPIISLFLLILSLETSFIPSIALTLSVVAFCILFMLYY
FT                   RRFKMLAWMIILAILPSFANYWAVQLHGDASQAVMLGTRAFVTVCIGLVFVSSVSLKEL
FT                   LLYLAQKGLSRSWSYALIVVFNSFPLIQQEIKSLKEACLLRGQELHFWSPLIYSKVLMT
FT                   VFRWRHLYLRALSAHGYDEHAQLKNSYRTFYIPKKTKLIYLLFFLLLQTSLFL"
FT   gene            687609..688301
FT                   /gene="tenA"
FT                   /locus_tag="SP_0722"
FT   CDS             687609..688301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tenA"
FT                   /locus_tag="SP_0722"
FT                   /product="transcriptional activator TenA"
FT                   /note="identified by similarity to EGAD:24145; match to
FT                   protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0722"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74863"
FT                   /protein_id="AAK74863.1"
FT                   /translation="MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDA
FT                   YYLKAFSEIYHLLADKTSNQEMKRLLKQNAQGLVEGELFIRQQFFKELEISDQEMEQHP
FT                   IAPTCYHYISHIYRQFAEPNLAIAFASLLPCPWLYHDIGKSLNLKPSPNPLYQQWIETY
FT                   ITDELEQQIREEGALVNQLYRESDETDKQKMLDAFHISVHMEAKFWEMAYQHQTWKSDL
FT                   QSLEKGEE"
FT   gene            688306..688830
FT                   /gene="thiW"
FT                   /locus_tag="SP_0723"
FT   CDS             688306..688830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiW"
FT                   /locus_tag="SP_0723"
FT                   /product="thiW protein"
FT                   /note="identified by similarity to EGAD:170325; match to
FT                   protein family HMM TIGR02359"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0723"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74864"
FT                   /protein_id="AAK74864.1"
FT                   /translation="MRKHQLQVHKLTILSMMIALDVVLTPIFRIEGMAPMSSVVNILAG
FT                   IMMGPVYALAMATVTAFIRMTTQGIPPLALTGATFGALLAGLFYKYGRKFHYSALGEIL
FT                   GTGIIGSIVSYPVMVLFTGSAAKLSWFIYTPRFFGATLIGTAISFIAFRFLIKQEFFKK
FT                   VQGYFFSERID"
FT   gene            688830..689633
FT                   /locus_tag="SP_0724"
FT   CDS             688830..689633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0724"
FT                   /product="putative hydroxyethylthiazole kinase"
FT                   /note="identified by similarity to EGAD:13938; match to
FT                   protein family HMM PF02110"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0724"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74865"
FT                   /db_xref="GOA:Q97RR9"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RR9"
FT                   /protein_id="AAK74865.1"
FT                   /translation="MQEFTNPFPIGSSSLIHCITNEISCEMLANGILALGCKPVMADDS
FT                   REVLDFTKQSQALFINLGHLSAEKEKAIRMAASYANQSSLPMVVDAVGVTTSSIRKSLV
FT                   KDLLDYRPTVLKGNMSEIRSLVGLKHHGVGVDASAKDQETEDLLQVLKDWCQTYPGMSF
FT                   LVTGPKDLVVSKNQVAVLGNGCTELDWITGTGDLVGALTAVFLSQGKTGFEASCLAVSY
FT                   LNIAAEKIVVQGMGLEEFRYQVLNQLSLLRRDENWLDTIKGEVYE"
FT   gene            689626..690258
FT                   /gene="thiE-2"
FT                   /locus_tag="SP_0725"
FT   CDS             689626..690258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE-2"
FT                   /locus_tag="SP_0725"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by similarity to GP:2746079; match to
FT                   protein family HMM PF02581; match to protein family HMM
FT                   TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0725"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74866"
FT                   /db_xref="GOA:P66920"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66920"
FT                   /protein_id="AAK74866.1"
FT                   /translation="MNREALRLYLVTNRYQDSVESFLAKVETACRSGVTIVQLREKNLT
FT                   TNQYYQLAKQVKEITDAYQVPLIIDDRLDVCLAVDAAGLHIGDDELPVSVARKVLGPEK
FT                   ILGVTAKTVKRALEAEKSGADYLGTGAIFPTTTKENAPITLISTLKTICQTVAIPVVAI
FT                   GGLTSENIDQLMGTGIAGVAVVRDLMQAEDIEAKTQAFLKKLHNILS"
FT   gene            complement(690468..691259)
FT                   /gene="thiD"
FT                   /locus_tag="SP_0726"
FT   CDS             complement(690468..691259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SP_0726"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by similarity to EGAD:90778; match to
FT                   protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0726"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74867"
FT                   /protein_id="AAK74867.1"
FT                   /translation="MTYLPVALTIAGTDPSGGAGIMADLKSFQARDVYGMAVVTSLVAQ
FT                   NTRGVQLIEHVSPQMLKAQLESVFSDIPPQAVKTGMLATTEIMEIIQPYLKKLDCPYVL
FT                   DPVMVATSGDALIDSNARDYLKTNLLPLATIITPNLPEAEEIVGFSIHDPEDMQRAGRL
FT                   ILKEFGPQSVVIKGGHLKGGAKDFLFTKNEQFVWESPRIQTCHTHGTGCTFAAVITAEL
FT                   AKGKSLYQAVDKAKAFITKAIQDAPQLGHGSGPVNHTTFKD"
FT   gene            691619..692020
FT                   /locus_tag="SP_0727"
FT   CDS             691619..692020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0727"
FT                   /product="putative transcriptional repressor"
FT                   /note="identified by similarity to EGAD:42450; match to
FT                   protein family HMM PF03965; match to protein family HMM
FT                   TIGR02698"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0727"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74868"
FT                   /protein_id="AAK74868.1"
FT                   /translation="MVMQISDAEWQVMKIIWMQGEQTSTDLIRVLAERFDWSKSTVQTL
FT                   LARLVDKECLTRKKEGKSFVYSALLTLDQSRDLLVQDIKDKVCSRRIRNLLADLIVECE
FT                   FTQTDLEDLEAVISEKKSSAVTEVRCNCM"
FT   gene            692031..692402
FT                   /locus_tag="SP_0728"
FT   CDS             692031..692402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0728"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0728"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74869"
FT                   /protein_id="AAK74869.1"
FT                   /translation="MLNSIVTIICIALIAFILFWFFKKPEKSGQKAQQKNGYQEIRVEV
FT                   MGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQA
FT                   GEFGFACGMNMMHGKMIVE"
FT   gene            692673..694655
FT                   /locus_tag="SP_0729"
FT   CDS             692673..694655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0729"
FT                   /product="cation-transporting ATPase, E1-E2 family"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01511; match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0729"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74870"
FT                   /protein_id="AAK74870.1"
FT                   /translation="MKMQKGSYTVVEKTRKSLSLLQRFWITSIFTVPLVILMIGMLTGS
FT                   ISHQVMHWGTFLATTPIMLVAGKPYIQSAWASFKKHNANMDTLVALGTLVAYFYSLVAL
FT                   FAGLPVYFESAGFILFFVLLGAVFEEKMRKNTSQAVEKLLDLQAKTAEVLSDDSYVQVP
FT                   LEQVKVGDLIRVRPGEKIAVDGVVVEGVSSIDESMVTGESLPVDKTVGDTVIGSTINHS
FT                   GTLVFRAEKVGSETVLAQIVDFVKKAQTSRAPIQDLTDKISGIFVPVVVILGIMTFWVW
FT                   FVLLRDSVVVLGASFVSSLLYGVAVLIIACPCALGLATPTALMVGTGRSAKMGVLLKNG
FT                   TVLQEIQKVQTLVFDKTGTLTEGKPVVTDVIGDEVEVFGLAASLEDASQHPLAEAIVKR
FT                   ASEAGLEFQTVENFQSLHGKGVSGRINGKQVLLGNAKMLDGMDISNTYQDKLEELEKEA
FT                   KTVVFLAVDNEIKGLLALQDIPKENAKLAISQLKKRGLRTVMLTGDNAGVARAIADQIG
FT                   IEEVIAGVLPEEKAHEIHKLQQSGKVAFVGDGINDAPALSVADVGIAMGAGTDIAIESA
FT                   DLVLTTNNLLGVVRAFDMSKKTFHRILLNLFWAFIYNVVGIPIAAGVFSGVGLALNPEL
FT                   AGLAMAFSSVSVLTSSLLLNFSKID"
FT   gene            694862..696637
FT                   /gene="spxB"
FT                   /locus_tag="SP_0730"
FT   CDS             694862..696637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spxB"
FT                   /locus_tag="SP_0730"
FT                   /product="pyruvate oxidase"
FT                   /EC_number="1.2.3.3"
FT                   /note="identified by similarity to EGAD:41070; match to
FT                   protein family HMM PF00205; match to protein family HMM
FT                   PF02776; match to protein family HMM TIGR02720"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0730"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74871"
FT                   /db_xref="GOA:Q54970"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR014092"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q54970"
FT                   /protein_id="AAK74871.1"
FT                   /translation="MTQGKITASAAMLNVLKTWGVDTIYGIPSGTLSSLMDALAEDKDI
FT                   RFLQVRHEETGALAAVMQAKFGGSIGVAVGSGGPGATHLINGVYDAAMDNTPFLAILGS
FT                   RPVNELNMDAFQELNQNPMYNGIAVYNKRVAYAEQLPKVIDEACRAAVSKKGPAVVEIP
FT                   VNFGFQEIDENSYYGSGSYERSFIAPALNEVEIDKAVEILNNAERPVIYAGFGGVKAGE
FT                   VITELSRKIKAPIITTGKNFEAFEWNYEGLTGSAYRVGWKPANEVVFEADTVLFLGSNF
FT                   PFAEVYEAFKNTEKFIQVDIDPYKLGKRHALDASILGDAGQAAKAILDKVNPVESTPWW
FT                   RANVKNNQNWRDYMNKLEGKTEGELQLYQVYNAINKHADQDAIYSIDVGNTTQTSTRHL
FT                   HMTPKNMWRTSPLFATMGIALPGGIAAKKDNPDRQVWNIMGDGAFNMCYPDVITNVQYD
FT                   LPVINLVFSNAEYGFIKNKYEDTNKHLFGVDFTNADYAKIAEAQGAVGFTVDRIEDIDA
FT                   VVAEAVKLNKEGKTVVIDARITQHRPLPVEVLELDPKLHSEEAIKAFKEKYEAEELVPF
FT                   RLFLEEEGLQSRAIK"
FT   gene            696748..697095
FT                   /locus_tag="SP_0731"
FT   CDS             696748..697095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0731"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:7981392; match to
FT                   protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0731"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74872"
FT                   /protein_id="AAK74872.1"
FT                   /translation="MNLNQLDIIVSNVPQVCADLEHILDKKADYANDGFAQFTIGSHCL
FT                   MLSQNHLVPLENFQSGIIIHIEVEDVDQNYKRLNELGIKVLHGPTVTDWGTESLLVQGP
FT                   AGLVLDFYRMK"
FT   gene            complement(697212..697710)
FT                   /pseudo
FT                   /locus_tag="SP_0732"
FT                   /note="transposase family protein, authentic frameshift;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to EGAD:36363"
FT   gene            complement(697742..698008)
FT                   /locus_tag="SP_0733"
FT   CDS             complement(697742..698008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0733"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0733"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74873"
FT                   /protein_id="AAK74873.1"
FT                   /translation="MTVEEEKAFLARHLKATEAGEFVTIDALFQAYKKELGRSYTRDAF
FT                   YQLLKRHGWRNITPRPEHPKKADAQTIVASKNKISIQEGKKAF"
FT   gene            complement(698363..698458)
FT                   /locus_tag="SP_0734"
FT   CDS             complement(698363..698458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0734"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0734"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74874"
FT                   /protein_id="AAK74874.1"
FT                   /translation="MKSTKEEIQTIKTLLKDSRTAKYHKRLQIVL"
FT   gene            698523..698819
FT                   /locus_tag="SP_0735"
FT   CDS             698523..698819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0735"
FT                   /product="6-phospho-beta-glucosidase, truncation"
FT                   /note="identified by similarity to EGAD:21688"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75789"
FT                   /protein_id="ABC75789.1"
FT                   /translation="MDTPDENGYVADDYRITYLEAHIKAMRDAIYQDGVDLLGYTTWGC
FT                   IDPVSAGTGEMNKRYGFIYVDRDNVGNGALKRSKKKSFYWYKDVIYSNGASIG"
FT   gene            698940..699884
FT                   /gene="manA"
FT                   /locus_tag="SP_0736"
FT   CDS             698940..699884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="SP_0736"
FT                   /product="mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /note="identified by similarity to EGAD:14340; match to
FT                   protein family HMM PF01238; match to protein family HMM
FT                   TIGR00218"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0736"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74875"
FT                   /protein_id="AAK74875.1"
FT                   /translation="MSEPLFLQSVMQEKIWGGAKLRDEFGYDIPSEKIGEYWAISAHPN
FT                   GVSKVANGRYEGTDLATLYAEHRELFGNRPEPVFPLLTKILDANDWLSVQVHPDDAYGL
FT                   EHEGELGKTECWYIIAADEGSEIIYGHNAKSKEELRQQIEDKNWDDLLTKVPVKAGDFF
FT                   YVPSGTMHAIGAGILILETQQSSDTTYRVYDFDRKDDKGNLRELHLEKSIDVLNIGEPA
FT                   NSRPVTVKADDLRSTLLVSNDFFAVYKWEITGKVDFEKTADYSLLSVLAGQGQLTVDGK
FT                   NYPIQKGSHFILPSDVEAWTLEGQGLELIVSHP"
FT   gene            complement(699905..701176)
FT                   /locus_tag="SP_0737"
FT   CDS             complement(699905..701176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0737"
FT                   /product="sodium-dependent transporter"
FT                   /note="identified by similarity to EGAD:108536; match to
FT                   protein family HMM PF00209"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0737"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74876"
FT                   /protein_id="AAK74876.1"
FT                   /translation="MTAANGGGGFLLIFLISTILIGFPLLLAEFALGRSAGVSAIKTFG
FT                   KLGKNNKYNFIGWIGAFALFILLSFYSVIGGWILVYLGIEFGKLFQLGGTGDYAQLFTS
FT                   IISNPAIALGAQAAFILLNIFIVSRGVQKGIERASKVMMPLLFIVFVFIIGRSLSLPNA
FT                   MEGVLYFLKPDFSKLTSTGLLYALGQSFFALSLGVTVMLTYASYLDKKTNLVQSGISIV
FT                   AMNISISIMAGLAIFQARSPFNIQSEGGPSLLFIVLPQLFDKMPFGTIFYVLFLLLFLF
FT                   ATVTFSVVMLEINVDNITNQDNSKRAKWSVILGILTFVFGIPSALSYGVMADVHIFGKT
FT                   FFDAMDFLVSNLLMPFGALYLSLFTGYIFKKALAMEELHLDERAWKQGLFQVWLFLLRF
FT                   FVSSFQSSSLWSSLPNLCNQKGLE"
FT   gene            complement(701173..701400)
FT                   /locus_tag="SP_0738"
FT   CDS             complement(701173..701400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0738"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0738"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74877"
FT                   /protein_id="AAK74877.1"
FT                   /translation="MKMIFLTDLRKHDRIVKSINQTEGYLTTQVAFSYFEKGDQSLTMS
FT                   EKSQWGSKLGFILASAGWPSGLVPFGSFPT"
FT   gene            701499..702239
FT                   /locus_tag="SP_0739"
FT   CDS             701499..702239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0739"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF07739"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0739"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74878"
FT                   /protein_id="AAK74878.1"
FT                   /translation="MYHIKEAAQLSGVSVKTLHHYDKIGLLVPLKSENGYRTYSQEDLE
FT                   RLQVILYYKYLGFSLEKIAELLKEERTDLLPHLTRQLDYLTRERQHLDTLISTLQKTIQ
FT                   EQKGERKMTIEEKFTGFSYQDNQKYHQEAVEKYGQEVMGQALERQKGHEDEATAAFNQV
FT                   FQTLAQNLQVGLPATATENQEQAAKLLQAIRTYGFDCSIEVFGHIGKGYVYNPEFKENI
FT                   DKFGSETAQYTSDAIAVYVQTNAE"
FT   gene            complement(702268..702723)
FT                   /locus_tag="SP_0740"
FT   CDS             complement(702268..702723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0740"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by similarity to EGAD:19249; match to
FT                   protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0740"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74879"
FT                   /protein_id="AAK74879.1"
FT                   /translation="MNRREAVEFVNMCMIKNGDKVLVQDRVNPDWSGITFPGGHVERGE
FT                   SFVDAVIREVKEETGLIISKPQLCGIKNWYDDKDYRYVVLFYKTEHFTGELQSSDEGKV
FT                   WWEDFENLSHLKLATDDMSDMLRVFLEEDLSEFFYYKNGDDWLYDLK"
FT   gene            complement(702743..703918)
FT                   /locus_tag="SP_0741"
FT   CDS             complement(702743..703918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0741"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2293312; match to
FT                   protein family HMM PF03486; match to protein family HMM
FT                   TIGR00275"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0741"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74880"
FT                   /protein_id="AAK74880.1"
FT                   /translation="MKHFDTIVIGGGPAGMMATISSSFYGQKTLLIEKNRKLGKKLAGT
FT                   GGGRCNVTNNGSLDNLLAGIPGNGRFLYSVFSQFDNHDIINFFTENGVKLKVEDHGRVF
FT                   PASDKSRTIIEALEKKITELGGQVATQIEIVSVKKVDDQFVLKSADQTFTCEKLIVTTG
FT                   GKSYPSTGSTGFGHEIARHFKHTITDLEAAESPLLTDFPHKALQGISLDDVTLSYGKHV
FT                   ITHDLLFTHFGLSGPAALRMSSFVKGGEVLSLDVLPQLSEKDLVTFLEENREKSLKNAL
FT                   KTLLPERLAEFFVQGYPEKVKQLTEKEREQLVQSIKELKIPVTGKMSLAKSFVTKGGVS
FT                   LKEINPKTLESKLVPGLHFAGEVMDINAHTGGFNITSALCTGWVAGSLHYD"
FT   gene            complement(703977..704822)
FT                   /locus_tag="SP_0742"
FT   CDS             complement(703977..704822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0742"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4580621; match to
FT                   protein family HMM PF02645"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0742"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74881"
FT                   /db_xref="GOA:Q97RQ6"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RQ6"
FT                   /protein_id="AAK74881.1"
FT                   /translation="MTWKIIADSGCDYRQLPTPAINTTFVSVPLTIQVADQVFVDDASL
FT                   DIDQMMETMYATAEASKSACPSPDDYLRAFEGAKNIFLVTITGTLSGSHNSAQLAKNIY
FT                   LEDHPDTKIHVIDSLSAGGEVDLLVEKLNDLIDQGLSFEEVVEAITAYQEKTKLLFVLA
FT                   KVDNLVKNGRLSKLIGTVVGLLNIRMVGKASETGTLELLQKARGSKKSVQAAYDELVKA
FT                   GYAGGRIVMAQRNNEKCCQQLSERIRETFPQADIKILPTSGLCSFYAEEGGLLMGYEID
FT                   "
FT   gene            704947..705504
FT                   /locus_tag="SP_0743"
FT   CDS             704947..705504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0743"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to SP:P39897; match to
FT                   protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0743"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74882"
FT                   /protein_id="AAK74882.1"
FT                   /translation="MSERRISEKSLENLRKSNQESNLLTREAIETALLQLLEKKELTKI
FT                   SISELVKRAGVSRAAFYRNYDSKEEILESVFKRTVHNIMEQLHHYDLKTDLYLVWVHLF
FT                   REARKEARVIQLALDYHLEKIFVQAMQEFLEKYHGKSKGVSSYLHSFWSSAIVSVLLKW
FT                   IKDGMKVPAEKIADLGLPFFKK"
FT   gene            705523..705990
FT                   /locus_tag="SP_0744"
FT   CDS             705523..705990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0744"
FT                   /product="cytidine and deoxycytidylate deaminase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0744"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74883"
FT                   /protein_id="AAK74883.1"
FT                   /translation="MTEKRLAWDEYFAAQALLIANRSTCKRAKVGAILVKDNKVISTGY
FT                   NGSVSGTEHCIDHECLVIEGHCVRTLHAEVNAILQGAERGVPKGFTAYVTHFPCLNCTK
FT                   QLLQVGCKRVVYINQYRMDDYAQYLYQEKGTELTHLPLETVQTALKEADLM"
FT   gene            706079..706708
FT                   /gene="upp"
FT                   /locus_tag="SP_0745"
FT   CDS             706079..706708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="SP_0745"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="identified by similarity to EGAD:42213; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR01091"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0745"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74884"
FT                   /db_xref="GOA:Q97RQ3"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RQ3"
FT                   /protein_id="AAK74884.1"
FT                   /translation="MGKIEVINHPLIQHKLSILRRTDTSTKAFRELVDEIAMLMGYEVL
FT                   RDLPLEDVEIETPITKTVQKQLAGKKLAIVPILRAGIGMVDGLLNLVPAAKVGHIGMYR
FT                   DEETLQPVEYLVKLPEDIDQRQIFVVDPMLATGGSAILAVDSLKKRGASNIKFVCLVSA
FT                   PEGVKALQEAHPDVEIFTAALDERLNEHGYIVPGLGDAGDRLFGTK"
FT   gene            706882..707472
FT                   /gene="clpP"
FT                   /locus_tag="SP_0746"
FT   CDS             706882..707472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SP_0746"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit"
FT                   /EC_number="3.4.21.92"
FT                   /note="identified by match to protein family HMM PF00574"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0746"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74885"
FT                   /db_xref="GOA:P63787"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63787"
FT                   /protein_id="AAK74885.1"
FT                   /translation="MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQ
FT                   LLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASS
FT                   GAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNTLEKILAENSGQSME
FT                   KVHADAERDNWMSAQETLEYGFIDEIMANNSLN"
FT   gene            complement(707469..707567)
FT                   /locus_tag="SP_0747"
FT   CDS             complement(707469..707567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0747"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0747"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74886"
FT                   /protein_id="AAK74886.1"
FT                   /translation="MTFSNMINPLSKKSLPIIPKKANPVEFAFYHH"
FT   gene            707551..707799
FT                   /locus_tag="SP_0748"
FT   CDS             707551..707799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0748"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108191"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0748"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74887"
FT                   /db_xref="GOA:Q97RQ1"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RQ1"
FT                   /protein_id="AAK74887.1"
FT                   /translation="MFEKVNRSGLIIYLYYNRDAKKLQDYGDITYHSKKHRYLQLYVPT
FT                   QEVEQLVGRLSKEKFIKKVRVCHIQELETPFVGNLYR"
FT   gene            707900..709060
FT                   /gene="livJ"
FT                   /locus_tag="SP_0749"
FT   CDS             707900..709060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livJ"
FT                   /locus_tag="SP_0749"
FT                   /product="branched-chain amino acid ABC transporter, amino
FT                   acid-binding protein"
FT                   /note="identified by similarity to SP:P02917; match to
FT                   protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0749"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74888"
FT                   /protein_id="AAK74888.1"
FT                   /translation="MKKKFALSFVALASVALLAACGEVKSGAVNTAGNSVEEKTIKIGF
FT                   NFEESGSLAAYGTAEQKGAQLAVDEINAAGGIDGKQIEVVDKDNKSETAEAASVTTNLV
FT                   TQSKVSAVVGPATSGATAAAVANATKAGVPLISPSATQDGLTKGQDYLFIGTFQDSFQG
FT                   KIISNYVSEKLNAKKVVLYTDNASDYAKGIAKSFRESYKGEIVADETFVAGDTDFQAAL
FT                   TKMKGKDFDAIVVPGYYNEAGKIVNQARGMGIDKPIVGGDGFNGEEFVQQATAEKASNI
FT                   YFISGFSTTVEVSAKAKAFLDAYRAKYNEEPSTFAALAYDSVHLVANAAKGAKNSGEIK
FT                   NNLAKTKDFEGVTGQTSFDADHNTVKTAYMMTMNNGKVEAAEVVKP"
FT   gene            709328..710197
FT                   /gene="livH"
FT                   /locus_tag="SP_0750"
FT   CDS             709328..710197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livH"
FT                   /locus_tag="SP_0750"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="identified by similarity to EGAD:9658; match to
FT                   protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0750"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74889"
FT                   /protein_id="AAK74889.1"
FT                   /translation="MLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMMGAF
FT                   IGYFLINSFQMNFFVALIVAMLATAILGVVIEFLAYRPLRHSTRIAVLITAIGVSFLLE
FT                   YGMVYLVGANTRAFPQAIQTVRYDLGPISLTNVQLMILAISLILMILLQVIVQKTKMGK
FT                   AMRAVSVDSDAAQLMGINVNRTISFTFALGSALAGAAGVLIALYYNSLEPLMGVTPGLK
FT                   SFVAAVLGGIGIIPGAALGGFVIGLLETFATAFGMSDFRDAIVYGILLLILIVRPAGIL
FT                   GKNVKEKV"
FT   gene            710201..711157
FT                   /gene="livM"
FT                   /locus_tag="SP_0751"
FT   CDS             710201..711157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livM"
FT                   /locus_tag="SP_0751"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="identified by similarity to EGAD:7705; match to
FT                   protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0751"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74890"
FT                   /protein_id="AAK74890.1"
FT                   /translation="MKENLKVNILWLLLLLAGYSLISVLVSVGVLNLFYVQILQQIGIN
FT                   IILAVGLNLIVGFSGQFSLGHAGFMAIGAYAAAIIGSKSPTYGAFFGAMLVGALLSGAV
FT                   ALLVGIPTLRLKGDYLAVATLGVSEIIRIFIINGGSLTNGAAGILGIPNFTTWQMVYFF
FT                   VVITTIATLNFLRSPIGRSTLSVREDEIAAESVGVNTTKIKIIAFVFGAITASIAGSLQ
FT                   AGFIGSVVPKDYTFINSINVLIIVVFGGLGSITGAIVSAIVLGILNMLLQDVASVRMII
FT                   YALALVLVMIFRPGGLLGTWELSLSRFFKKSKKEEQN"
FT   gene            711157..711921
FT                   /gene="livG"
FT                   /locus_tag="SP_0752"
FT   CDS             711157..711921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="SP_0752"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by similarity to EGAD:21366; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0752"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74891"
FT                   /protein_id="AAK74891.1"
FT                   /translation="MALLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTL
FT                   FNLLTGVYEPSEGTVTLDGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFG
FT                   NHHKQHVFTSFLRLPAFYKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIV
FT                   RALATEPKILFLDEPAAGMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERI
FT                   YVLEYGRLIAQGTPDEIKTNKRVIEAYLGGEA"
FT   gene            711921..712631
FT                   /gene="livF"
FT                   /locus_tag="SP_0753"
FT   CDS             711921..712631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="SP_0753"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by similarity to SP:P22731; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0753"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74892"
FT                   /protein_id="AAK74892.1"
FT                   /translation="MSMLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTI
FT                   LRTLSGLVRPSSGKIEFLGQEIQKMPAQKIVASGLSQVPEGRHVFPGLTVMENLEMGAF
FT                   LKKNREENQANLKKVFSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEP
FT                   SMGLAPIFIQEIFDIIQDIQKQGTTVLLIEQNANKALAISDRGYVLETGRIVLSGTGKE
FT                   LASSEEVRKAYLGG"
FT   gene            712939..713595
FT                   /locus_tag="SP_0754"
FT   CDS             712939..713595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0754"
FT                   /product="putative acetoin utilization protein AcuB"
FT                   /note="identified by similarity to EGAD:15842; match to
FT                   protein family HMM PF00571; match to protein family HMM
FT                   PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0754"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74893"
FT                   /protein_id="AAK74893.1"
FT                   /translation="MAVKDFMTRKVVYISPDITVSHAADLMREQGLHRLPVIENDQLVG
FT                   LVTEGTIAQASPSKATSLSIYEMNYLLNKTKVKDVMIRDVVTVSGYASLEDATYLMLKN
FT                   KISILPVVDNHQVYGVITDRDVFQAFLEIAGYGEEGIRVRFVTEDEVGVLGKIVSLIVE
FT                   ENLNISHTVNIPRKDGKVIIEVQIDGSIDLPALKEKFEANGIQVEEIARTSAKVL"
FT   gene            713703..714798
FT                   /gene="prfB"
FT                   /locus_tag="SP_0755"
FT   CDS             join(713703..713774,713776..714798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /gene="prfB"
FT                   /locus_tag="SP_0755"
FT                   /product="peptide chain release factor 2, programmed
FT                   frameshift"
FT                   /note="identified by similarity to EGAD:5932; match to
FT                   protein family HMM PF00472; match to protein family HMM
FT                   PF03462; match to protein family HMM TIGR00020"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75805"
FT                   /db_xref="GOA:Q2MGI2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR020853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2MGI2"
FT                   /protein_id="ABC75805.1"
FT                   /translation="MDISVIRQKIDANREKLASFRGSLDLEGLEEEIAILENKMTEPDF
FT                   WNDNIAAQKTSQELNELKNTYNTFHKMEELQDEVEILLDFLAEDESVHDELVAQLAELD
FT                   KIMTSYEMTLLLSEPYDHNNAILEIHPGSGGTEAQDWGDMLLRMYTRYGNAKGFKVEVL
FT                   DYQAGDEAGIKSVTLSFEGPNAYGLLKSEMGVHRLVRISPFDSAKRRHTSFTSVEVMPE
FT                   LDDTIEVEIREDDIKMDTFRSGGAGGQNVNKVSTGVRLTHIPTGIVVQSTVDRTQYGNR
FT                   DRAMKMLQAKLYQMEQDKKAAEVDSLKGEKKEITWGSQIRSYVFTPYTMVKDHRTSFEV
FT                   AQVDKVMDGDLDGFIDAYLKWRIS"
FT   gene            714816..715508
FT                   /gene="ftsE"
FT                   /locus_tag="SP_0756"
FT   CDS             714816..715508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="SP_0756"
FT                   /product="cell division ABC transporter, ATP-binding
FT                   protein FtsE"
FT                   /note="identified by similarity to EGAD:7038; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR02673"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0756"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74894"
FT                   /protein_id="AAK74894.1"
FT                   /translation="MSIIEMRDVVKKYDNGTTALRGVSVSVQPGEFAYIVGPSGAGKST
FT                   FIRSLYREVKIDKGSLSVAGFNLVKIKKKDVPLLRRSVGVVFQDYKLLPKKTVYENIAY
FT                   AMEVIGENRRNIKRRVMEVLDLVGLKHKVRSFPNELSGGEQQRIAIARAIVNNPKVLIA
FT                   DEPTGNLDPDNSWEIMNLLERINLQGTTILMATHNSQIVNTLRHRVIAIENGRVVRDES
FT                   KGEYGYDD"
FT   gene            715501..716427
FT                   /gene="ftsX"
FT                   /locus_tag="SP_0757"
FT   CDS             715501..716427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="SP_0757"
FT                   /product="cell division ABC transporter, permease protein
FT                   FtsX"
FT                   /note="identified by similarity to EGAD:8574; match to
FT                   protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0757"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74895"
FT                   /protein_id="AAK74895.1"
FT                   /translation="MISRFFRHLFEALKSLKRNGWMTVAAVSSVMITLTLVAIFASVIF
FT                   NTAKLATDIENNVRVVVYIRKDVEDNSQTIEKEGQTVTNNDYHKVYDSLKNMSTVKSVT
FT                   FSSKEEQYEKLTEIMGDNWKIFEGDANPLYDAYIVEANTPNDVKTIAEDAKKIEGVSEV
FT                   QDGGANTERLFKLASFIRVWGLGIAALLIFIAVFLISNTIRITIISRSREIQIMRLVGA
FT                   KNSYIRGPFLLEGAFIGLLGAIAPSVLVFIVYQIVYQSVNKSLVGQNLSMISPDLFSPL
FT                   MIALLFVIGVFIGSLGSGISMRRFLKI"
FT   gene            716713..718893
FT                   /locus_tag="SP_0758"
FT   CDS             716713..718893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0758"
FT                   /product="PTS system, IIABC components"
FT                   /note="identified by similarity to EGAD:6564; match to
FT                   protein family HMM PF00358; match to protein family HMM
FT                   PF00367; match to protein family HMM PF02378; match to
FT                   protein family HMM TIGR00826; match to protein family HMM
FT                   TIGR00830; match to protein family HMM TIGR02003"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0758"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74896"
FT                   /db_xref="GOA:P35595"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011300"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35595"
FT                   /protein_id="AAK74896.1"
FT                   /translation="MMKDTFKNVLSFEFWQKFGKALMVVIAVMPAAGLMISIGKSIVMI
FT                   NPTFAPLVITGGILEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRIT
FT                   GTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAY
FT                   NKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQ
FT                   ETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGAAKGTQVFGQDPLW
FT                   LAWVTDLVNLKGTDASQYQHLLDTVHPARFKVGQMIGSFGILMGVIVAIYRNVDADKKH
FT                   KYKGMMIATALATFLTGVTEPIEYMFMFIATPMYLVYSLVQGAAFAMADVVNLRMHSFG
FT                   SIEFLTRTPIAISAGIGMDIVNFVWVTVLFAVIMYFIANFMIQKFNYATPGRNGNYETA
FT                   EGSEETSSEVKVAAGSQAVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKA
FT                   EGAMGLVMKGQGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKDL
FT                   TEEVYSVADGQVVALEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAF
FT                   GIVTEAGLEVLVHIGLDTVSLEGKPFTVHVAEGQKVAAGDLLVTADLDAIRAAGRETST
FT                   VVVFTNGDAIKSVKLEKTGSLAAKTAVAKVEL"
FT   gene            718899..719018
FT                   /locus_tag="SP_0759"
FT   CDS             718899..719018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0759"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0759"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74897"
FT                   /protein_id="AAK74897.1"
FT                   /translation="MRLEAVFQPLILGEKNEIFNTQYSQLDGERSRGKIPDFA"
FT   gene            719074..719760
FT                   /locus_tag="SP_0760"
FT   CDS             719074..719760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0760"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0760"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74898"
FT                   /protein_id="AAK74898.1"
FT                   /translation="MTSSEVEVNDLYQALPAAEPIHQDHYVRLLVEKLSEQGKNYYWTW
FT                   AYNHIGYNRYHEGVAILSKTPIEAREILVSDVDDPTDYHTRRVALAETVVDGKELAVAS
FT                   VHLSWWDKGFQEEWARFEAVLKKLNKPLLLAGDFNNPAGQEGYQAILASPLGLQDAFEV
FT                   AQEKSGSYTVPPEIDGWKGNTEPLRIDYVFTTKELAVENLHVVFDGNKSPQVSDHYGLN
FT                   AILNWK"
FT   gene            719900..721243
FT                   /locus_tag="SP_0761"
FT   CDS             719900..721243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0761"
FT                   /product="ATP-dependent RNA helicase, DEAD/DEAH box family"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0761"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74899"
FT                   /protein_id="AAK74899.1"
FT                   /translation="MSFTKFQFKNYIREALKELKFTTPTEVQDKLIPIVLAGRDLVGES
FT                   KTGSGKTHTFLLPIFQQLDEASDSVQAVITAPSRELATQIYQVARQISAHSDVEVRVVN
FT                   YVGGTDKARQIEKLASNQPHIVIGTPGRIYDLVKSGDLAIHKAKTFVVDEADMTLDMGF
FT                   LETVDKIAGSLPKDLQFMVFSATIPQKLQPFLKKYLSNPVMEKIKTKTVISDTIDNWLI
FT                   STKGHDKNAQIYQLTQLMQPYLAMIFVNTKTRADELHSYLTAQGLKVAKIHGDIAPRER
FT                   KRIMNQVQNLDFEYIVATDLAARGIDIEGVSHVINDAIPQDLSFFVHRVGRTGRNGLPG
FT                   TAITLYQPSDDSDIRELEKLGIKFSPKMVKDGEFQDTYDRDRRANREKKQDKLDIEMIG
FT                   LVKKKKKKVKPGYKKKIQWAVDEKRRKTKRAENRARGRAERKAKRQTF"
FT   gene            721458..722648
FT                   /gene="metK"
FT                   /locus_tag="SP_0762"
FT   CDS             721458..722648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="SP_0762"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0762"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74900"
FT                   /db_xref="GOA:Q97RN9"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RN9"
FT                   /protein_id="AAK74900.1"
FT                   /translation="MSERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAET
FT                   AVYTGSVHVFGEISTNAYVDINRVVRDTIAEIGYTNTEYGFSAETVGVHPSLVEQSPDI
FT                   AQGVNEALEVRGNADQDPLDLIGAGDQGLMFGFAVDETEELMPLPIALSHKLVRRLAEL
FT                   RKSGEISYLRPDAKSQVTVEYDENDRPVRVDTVVISTQHDPEATNEQIHQDVIDKVIKE
FT                   VIPSSYLDDKTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDAT
FT                   KVDRSASYAARYIAKNIVAADLAKKAEVQLAYAIGVAQPVSVRIDTFGTGTVAESQLEK
FT                   AARQIFDLRPAGIIQMLDLKRPIYRQTSAYGHMGRTDIDLPWERLDKVDALKEAVK"
FT   gene            722939..723067
FT                   /locus_tag="SP_0763"
FT   CDS             722939..723067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0763"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0763"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74901"
FT                   /protein_id="AAK74901.1"
FT                   /translation="MTIARFSRATESWNGLMVEISPCCLDFIQKSVTQALFKLLIH"
FT   gene            723201..724136
FT                   /gene="pyrDA"
FT                   /locus_tag="SP_0764"
FT   CDS             723201..724136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrDA"
FT                   /locus_tag="SP_0764"
FT                   /product="dihydroorotate dehydrogenase A"
FT                   /EC_number="1.3.98.1"
FT                   /note="identified by similarity to EGAD:17787; match to
FT                   protein family HMM PF01180; match to protein family HMM
FT                   TIGR01037"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0764"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74902"
FT                   /db_xref="GOA:Q9X9S0"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X9S0"
FT                   /protein_id="AAK74902.1"
FT                   /translation="MVSTKTQIAGFEFDNCLMNAAGVACMTIEELEEVKNSAAGTFVTK
FT                   TATLDFRQGNPEPRYQDVPLGSINSMGLPNNGLDYYLDYLLDLQEKESNRTFFLSLVGM
FT                   SPEETHTILKKVQESDFRGLTELNLSCPNVPGKPQIAYDFETTDRILAEVFAYFTKPLG
FT                   IKLPPYFDIVHFDQAAAIFNKYPLKFVNCVNSIGNGLYIEDESVVIRPKNGFGGIGGEY
FT                   IKPTALANVHAFYQRLNPQIQIIGTGGVLTGRDAFEHILCGASMVQVGTTLHKEGVSAF
FT                   DRITNELKAIMVEKGYESLEDFRGKLRYID"
FT   gene            724170..725207
FT                   /gene="holA"
FT                   /locus_tag="SP_0765"
FT   CDS             724170..725207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="SP_0765"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /note="identified by match to protein family HMM TIGR01128"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0765"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74903"
FT                   /protein_id="AAK74903.1"
FT                   /translation="MLAIEESQKLTLSNLPSLSLFTGTDQGQFEVMKSQMLKQIGYDSA
FT                   DLNFAYFDMKEVVYKDVELELVSLPFFADEKIVILDYFMDITTAKKRFLTDDELKSFEE
FT                   YLDNPSPTTKLIIFAEGKLDSKRRLVKLLKRDAKAFDAVEVKEQELRQYFQKWSQKQGL
FT                   QFTNHSFENLLIKSGFQFSEIQKNLLFLQSYKANSVIEEEDIVNAIPKTLQDNIFDLTQ
FT                   FILTKKMDQARDLVRDLTLQGEDEIKLIAVMLGQFRTFTQVKILAESGQTESQIASSLG
FT                   SYLGRNPNPYQIKFALRDSRGLSLSFLKQAISYLIETDYQIKTGLYEKGFLFEKALLQI
FT                   ASQVN"
FT   gene            725380..725985
FT                   /gene="sodA"
FT                   /locus_tag="SP_0766"
FT   CDS             725380..725985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="SP_0766"
FT                   /product="superoxide dismutase, manganese-dependent"
FT                   /EC_number="1.15.1.1"
FT                   /note="identified by similarity to GP:5758312; match to
FT                   protein family HMM PF00081; match to protein family HMM
FT                   PF02777"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0766"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74904"
FT                   /db_xref="GOA:P0A4J6"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4J6"
FT                   /protein_id="AAK74904.1"
FT                   /translation="MAIILPELPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEK
FT                   HPEIGEDLEALLADVESIPADIRQALINNGGGHLNHALFWELMTPEKTAPSAELAAAID
FT                   ATFGSFEEFQAAFTAAATTRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKKPILGLD
FT                   VWEHAYYVKYRNVRPDYIKAFFSVINWNKVDELYAAAK"
FT   gene            726141..726653
FT                   /locus_tag="SP_0767"
FT   CDS             726141..726653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0767"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108986; match to
FT                   protein family HMM PF06265"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0767"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74905"
FT                   /protein_id="AAK74905.1"
FT                   /translation="MRKEIAPELYNYNKFPGPEFHLHGDKVETEGIAFSLVENIKDAFD
FT                   VTTFNQRFSEVLTKFDYIVGDWSNEQLRLRGFYKDDRTEEKLEKISRLQDYLLEYCSYG
FT                   CAYFVLENEAPKRASFDKKMRKTEEETPSRKGKKPTQTKRKSNADKKNRRRQKDDKGQR
FT                   HFVIRQK"
FT   gene            726674..727759
FT                   /locus_tag="SP_0768"
FT   CDS             726674..727759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0768"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108261; match to
FT                   protein family HMM PF04055; match to protein family HMM
FT                   TIGR00048"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0768"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74906"
FT                   /db_xref="GOA:Q97RN5"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RN5"
FT                   /protein_id="AAK74906.1"
FT                   /translation="MKPSIHSLVHQTMQEWVLEQGEKKFRADQIWEWLYRKRVQSFEEM
FT                   TNLSKDLIAKLNDQFVVNPLKQRIVQESADGTVKYLFELPDGMLIETVLMRQHYGLSVC
FT                   VTTQVGCNIGCTFCASGLIKKQRDLNNGEIVAQIMLVQKYFDERGQDERISHIVVMGIG
FT                   EPFDNYNNVLNFFRTINDDKGMAIGARHITVSTSGLAHKIRDFADEGVQVNLAVSLHAP
FT                   NNELRSSIMKINRAFPIEKLFAAIEYYIETTNRRVTFEYIMLNEVNDGVEQALELTELL
FT                   KNIKKLSYVNLIPYNPVSEHDQYSRSPKECVLAFYDTLKKKGVNCVVRQEHGTDIDAAC
FT                   GQLRSNTMKRDRQKAVAAVNP"
FT   gene            727762..728241
FT                   /locus_tag="SP_0769"
FT   CDS             727762..728241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0769"
FT                   /product="VanZF-related protein"
FT                   /note="identified by similarity to GP:7110140; match to
FT                   protein family HMM PF04892"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0769"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74907"
FT                   /protein_id="AAK74907.1"
FT                   /translation="MKKTYNHILVWGVIFYSICIVCFCFTPQEQSTVGVGTPGIQHLGR
FT                   LVFLLTPFNSLWKLGEVSDIGQLCWIFLQNILNVFLFFPLIFQLLYLFPNLRKTKKVLL
FT                   FSFLVSLGIECTQLILDFFFDFNRVFEIDDLWTNTLGGYLAWLLYKRLHKNKVRN"
FT   gene            728243..729784
FT                   /locus_tag="SP_0770"
FT   CDS             728243..729784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0770"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0770"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74908"
FT                   /protein_id="AAK74908.1"
FT                   /translation="MSILEVKNLSHGFGDRAIFEDVSFRLLKGEHIGLVGANGEGKSTF
FT                   MSIVTGKMLPDEGKVEWSKYVTAGYLDQHSVLAERQSVRDVLRTAFDELFKAEARINDL
FT                   YMKMAEDGADVDALMEEVGELQDRLESRDFYTLDAKIDEVARALGVMDFGMDTDVTSLS
FT                   GGQRTKVLLAKLLLEKPDILLLDEPTNYLDAEHIDWLKRYLQNYENAFVLISHDIPFLN
FT                   DVINIVYHVENQQLTRYSGDYYQFQEVYAMKKSQLEAAYERQQKEIADLKDFVARNKAR
FT                   VATRNMAMSRQKKLDKMDIIELQSEKPKPSFDFKPARTPGRFIFQAKNLQIGYDRPLTK
FT                   PLNLTFERNQKVAIIGANGIGKTTLLKSLLGIISPIAGEVERGDYLELGYFEQEVEGGN
FT                   RQTPLEAVWNAFPALNQAEVRAALARCGLTTKHIESQIQVLSGGEQAKVRFCLLMNREN
FT                   NVLVLDEPTNHLDVDAKDELKRALKEYRGSILMVCHEPDFYEGWIDQIWDFNNLT"
FT   gene            complement(729840..730643)
FT                   /locus_tag="SP_0771"
FT   CDS             complement(729840..730643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0771"
FT                   /product="peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin-type"
FT                   /note="identified by similarity to GP:3169061; match to
FT                   protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0771"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74909"
FT                   /protein_id="AAK74909.1"
FT                   /translation="MKKLATLLLLSTVALAGCSSVQRSLRGDDYVDSSLAAEESSKVAA
FT                   QSAKELNDALTNENANFPQLSKEVAEDEAEVIFHTSQGDIRIKLFPKLAPLAVENFLTH
FT                   AKEGYYNGITFHRVIDGFMVQTGDPKGDGTGGQSIWHDKDKTKDKGTGFKNEITPYLYN
FT                   IRGALAMANTGQPNTNGSQFFINQNSTDTSSKLPTSKYPQKIIEAYKEGGNPSLDGKHP
FT                   VFGQVIDGMDVVDKIAKAEKDEKDKPTTAITIDSIEVVKDYDFKS"
FT   gene            complement(730727..730930)
FT                   /locus_tag="SP_0772"
FT   CDS             complement(730727..730930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0772"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0772"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74910"
FT                   /protein_id="AAK74910.1"
FT                   /translation="MDFFYNGIAITPNTYLSAWFVNFIAALPLNFLIVEPIARFILSSF
FT                   QKPFTGEEVEDFQDDDEIPTII"
FT   gene            731337..731435
FT                   /locus_tag="SP_0773"
FT   CDS             731337..731435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0773"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0773"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74911"
FT                   /protein_id="AAK74911.1"
FT                   /translation="MKIYFLKKWENIDSKRILNHIRMGVFKIMFQW"
FT   gene            complement(731419..731628)
FT                   /locus_tag="SP_0774"
FT   CDS             complement(731419..731628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0774"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0774"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74912"
FT                   /protein_id="AAK74912.1"
FT                   /translation="MLSVNTILEKFYKEHQVKPFISPERELDTWLLSPKPVPKRNMDLL
FT                   VDDSLAGDIILLWRIQFGTFTTET"
FT   gene            731798..732070
FT                   /gene="rpsP"
FT                   /locus_tag="SP_0775"
FT   CDS             731798..732070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="SP_0775"
FT                   /product="ribosomal protein S16"
FT                   /note="identified by match to protein family HMM PF00886;
FT                   match to protein family HMM TIGR00002"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0775"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74913"
FT                   /db_xref="GOA:P66444"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66444"
FT                   /protein_id="AAK74913.1"
FT                   /translation="MAVKIRLTRMGSKKKPFYRINVADSRSPRDGRFIETVGTYNPLVA
FT                   ENQVTLKEDRVLAWLANGAQPSDTVRNILSKEGVLKKFHDSKFSK"
FT   gene            732090..732329
FT                   /locus_tag="SP_0776"
FT   CDS             732090..732329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0776"
FT                   /product="KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0776"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74914"
FT                   /protein_id="AAK74914.1"
FT                   /translation="MDTIENLIIAIVKPLISQPDALTIKIEDTPEFLEYHLNLDQSDVG
FT                   RVIGRKGRTISAIRTIVYSVPTEYKKVRIVIDEK"
FT   gene            732894..733694
FT                   /locus_tag="SP_0777"
FT   CDS             732894..733694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0777"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0777"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74915"
FT                   /protein_id="AAK74915.1"
FT                   /translation="MDFFMKRFEVSTEIGSLSVTYQKQKKVLVCLNGAGLLPSYENFSL
FT                   ILEKPPPTIGYLTIDFPNTGRSPIHDQAGKNLDNLADAVYEVLEELGISEYILCAHSWS
FT                   GILACKLLEKPIKRQTLVAIEPTTKKVMFADFSENPYPEMEEQMRLIDECGPELYFKNL
FT                   TQATFSPETNKKIWELMQEKGLELENQDPEFQISGEITEEDFEDVSIEAHIPVFVFCQP
FT                   YREKEYRESEYWTSNTKLILGGNHHYLQWSESEKIAAIIRELLE"
FT   gene            733725..734243
FT                   /gene="rimM"
FT                   /locus_tag="SP_0778"
FT   CDS             733725..734243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="SP_0778"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="identified by similarity to EGAD:10765; match to
FT                   protein family HMM PF01782; match to protein family HMM
FT                   PF05239; match to protein family HMM TIGR02273"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0778"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74916"
FT                   /db_xref="GOA:Q97RM5"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RM5"
FT                   /protein_id="AAK74916.1"
FT                   /translation="MNYFNVGKIVNTQGLQGEMRVLSVTDFAEERFKKGAELVLFDEKD
FT                   QFVQTVTIASHRKQKNFDIIKFKDMYHINTIEKYKGYSLKVAEEDLNDLDDGEFYYHEI
FT                   IGLEVYEGDSLVGTIKEILQPGANDVWVVKRKGKRDLLLPYIPPVVLNVDIPSKRVDVE
FT                   ILEGLDDED"
FT   gene            734233..734952
FT                   /gene="trmD"
FT                   /locus_tag="SP_0779"
FT   CDS             734233..734952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="SP_0779"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="identified by similarity to EGAD:10848; match to
FT                   protein family HMM PF01746; match to protein family HMM
FT                   TIGR00088"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0779"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74917"
FT                   /db_xref="GOA:Q97RM4"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RM4"
FT                   /protein_id="AAK74917.1"
FT                   /translation="MKIDILTLFPEMFSPLEHSIVGKAREKGLLDIQYHNFRENAEKAR
FT                   HVDDEPYGGGQGMLLRAQPIFDSFDAIEKKNPRVILLDPAGKQFDQAYAEDLAQEEELI
FT                   FICGHYEGYDERIKTLVTDEISLGDYVLTGGELAAMTMIDATVRLIPEVIGKESSHQDD
FT                   SFSSGLLEYPQYTRPYDYRGMVVPDVLMSGHHEKIRQWRLYESLKKTYERRPDLLEHYQ
FT                   LTVEEEKMLAEIKENKE"
FT   gene            734964..735302
FT                   /locus_tag="SP_0780"
FT   CDS             734964..735302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0780"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit, truncation"
FT                   /note="identified by similarity to EGAD:168576; match to
FT                   protein family HMM PF03477"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75778"
FT                   /protein_id="ABC75778.1"
FT                   /translation="MQVIKRNGEIAEFNPDKIYQAILKAAQTVYVLTDDLRQNLAQVTK
FT                   KVVLDLQEAKVERATISMIQSMVEHRLLGAGYITIAEHYISYRLQRDLERSGYGDHIAV
FT                   HLHFEQIR"
FT   gene            complement(735333..735653)
FT                   /locus_tag="SP_0781"
FT   CDS             complement(735333..735653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0781"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0781"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74918"
FT                   /protein_id="AAK74918.1"
FT                   /translation="MRHKFQQVLNKIHDFLNGYDQPDQTETNSLTATIEEAIQKQTAVH
FT                   LILSETSFTGDIIKYDQQGQQIIVKNFSKNVSRIIRISDIQRLRFVPSTVQTAQKNRFK
FT                   KE"
FT   gene            735727..735966
FT                   /locus_tag="SP_0782"
FT   CDS             735727..735966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0782"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:157679"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0782"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74919"
FT                   /protein_id="AAK74919.1"
FT                   /translation="MKLKKEKKMAEFTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAK
FT                   FDIRAWSPDHTKMGKGITLSNEEFQTMVDAFKGN"
FT   gene            complement(736172..736708)
FT                   /locus_tag="SP_0783"
FT   CDS             complement(736172..736708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0783"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:165178; match to
FT                   protein family HMM PF02632"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0783"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74920"
FT                   /protein_id="AAK74920.1"
FT                   /translation="MKKAHVYAIPAIGAALIAALAQISLPIGPVPFTLQNFAIGLIATV
FT                   FRPREAVLSAGLYLLLGAIGLPVFAGGGAGFQALVGPTAGYLWFYLVYSGLTSSLTNSK
FT                   SGVVKIFLANLLGDALVFVGGILSLHFLAGMAFEKALAVGVLPFIIPDLGKLLAISFIS
FT                   RPLLQRLKNQAYFTN"
FT   gene            complement(736905..738251)
FT                   /gene="gor"
FT                   /locus_tag="SP_0784"
FT   CDS             complement(736905..738251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="SP_0784"
FT                   /product="glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="identified by similarity to EGAD:22912; match to
FT                   protein family HMM PF00070; match to protein family HMM
FT                   PF02852; match to protein family HMM PF07992; match to
FT                   protein family HMM TIGR01421"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0784"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74921"
FT                   /protein_id="AAK74921.1"
FT                   /translation="MREYDIIAIGGGSGGIATMNRAGEHGAKAAVIEEKKLGGTCVNVG
FT                   CVPKKIMWYGAQIAETFHQFGEDYGFKTTDLNFDFATLRRNREAYIDRARSSYDGSFKR
FT                   NGVDLIEGHAEFVDSHTVSVNGELIRAKHIVIATGAHPSIPNIPGAELGGSSDDVFAWE
FT                   ELPESIAILGAGYIAVELAGVLHTFGVKTDLFVRRDRPLRGFDSYIVEGLVKEMERTNL
FT                   PLHTHKVPVKLEKTTDGITIHFEDGTSHTASQVIWATGRRPNVKGLQLEKAGVTLNERG
FT                   FIQVDEYQNTVVEGIYALGDVTGEKELTPVAIKAGRTLSERLFNGKTTAKMDYSTIPTV
FT                   VFSHPAIGTVGLTEEQAIKEYGQDQIKVYKSSFASMYSACTCNRQESRFKLITAGSEEK
FT                   VVGLHGIGYGVDEMIQGFAVAIKMGATKADFDATVAIHPTASEEFVTMR"
FT   gene            738516..739715
FT                   /locus_tag="SP_0785"
FT   CDS             738516..739715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0785"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2822198; match to
FT                   protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0785"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74922"
FT                   /protein_id="AAK74922.1"
FT                   /translation="MKKKNGKAKKWQLYAAIGAASVVVLGAGGILLFRQPSQTALKDEP
FT                   THLVVAKEGSVASSVLLSGTVTAKNEQYVYFDASKGDLDEILVSVGDKVSEGQALVKYS
FT                   SSEAQAAYDSASRAVARADRHINELNQARNEAASAPAPQLPAPVGGEDATVQSPTPVAG
FT                   NSVASIDAQLGDARDARADAAAQLSKAQSQLDATTVLSTLEGTVVEVNSNVSKSPTGAS
FT                   QVMVHIVSNENLQVKGELSEYNLANLSVGQEVSFTSKVYPDKKWTGKLSYISDYPKNNG
FT                   EAASPAAGNNTGSKYPYTIDVTGEVGDLKQGFSVNIEVKSKTKAILVPVSSLVMDDSKN
FT                   YVWIVDEQQKAKKVEVSLGNADAENQEITSGLTNGAKVISNPTSSLEEGKEVKADEATN
FT                   "
FT   gene            739699..740400
FT                   /locus_tag="SP_0786"
FT   CDS             739699..740400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0786"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to GP:2822199; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0786"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74923"
FT                   /protein_id="AAK74923.1"
FT                   /translation="MKQLISLKNIFRSYRNGDQELQVLKNINLEVNEGEFVAIMGPSGS
FT                   GKSTLMNTIGMLDTPTSGEYYLEGQEVAGLGEKQLAKVRNQQIGFVFQQFFLLSKLNAL
FT                   QNVELPLIYAGVSSSKRRKLAEEYLDKVELTERSHHLPSELSGGQKQRVAIARALVNNP
FT                   SIILADEPTGALDTKTGNQIMQLLVDLNKEGKTIIMVTHEPEIAAYAKRQIVIRDGVIS
FT                   SDSAQLGKEEN"
FT   gene            740402..741661
FT                   /locus_tag="SP_0787"
FT   CDS             740402..741661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0787"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:107872; match to
FT                   protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0787"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74924"
FT                   /protein_id="AAK74924.1"
FT                   /translation="MQNLKFAFSSIMAHKMRSLLTMIGIIIGVSSVVVIMALGDSLSRQ
FT                   VNKDMTKSQKNISVFFSPKKSKDGSFTQKQSAFTVSGKEEEVPVEPPKPQESWVQEAAK
FT                   LKGVDSYYVTNSTNAILTYQDKKVENANLTGGNRTYMDAVKNEIIAGRSLREQDFKEFA
FT                   SVILLDEELSISLFESPQEAINKVVEVNGFSYRVIGVYTSPEAKRSKIYGFGGLPITTN
FT                   ISLAANFNVDEIANIVFRVNDTSLTPTLGPELARKMTELAGLQQGEYQVADESVVFAEI
FT                   QQSFSFMTTIISSIAGISLFVGGTGVMNIMLVSVTERTREIGLRKALGATRANILIQFL
FT                   IESMILTLLGGLIGLTIASGLTALAGLLLQGLIEGIEVGVSIPVALFSLAVSASVGMIF
FT                   GVLPANKASKLDPIEALRYE"
FT   gene            741785..743782
FT                   /gene="metG"
FT                   /locus_tag="SP_0788"
FT   CDS             741785..743782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="SP_0788"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF01588; match to protein
FT                   family HMM TIGR00398; match to protein family HMM
FT                   TIGR00399"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0788"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74925"
FT                   /db_xref="GOA:P67580"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67580"
FT                   /protein_id="AAK74925.1"
FT                   /translation="MSEKNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVF
FT                   YLTGLDEHGQKIQQKAEEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKV
FT                   VAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVE
FT                   WVSEESYFLRLSKYQDRLVEFFKAHPEFITPDGRLNEMLRNFIEPGLEDLAVSRTTFTW
FT                   GVPVPSNPKHVVYVWIDALLNYATALGYAQDEHGNFDKFWNGTVFHMVGKDILRFHSIY
FT                   WPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNL
FT                   PVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLA
FT                   EVAEQSIADFHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVM
FT                   SHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEVSSLENLSLADFPADVTVVAKGTPIF
FT                   PRLNMEEEIAYIKEQMEGNKPAVEKEWNPDEVELKLNKDEIKFEDFDKVEIRVAEVKEV
FT                   SKVEGSDKLLQFRLDAGDGEDRQILSGIAKYYPNEQELVGKKVQIVANLKPRKMMKKYV
FT                   SQGMILSAEHDGKLTLLTVDPAVPNGSVIG"
FT   gene            744248..744568
FT                   /locus_tag="SP_0789"
FT   CDS             744248..744568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0789"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0789"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74926"
FT                   /protein_id="AAK74926.1"
FT                   /translation="MKETQLLKGVLEGCVLDMIGQKERYGYELVQTLREAGFDTIVPGT
FT                   IYPLLQKLEKNQWIRGDMRPSPDGPDRKYFSLMKEGEERVSVFWQQWDDLSQKVEGIKN
FT                   GG"
FT   gene            744572..745387
FT                   /locus_tag="SP_0790"
FT   CDS             744572..745387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0790"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:3582248"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0790"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74927"
FT                   /protein_id="AAK74927.1"
FT                   /translation="MKKMKYYEETSALLHEFSEENQKYFEELWESFNLAGFLYDEDYLR
FT                   EQIYLMMLDFSEAERDGMSAEDYLGKNPKKIMKEILKGAPRSSIKESLLTPILVLAVLR
FT                   YYQLLSDFSKGPLLTVNLLTFLGQLLIFLIGFGLVATILRRSLVQDSPKMKIGTYIVVG
FT                   TIVLLVVLGYVGMASFIQEGAFYIPAPWDSLSVFTISLVIGIWNWKEAVFRPFVSMIIA
FT                   HLVVGSLLRYYEWMGISNVFLTKVIPLAVLFIGIFVLFRGFKKIKWSEV"
FT   gene            745462..746388
FT                   /locus_tag="SP_0791"
FT   CDS             745462..746388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0791"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by similarity to EGAD:90687; match to
FT                   protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0791"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74928"
FT                   /protein_id="AAK74928.1"
FT                   /translation="MRYITLGQDDKELSEIVLGMMRIKDKSVKEVEELVETALSVGINA
FT                   FDLADIYGRGRCEELLGLVLKNRPDLREKMWIQSKCGIRIEEFTYFDFSKDYIIKSVDG
FT                   ILQRLKIDHLDSLLLHRPDALMESDQVAEAFNLLYKQGKVRDFGVSNQNPMMMELLKKD
FT                   VKQPLAVNQLQLSAAFTPGFESAFHVNMEDSQAAMRDGSIFEYCQLHDVVIQAWSVLQF
FT                   GYFKGNFVGNEKFQALNQVLDRLAIKYGVTSSTIAISWILRYPAKMQAVVGTTNPKHLR
FT                   EVSRAANFSLTRKEWYEIYLAAGNNLP"
FT   gene            746454..746720
FT                   /locus_tag="SP_0792"
FT   CDS             746454..746720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0792"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0792"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74929"
FT                   /protein_id="AAK74929.1"
FT                   /translation="MKNVELKEKNMTFEEILPGLKAKRKYVRTGWGGAENYVQLFDTIE
FT                   QNGLALEMTPYFLINVSGEGEGFSMWSPTVCDVLATDWVEVHD"
FT   gene            746713..747411
FT                   /locus_tag="SP_0793"
FT   CDS             746713..747411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0793"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0793"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74930"
FT                   /protein_id="AAK74930.1"
FT                   /translation="MTKRVLITGVSSGIGLAQARLFLEKGYQVYGVDQGEKPLLEGDFR
FT                   FLQRDLTLDLEPIFDWCPQVDVLCNTAGVLDDYKPLLEQTAQDIQEIFEINYIIPVELT
FT                   RYYLTQMLENKKGIIINMCSIASSLAGGGGHAYTSSKHALAGFTKQLALDYAEAGIQVF
FT                   GIAPGAVKTAMTAADFEPGGLADWVASETPIKRWIEPEEIAELSLFLASGKASAMQGQI
FT                   LTIDGGWSLK"
FT   gene            747422..747922
FT                   /locus_tag="SP_0794"
FT   CDS             747422..747922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0794"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0794"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74931"
FT                   /protein_id="AAK74931.1"
FT                   /translation="MEIKNHFGVYCVCFENGKLLCIEKTRGPYQHRYDLPGGSQQLGEG
FT                   LTETLTREVMEETGFTVRSYSNPRIYDVFVREELKNFMVHHVIALYDVEMNESAPQVTI
FT                   SEAVSDGANDSLGYIWMDIQEITEENASPLVLKVKSELLGFPELDKTSYMNWKVNDEKS
FT                   TCP"
FT   gene            747975..748769
FT                   /locus_tag="SP_0795"
FT   CDS             747975..748769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0795"
FT                   /product="PEP-utilizing enzymes family protein"
FT                   /note="identified by match to protein family HMM PF02896"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0795"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74932"
FT                   /protein_id="AAK74932.1"
FT                   /translation="MIRGEYLLRELNQNILLQSCQEFVKDYLDTICSFYLGKEVWYRFT
FT                   ELTNTEANCLVGTKEFFDEGHPLFGYRGTRRLLACLDEFQAEAHVVTEVYQTNPNLSVI
FT                   FPFVNDADQLKQAITVLRQQGFTGKVGTMIELPSAYFDLSSILETGISKIVVGMNDLTS
FT                   FVFATMRNSQWHDMESPIMLDMLRDMQDKARKNKIDFAVAGYLNTSFIQKMNQLGIKCI
FT                   IHYSSIPEIFDLEIDHPDHLKHIKEESKKLQRSTHDTARNVE"
FT   gene            748744..749184
FT                   /locus_tag="SP_0796"
FT   CDS             748744..749184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0796"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:3449253; match to
FT                   protein family HMM PF06171"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0796"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74933"
FT                   /protein_id="AAK74933.1"
FT                   /translation="MIPQEMWNKYKQINPLIGDEIDAWAFGVEPDLLADLVFKGEKTAT
FT                   ASAYDLYVLEDEPLPQVGTFDVILDSQNQAVCIVEITKVSVKPFNRVSADHAYKEGEGN
FT                   KTLVYWRQVHEDFFRDCLGEAGLTFTPESKVVLEEFRKVYPL"
FT   gene            749307..751853
FT                   /gene="pepN"
FT                   /locus_tag="SP_0797"
FT   CDS             749307..751853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="SP_0797"
FT                   /product="aminopeptidase N"
FT                   /EC_number="3.4.11.2"
FT                   /note="identified by similarity to GP:5524752; match to
FT                   protein family HMM PF01433"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0797"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74934"
FT                   /protein_id="AAK74934.1"
FT                   /translation="MQAVEHFIKQFVPEHYDLFLDLSRETKTFSGKVTITGQAQSDRIS
FT                   LHQKDLEITSVEVAGQARPFTVDHDNEALHIELAEAGQVELVLAFSGKITDNMTGIYPS
FT                   YYTVDGVKKEVLSTQFESHFAREAFPCVDEPEAKATFDLSLRFDQAEGELALSNMPEID
FT                   VENRKETGIWKFETTPRMSSYLLAFVAGDLQGVTAKTKNGTLVGVYSTKAHPLSNLDFS
FT                   LDIAVRSIEFYEDYYGVKYPIPQSLHIALPDFSAGAMENWGLVTYREVYLVVDENSTFA
FT                   SRQQVALVVAHELAHQWFGNLVTMKWWDDLWLNESFANMMEYVCVDTIEPSWNIFEDFQ
FT                   TGGVPLALERDATDGVQSVHVEVKHPDEINTLFDGAIVYAKGSRLMHMLRRWLGDADFA
FT                   KGLHAYFEKHQYSNTIGSDLWDALGQASGRDVAAFMDSWLEQPGYPVLTVKVENDVLKI
FT                   SQKQFFIGENEDKNRLWVVPLNSNWKGLPDTLETESIEIPGYAALLAENEGALRLNTEN
FT                   TAHYITDYQGDLLAAVLAELETLDNTSKLQIVQERRLLAEAGHISYADLLPVLDKLAKE
FT                   ESYLVVSAVSQVISALERFIDEGTDAETAFKGLVAKLARHNYDRLGFEAKDGESDEDEL
FT                   VRQLAVSMMIRSNDAEASQVASQIFATHKENLAGLPAAIRSQVLINEMKHHETKDLLAL
FT                   YLDTYTHATDAVFKRQLAAALAYSTDADNIQNLITSWKDKFVVKPQDLSAWYYQFLAHQ
FT                   ATQKTAWSWARENWAWIKAALGGDMSFDSFVILPAHVFKTQQRLAEYKEFFEPQLSDLA
FT                   LSRNIGMGIKEIAARVDLISREKAAVEAVVLQYGNA"
FT   gene            751962..752636
FT                   /gene="ciaR"
FT                   /locus_tag="SP_0798"
FT   CDS             751962..752636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ciaR"
FT                   /locus_tag="SP_0798"
FT                   /product="DNA-binding response regulator CiaR"
FT                   /note="identified by similarity to EGAD:15562; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0798"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74935"
FT                   /db_xref="GOA:P0A4H7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4H7"
FT                   /protein_id="AAK74935.1"
FT                   /translation="MIKILLVEDDLGLSNSVFDFLDDFADVMQVFDGEEGLYEAESGVY
FT                   DLILLDLMLPEKNGFQVLKELREKGITTPVLIMTAKESLDDKGHGFELGADDYLTKPFY
FT                   LEELKMRIQALLKRSGKFNENTLTYGNIVVNLSTNTVKVEDTPVELLGKEFDLLVYFLQ
FT                   NQNVILPKTQIFDRLWGFDSDTTISVVEVYVSKVRKKLKGTTFAENLQTLRSVGYLLKD
FT                   VQ"
FT   gene            752626..753960
FT                   /gene="ciaH"
FT                   /locus_tag="SP_0799"
FT   CDS             752626..753960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ciaH"
FT                   /locus_tag="SP_0799"
FT                   /product="sensor histidine kinase CiaH"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by similarity to EGAD:14891; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0799"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74936"
FT                   /db_xref="GOA:P0A4I5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4I5"
FT                   /protein_id="AAK74936.1"
FT                   /translation="MFSKLKKTWYADDFSYFIRNFGVFTLIFSTMTLIILQVMHSSLYT
FT                   SVDDKLHGLSENPQAVIQLAINRATEEIKDLENARADASKVEIKPNVSSNTEVILFDKD
FT                   FTQLLSGNRFLGLDKIKLEKKELGHIYQIQVFNSYGQEEIYRVILMETNISSVSTNIKY
FT                   AAVLINTSQLEQASQKHEQLIVVVMASFWILSLLASLYLARVSVRPLLESMQKQQSFVE
FT                   NASHELRTPLAVLQNRLETLFRKPEATIMDVSESIASSLEEVRNMRFLTTSLLNLARRD
FT                   DGIKPELAEVPTSFFNTTFTNYEMIASENNRVFRFENRIHRTIVTDQLLLKQLMTILFD
FT                   NAVKYTEEDGEIDFLISATDRNLYLLVSDNGIGISTEDKKKIFDRFYRVDKARTRQKGG
FT                   FGLGLSLAKQIVDALKGTVTVKDNKPKGTIFEVKIAIQTPSKKKK"
FT   gene            complement(753994..754281)
FT                   /locus_tag="SP_0800"
FT   CDS             complement(753994..754281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0800"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0800"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74937"
FT                   /protein_id="AAK74937.1"
FT                   /translation="MPVRKLQSYEVDYQEELNQQLPHYQAYTPEAQSDANLKEILFFIN
FT                   IAVFCICIAIFSFIFLALKLSTALAFAAAIGFSLLVLKVQRSIIKRKRRR"
FT   gene            754280..755350
FT                   /locus_tag="SP_0801"
FT   CDS             754280..755350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0801"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:110011; match to
FT                   protein family HMM PF01136"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0801"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74938"
FT                   /protein_id="AAK74938.1"
FT                   /translation="MILSLTVHTYFIIFSAENYYRKVTKRIKSLFIFKAWLILEKCGII
FT                   FLMEKIVITATAESIEQVEQLLEAGVDRIYVGEKDFGLRLPTTFSYDQLREIAKLVHDA
FT                   GKELIVAVNALMHQDMMDRIKPFLNFLEEIKTDYITIGDAGVFYVVNRDGYSFKTIYDA
FT                   STMVTSSRQINFWGQKAGASEAVLAREIPSAELFKMPEILEIPAEVLVYGASVIHHSKR
FT                   PLLQNYYNFTHIDDEKTHKRDLFLAEPSDPESHYSIFEDNHGTHIFANNDLDLMIKLTE
FT                   LVEHGFTRWKLEGLYTPGQNFVEIAKLFIQARSLIQEGNFSHAQAFLLDEEVRKLHPKN
FT                   RFLDTGFYDYDPDMVR"
FT   gene            755550..758000
FT                   /locus_tag="SP_0802"
FT   CDS             755550..758000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0802"
FT                   /product="DNA polymerase III, epsilon subunit/ATP-dependent
FT                   helicase DinG"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM TIGR00573; match to protein
FT                   family HMM TIGR01407"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0802"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74939"
FT                   /protein_id="AAK74939.1"
FT                   /translation="MKTIGNRYVVVDLEATSTGSKAKIIQVGIVVIEDGEIVDHYTTDV
FT                   NPHEPLDAHIKELTGLTDQRLAQAPDFSQVARKIFDLVEDGIFVAHNVQFDANLLAENL
FT                   FFEGYELRNPRVDTVELAQVFFPELEKYSLPILCRELGIPLKHAHTALSDAQATAELLL
FT                   FLRKKMTQLPKGLLERLLEMADALLYESYLVIEETYRNQSILSSPDLVQVQGLYFKKTE
FT                   ASLEPRKLSQDFSKNISLLNLEVREEQESFAKEVGLLLKDEPVSLIQAPTGIGKTYGYL
FT                   LPALSQSKERQIVLSVPTKILQNQIMEEEGKRLKEVFHTDIHSLKGPQNYLKLDAFYHS
FT                   LQENDENRLFRRFKMQVLVWLTETETGDLDEIGQLYRYQHFLADLRHDGNLSSQSLFVT
FT                   EDFWKRSQERAETCKLLVTNHAYLVTRLEDNPEFVSDRLLIIDEVQKILLALENLLQET
FT                   YDIQSIIDLIDKALVGEENRVQQRILESIRFECLYLIEQFQSGKSRKNILDSLDNLHQY
FT                   FSELEVEDFDELVRYFTAEGDYWLEVTETSQKKIQISSTKSGRTLLSSLLPESCQVLGV
FT                   SATLEISQRVSLADLLGYPEAKFVKIESRGKQEQEVVMVKDFPLVTETSLEVYAREVAA
FT                   LLVEIQAFQQPILVLFTAKDMLLAVSDLLTVSHLAQYKNGDVHQLKKRFEKGEQQILLG
FT                   AASFWEGVDFSSHPSVIQVVPRLPFQNPQEPLTKKINQELNQEGKNAFYDYQLPMAIIR
FT                   LKQALGRSMRREYQRSLTLILDRRIVGKRYGKQIVASLAEEATVKTISRSEVDEAIDRF
FT                   FNEL"
FT   gene            758037..759260
FT                   /locus_tag="SP_0803"
FT   CDS             758037..759260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0803"
FT                   /product="putative rod shape-determining protein RodA"
FT                   /note="identified by similarity to EGAD:21935; match to
FT                   protein family HMM PF01098"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0803"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74940"
FT                   /protein_id="AAK74940.1"
FT                   /translation="MKRSLDSRVDYSLLLPVFFLLVIGVVAIYIAVSHDYPNNILPILG
FT                   QQVAWIALGLVIGFVVMLFNTEFLWKVTPFLYILGLGLMILPIVFYNPSLVASTGAKNW
FT                   VSINGITLFQPSEFMKISYILMLARVIVQFTKKHKEWRRTVPLDFLLIFWMILFTIPVL
FT                   VLLALQSDLGTALVFVAIFSGIVLLSGVSWKIIIPVFVTAVTGVAGFLAIFISKDGRAF
FT                   LHQIGMPTYQINRILAWLNPFEFAQTTTYQQAQGQIAIGSGGLFGQGFNASNLLIPVRE
FT                   SDMIFTVIAEDFGFIGSVLVIALYLMLIYRMLKITLKSNNQFYTYISTGLIMMLLFHIF
FT                   ENIGAVTGLLPLTGIPLPFISQGGSAIISNLIGVGLLLSMSYQTNLAEEKSGKVPFKRK
FT                   KVVLKQIK"
FT   gene            759271..759825
FT                   /locus_tag="SP_0804"
FT   CDS             759271..759825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0804"
FT                   /product="putative 4-methyl-5(b-hydroxyethyl)-thiazole
FT                   monophosphate biosynthesis protein"
FT                   /note="identified by similarity to SP:Q46948; match to
FT                   protein family HMM PF01965; match to protein family HMM
FT                   TIGR01383"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0804"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74941"
FT                   /protein_id="AAK74941.1"
FT                   /translation="MVKVAVILAQGFEEIEALTVVDVLRRANITCDMVGFEEQVTGSHA
FT                   IQVRADHVFDGDLSDYDMIVLPGGMPGSAHLRDNQTLIQELQSFEQEGKKLAAICAAPI
FT                   ALNQAEILKNKRYTCYDGVQEQILDGHYVKETVVVDGQLTTSRGPSTALAFAYELVEQL
FT                   GGDAESLRTGMLYRDVFGKNQ"
FT   gene            759901..760473
FT                   /locus_tag="SP_0805"
FT   CDS             759901..760473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0805"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0805"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74942"
FT                   /protein_id="AAK74942.1"
FT                   /translation="MKGMKYHDYIWDLGGTLLDNYETSTAAFVETLALYGITQDHDSVY
FT                   QALKVSTPFAIETFAPNLENFLEKYKENEARELEHPILFEGVSDLLEDISNQGGRHFLV
FT                   SHRNDQVLEILEKTSIAAYFTEVVTSSSGFKRKPNPESMLYLREKYQISSGLVIGDRPI
FT                   DIEAGQAAGLDTHLFTSIVNLRQVLDI"
FT   gene            760488..762434
FT                   /gene="gyrB"
FT                   /locus_tag="SP_0806"
FT   CDS             760488..762434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="SP_0806"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by similarity to SP:P48355; match to
FT                   protein family HMM PF00204; match to protein family HMM
FT                   PF00986; match to protein family HMM PF01751; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0806"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74943"
FT                   /db_xref="GOA:P0A4L9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4L9"
FT                   /protein_id="AAK74943.1"
FT                   /translation="MTEEIKNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHH
FT                   LVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTV
FT                   LHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHYQEYRRGHVVADLEI
FT                   VGDTDKTGTTVHFTPDPKIFTETTIFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQT
FT                   KHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMDDITVEVAMQYTTGYHENVMSFANN
FT                   IHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQ
FT                   FEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRARE
FT                   VTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGK
FT                   ILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTL
FT                   LLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGR
FT                   TKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRRE
FT                   FIEENAVYSTLDV"
FT   gene            762516..764243
FT                   /locus_tag="SP_0807"
FT   CDS             762516..764243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0807"
FT                   /product="putative septation ring formation regulator EzrA"
FT                   /note="identified by similarity to EGAD:108156; match to
FT                   protein family HMM PF06160"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0807"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74944"
FT                   /db_xref="GOA:Q97RK0"
FT                   /db_xref="InterPro:IPR010379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RK0"
FT                   /protein_id="AAK74944.1"
FT                   /translation="MSNGQLIYLMVAIAVILVLAYVVAIFLRKRNEGRLEALEEKKEEL
FT                   YNLPVNDEVEAVKNMHLIGQSQVAFREWNQKWVDLSLNSFADIENNLFEAEGYNHSFRF
FT                   LKASHQIDQIESQITLIEEDIAAIRNALADLEKQESKNSGRVLHALDLFEELQHRVAEN
FT                   SEQYGQALDEIEKQLENIQSEFSQFVTLNSSGDPVEAAVILDNTENHILALSHIVDRVP
FT                   ALVTTLSTELPDQLQDLEAGYRKLIDANYHFVETDIEARFHLLYEAFKKNQENIRQLEL
FT                   DNAEYENGQAQEEINALYDIFTREIAAQKVVENLLATLPTYLQHMKENNTLLGEDIARL
FT                   NKTYLLPETAASHVRRIQTELESFEAAIVEVTSNQEEPTQAYSVLEENLEDLQTQLKDI
FT                   EDEQISVSERLTQIEKDDINARQKANVYVNRLHTIKRYMEKRNLPGIPQTFLKLFFTAS
FT                   NNTEDLMVELEQKMINIESVTRVLEIATNDMEALETETYNIVQYATLTEQLLQYSNRYR
FT                   SFDERIQEAFNEALDIFEKEFDYHASFDKISQALEVAEPGVTNRFVTSYEKTRETIRF"
FT   gene            complement(764616..764747)
FT                   /pseudo
FT                   /locus_tag="SP_0808"
FT                   /note="An N-terminal deletion/truncation resembles IS679,
FT                   and identified in a BLASTN search with the sequence from
FT                   more complete copies in the same cell. IRleft =
FT                   GTAAGCGCGTCATAACAAGG. IRright = GTAACCGTCCAATAACGAAG.; IS66
FT                   family element, Orf3, internal deletion; this region
FT                   contains one or more premature stops and/or frameshifts
FT                   which are not the result of sequencing error"
FT   gene            764779..764874
FT                   /locus_tag="SP_0809"
FT   CDS             764779..764874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0809"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0809"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74945"
FT                   /protein_id="AAK74945.1"
FT                   /translation="MKSTKEEIQTIKTLLKDSRTAKYHKRLQIVL"
FT   gene            765229..765495
FT                   /locus_tag="SP_0810"
FT   CDS             765229..765495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0810"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0810"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74946"
FT                   /protein_id="AAK74946.1"
FT                   /translation="MTVEEKKVFLARHLKAAEAGEFVTIDALFQAYKKELGRSYTRDAF
FT                   YQLLKCHGWRNIMPRPEHPKKADAQTIVASKNKISIQEEKKAL"
FT   gene            765527..766036
FT                   /locus_tag="SP_0811"
FT   CDS             765527..766036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0811"
FT                   /product="transposase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0811"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74947"
FT                   /protein_id="AAK74947.1"
FT                   /translation="MYQDEAGFGRISKLGSCWAPIGVGPHIHSHYIREFRYCYGAVDAH
FT                   TGESFFLIAGRCNTEWMNAFLEELSQAYPDDYLLLVMDNAIWHKSSTLKIPTNIGFTFI
FT                   PPYTPEMNPIEQVWKEIRKRGFKNKAFQTLEDVMNQLQDVIQGLEKEVIKSIVNRRWTR
FT                   MLFENR"
FT   gene            complement(766059..766514)
FT                   /pseudo
FT                   /locus_tag="SP_0812"
FT                   /note="An RUP element disrupts the C-terminus of this gene.
FT                   IRleft = GTAAGCGCGTCATAACAAGG. IRright =
FT                   GTAACCGTCCAATAACGAAG.; IS66 family element, Orf2,
FT                   interruption; this gene contains a premature stop which is
FT                   not the result of sequencing error; identified by
FT                   similarity to GP:6009426"
FT   gene            766755..767270
FT                   /pseudo
FT                   /locus_tag="SP_0813"
FT                   /note="IS3-Spn1, hypothetical protein, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GP:8163692"
FT   gene            767270..768092
FT                   /pseudo
FT                   /locus_tag="SP_0814"
FT                   /note="IS3-Spn1, transposase, internal deletion; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:8163693"
FT   gene            768130..768243
FT                   /locus_tag="SP_0815"
FT   CDS             768130..768243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0815"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0815"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74948"
FT                   /protein_id="AAK74948.1"
FT                   /translation="MLLCVLLLKDLLDFLSNRVFTQFSYLIGIEIPINFSE"
FT   gene            complement(768201..768500)
FT                   /locus_tag="SP_0816"
FT   CDS             complement(768201..768500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0816"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0816"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74949"
FT                   /protein_id="AAK74949.1"
FT                   /translation="MKLINTTNSHSQLVKSQLESTDATLVEVYSAGNTDVIFTQAPLHY
FT                   EILISNKHRAIREPEIETIQEFFLKRKIDKASVDEANIKTLYSEKLIGISIPIK"
FT   gene            complement(768665..769087)
FT                   /locus_tag="SP_0817"
FT   CDS             complement(768665..769087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0817"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by similarity to GP:9656965; match to
FT                   protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0817"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74950"
FT                   /protein_id="AAK74950.1"
FT                   /translation="MNTDYIARYGVYAVIPNPEQKQIVLVQEPNGAWFLPCGEIEAGEN
FT                   HQEALKHELIEELGFTAEIGTYYGQADEYFYSRHRDTYYYNPAYLYEATPFKEVQKPLE
FT                   NFNHIAWFPIDEAIKNLKRGSHKWAIESWKKQHKIG"
FT   gene            769180..769530
FT                   /locus_tag="SP_0818"
FT   CDS             769180..769530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0818"
FT                   /product="IS630-Spn1, transposase Orf1"
FT                   /note="identified by similarity to GP:4200438; match to
FT                   protein family HMM PF01710"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0818"
FT                   /db_xref="EnsemblGenomes-Tr:ABC75808"
FT                   /protein_id="ABC75808.1"
FT                   /translation="MWYNLLMAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWL
FT                   KLKEKTGELNHQVKGIKPRKVDRDRLKNYLTDNPDAYLTEIASEFGCHPTTIHYALKAM
FT                   GYTRKKKELHLL"
FT   gene            769728..770051
FT                   /locus_tag="SP_0819"
FT   CDS             769728..770051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0819"
FT                   /product="IS630-Spn1, transposase Orf2"
FT                   /note="identified by similarity to GP:5019553"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0819"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74951"
FT                   /protein_id="AAK74951.1"
FT                   /translation="MNGELIAPMTYEETMTSDFFEAWFQKFLLPTLTTPSVIIMDNARF
FT                   HRMGKLELLCEEFGYKLLPLPPYSPEYNPIEKTWAHIKKHLKKVLPSCNTFYEALLSCS
FT                   CFN"
FT   gene            complement(770258..772516)
FT                   /gene="clpE"
FT                   /locus_tag="SP_0820"
FT   CDS             complement(770258..772516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpE"
FT                   /locus_tag="SP_0820"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpE"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM PF07724"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0820"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74952"
FT                   /db_xref="GOA:P35594"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35594"
FT                   /protein_id="AAK74952.1"
FT                   /translation="MLCQNCKINDSTIHLYTNLNGKQKQIDLCQNCYKIIKTDPNNSLF
FT                   KGMTDLNNRDFDPFGDFFNDLNNFRPSSNTPPIPPTQSGGGYGGNGGYGSQNRGSAQTP
FT                   PPSQEKGLLEEFGINVTEIARRGDIDPVIGRDDEIIRVIEILNRRTKNNPVLIGEPGVG
FT                   KTAVVEGLAQKIVDGDVPHKLQGKQVIRLDVVSLVQGTGIRGQFEERMQKLMEEIRKRE
FT                   DIILFIDEIHEIVGAGSASDGNMDAGNILKPALARGELQLVGATTLNEYRIIEKDAALE
FT                   RRMQPVKVDEPTVDETITILKGIQKKYEDYHHVQYTDAAIEAAATLSNRYIQDRFLPDK
FT                   AIDLLDEAGSKMNLTLNFVDPKVIDQRLIEAENLKSQATREEDFEKAAYFRDQIAKYKE
FT                   MQKKKITDQDTPSISEKTIEHIIEQKTNIPVGDLKEKEQSQLIHLAEDLKSHVIGQDDA
FT                   VDKIAKAIRRNRVGLGTPNRPIGSFLFVGPTGVGKTELSKQLAIELFGSADSMIRFDMS
FT                   EYMEKHSVAKLVGAPPGYVGYDEAGQLTEKVRHNPYSLILLDEVEKAHPDVMHMFLQVL
FT                   DDGRLTDGQGRTVSFKDAIIIMTSNAGTGKTEASVGFGAAREGRTNSVLGELGNFFSPE
FT                   FMNRFDGIIEFKALSKDNLLQIVELMLADVNKRLSSNNIRLDVTDKVKEKLVDLGYDPK
FT                   MGARPLRRTIQDYIEDTITDYYLENPSEKDLKAVMTSKGNIQIKSAKKAEVKSSEKEK"
FT   gene            772647..772748
FT                   /locus_tag="SP_0821"
FT   CDS             772647..772748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0821"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0821"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74953"
FT                   /protein_id="AAK74953.1"
FT                   /translation="MKIFVNLDYKKILFVRQKGFYLDMQGQSQLVLD"
FT   gene            complement(772745..772975)
FT                   /locus_tag="SP_0822"
FT   CDS             complement(772745..772975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0822"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:107811"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0822"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74954"
FT                   /protein_id="AAK74954.1"
FT                   /translation="MESHLVRIINRLEAMANDGGNLKRNFEREGVVVAEVAYSHDEENG
FT                   PIFTLRDVEDRETYTFDSIDLIAMEIYELLY"
FT   gene            773159..773848
FT                   /locus_tag="SP_0823"
FT   CDS             773159..773848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0823"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by similarity to EGAD:45878; match to
FT                   protein family HMM PF00528; match to protein family HMM
FT                   TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0823"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74955"
FT                   /protein_id="AAK74955.1"
FT                   /translation="MTMNFSFLPKYLPYFNYGAVVTILISICVIFLGTILGVVLAFGQR
FT                   SKFKPLVWLANLYVWIFRGTPMMVQIMIAFALMHINAPTIQIGILGVDFSRLIPGILII
FT                   SMNSGAYVSETVRAGINAVPKGQLEAAYSLGIRPKNAMRYVILPQAVKNILPALGNEFI
FT                   TIIKDSSLLSAIGVMELWNGATTVSTTTYLPLTPLLFAAFYYLIMTSILTVALKAFEKH
FT                   MGQGDKK"
FT   gene            773848..774582
FT                   /locus_tag="SP_0824"
FT   CDS             773848..774582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0824"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to EGAD:32043; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0824"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74956"
FT                   /protein_id="AAK74956.1"
FT                   /translation="MTETLIKIENLHKSFGKNEVLKGINLEIKRGEVVVIIGPSGSGKS
FT                   TLLRSMNLLEEATKGKVIFEGVDITDKKNDLFAMREKMGMVFQQFNLFPNMTVMENITL
FT                   SPIKTKGDSKAVAEKRAQELLEKVGLPDKADAYPQSLSGGQQQRIAIARGLAMEPDVLL
FT                   FDEPTSALDPEMVGEVLAVMQDLAKSGMTMVIVTHEMGFAREVADRVIFMADGVVVEDG
FT                   TPEQIFEQTQGQRTKDFLSKVL"
FT   gene            774761..775618
FT                   /gene="folD"
FT                   /locus_tag="SP_0825"
FT   CDS             774761..775618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="SP_0825"
FT                   /product="methylenetetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
FT                   /note="identified by similarity to EGAD:12687; match to
FT                   protein family HMM PF00763; match to protein family HMM
FT                   PF02882"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0825"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74957"
FT                   /db_xref="GOA:Q97RI9"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RI9"
FT                   /protein_id="AAK74957.1"
FT                   /translation="MTQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPA
FT                   SQVYVRNKERSALAAGFRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHI
FT                   DEEAVLLAIDPEKDVDGFHPLNMGRLWSGHPVMIPSTPAGIMEMFHEYGIDLEGKNAVV
FT                   IGRSNIVGKPMAQLLLAKNATVTLTHSRTHNLSKVAAKADILVVAIGRAKFVTADFVKP
FT                   GAVVIDVGMNRDENGKLCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRT
FT                   LDRK"
FT   gene            775756..776577
FT                   /locus_tag="SP_0826"
FT   CDS             775756..776577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0826"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0826"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74958"
FT                   /protein_id="AAK74958.1"
FT                   /translation="MILKIYNGEYSLQWDGIYYLALIDYPNIQEWELEKIAKFIAYEKL
FT                   HKRQTSIECADSCLKKEILDYICQHPFLPPFTPTDKRVASTYDLHKRLVTSDYCSHTTT
FT                   IDAAISIFKTGRLLSAVKAFGRDAEELVLDSRNAASDPIDYFDYVMLGWSNTSSGYRLA
FT                   MERLLGRAPSEKELQDKFIPGVSFHFIYTDLIKVPGYIFDGYHAVKIKDMLNLLSELYI
FT                   CIIPTHNKSQFENIIPTKIQDRVYYLDYAGEDLEEWTKKVYQVVLKQSDKG"
FT   gene            776592..777431
FT                   /pseudo
FT                   /locus_tag="SP_0827"
FT                   /note="conserved hypothetical protein, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   EGAD:99002"
FT   gene            777729..778412
FT                   /gene="rpiA"
FT                   /locus_tag="SP_0828"
FT   CDS             777729..778412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="SP_0828"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by similarity to EGAD:20262; match to
FT                   protein family HMM PF06026; match to protein family HMM
FT                   TIGR00021"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0828"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74959"
FT                   /db_xref="GOA:Q97RI7"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RI7"
FT                   /protein_id="AAK74959.1"
FT                   /translation="MENLKKMAGITAAEFIKDGMVVGLGTGSTAYYFVEEIGRRIKEEG
FT                   LQITAVTTSSVTSKQAEGLNIPLKSIDQVDFVDVTVDGADEVDSQFNGIKGGGGALLME
FT                   KVVATPSKEYIWVVDESKLVEKLGAFKLPVEVVQYGAEQVFRHFERAGYKPSFREKDGQ
FT                   RFVTDMQNFIIDLALDVIENPIAFGQELDHVVGVVEHGLFNQMVDKVIVAGRDGVQIST
FT                   SKKGK"
FT   gene            778426..779637
FT                   /gene="deoB"
FT                   /locus_tag="SP_0829"
FT   CDS             778426..779637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="SP_0829"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="identified by match to protein family HMM PF01676;
FT                   match to protein family HMM TIGR01696"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0829"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74960"
FT                   /db_xref="GOA:Q97RI6"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RI6"
FT                   /protein_id="AAK74960.1"
FT                   /translation="MSKFNRIHLVVLDSVGIGAAPDANNFVNAGVPDGASDTLGHISKT
FT                   VGLNVPNMAKIGLGNIPRETPLKTVAAESNPTGYATKLEEVSLGKDTMTGHWEIMGLNI
FT                   TEPFDTFWNGFPEEILTKIEEFSGRKVIREANKPYSGTAVIYDFGPRQMETGELIIYTS
FT                   ADPVLQIAAHEDIIPLDELYRICEYARSITLERPALLGRIIARPYVGEPGNFTRTANRR
FT                   DLAVSPFFPTVLDKLNEAGIDTYAVGKINDIFNGAGINHDMGHNKSNSHGIDTLLKTMG
FT                   LAEFEKGFSFTNLVDFDALYGHRRNAHGYRDCLHEFDERLPEIIAAMRENDLLLITADH
FT                   GNDPTYAGTDHTREYIPLLAYSPAFKGNGLIPVGHFADISATVADNFGVETAMIGESFL
FT                   DKLV"
FT   gene            779639..780181
FT                   /locus_tag="SP_0830"
FT   CDS             779639..780181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0830"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0830"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74961"
FT                   /protein_id="AAK74961.1"
FT                   /translation="MTRYALLVRGINVGGKNKVVMAELRQELTNLGLEKVESYINSGNI
FT                   FFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFLF
FT                   YTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTAYHKYLLKVPFYRHI
FT                   TIRNAKTFDKIGQMLKK"
FT   gene            780197..781006
FT                   /locus_tag="SP_0831"
FT   CDS             780197..781006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0831"
FT                   /product="purine nucleoside phosphorylase, family 2"
FT                   /EC_number="2.4.2.1"
FT                   /note="identified by similarity to EGAD:30213; match to
FT                   protein family HMM PF00896; match to protein family HMM
FT                   TIGR01697; match to protein family HMM TIGR01700"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0831"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74962"
FT                   /protein_id="AAK74962.1"
FT                   /translation="MTFLNKIHETATFLKEKGIAAPEFGLILGSGLGELAEEIENPVVV
FT                   DYAEIPNWGRSTVVGHAGKLVYGELAGRKVLALQGRFHFYEGNPLEVVTFPVRVMKVLG
FT                   CEGVIVTNAAGGIGFGPGTLMAISDHINMTGQNPLMGENLDDFGPRFPDMSRAYTPEYR
FT                   ATAHEVAKKLNIKLDEGVYIGVTGPTYETPAEIRSYKTLGADAVGMSTVPEVIVAAHSG
FT                   LKVLGISCITNFAAGFQEELNHEEVVEVTERVKGDFKGLLKAILAEL"
FT   gene            781470..781640
FT                   /locus_tag="SP_0832"
FT   CDS             781470..781640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0832"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0832"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74963"
FT                   /protein_id="AAK74963.1"
FT                   /translation="MVIGVLDSKEELKESENDAPKLETPLREEPRLAPQTLPEASEVLE
FT                   NKREESKVEIT"
FT   gene            781707..782462
FT                   /locus_tag="SP_0833"
FT   CDS             781707..782462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0833"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0833"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74964"
FT                   /protein_id="AAK74964.1"
FT                   /translation="MYMTGHSLGCYLAQIAAVEAYQKYPDFYNHVLRKVTTFSAPKVIT
FT                   SRTVWNAKNGFWDVGLESRKLAVSGKIKHYVVDNDNVVTPLIHNNRDIVTFTGNSRFKH
FT                   RSRGYFESPMNDIPNFNIGKQATLDKHGYRDPKLDKVRFFKKQALPRSSSQPSAEPMEN
FT                   IASGKQVTQSSTAFGGDARRAVDGKVDGNYGHNSVTHTNFQSKPWWQVDLAKEETIRQI
FT                   NIYNRTDTAQDRLANFDVILLDSSGKEIE"
FT   gene            782487..782999
FT                   /locus_tag="SP_0834"
FT   CDS             782487..782999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0834"
FT                   /product="hemolysin-related protein"
FT                   /note="identified by similarity to GP:3309561"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0834"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74965"
FT                   /protein_id="AAK74965.1"
FT                   /translation="MSAQITINHKKARYVRIELEGYNALSLAEVEVFCFIATNAETATQ
FT                   VSKPVQPISQTPVKDKTLTIQHSGAYIARYSITWEEVPVDKDGNQVVRSHSWEGSGRNQ
FT                   TAGFVLNLPIKENMRNLRVKIEKKTGLLWNRWQTIYENRPILAQPHRKITHWGTTLNSK
FT                   VSDDDVL"
FT   gene            783653..784363
FT                   /locus_tag="SP_0835"
FT   CDS             783653..784363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0835"
FT                   /product="purine nucleoside phosphorylase, family 1"
FT                   /EC_number="2.4.2.1"
FT                   /note="identified by similarity to EGAD:139943; match to
FT                   protein family HMM PF01048; match to protein family HMM
FT                   TIGR00107"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0835"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74966"
FT                   /protein_id="AAK74966.1"
FT                   /translation="MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLDDAVCFNEVRNM
FT                   FGYTGTYKGHCVSVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELV
FT                   LAQAAATNSNIVRNDWPQYDFPQIASFDLLDKAYHIAKKLGMTTHVGNVLSSDVFYSNY
FT                   FEKNIELGKWGVKAVEMEAAALYYLAAQYHVDALAIMTISDSLVNPDEDTTAEERQNTF
FT                   TDMMKVGLETLIAE"
FT   gene            complement(784413..785669)
FT                   /locus_tag="SP_0836"
FT   CDS             complement(784413..785669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0836"
FT                   /product="IS1167, transposase"
FT                   /note="identified by similarity to GP:2804700; match to
FT                   protein family HMM PF01610"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0836"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74967"
FT                   /protein_id="AAK74967.1"
FT                   /translation="MEQLHFITKLLDIKDPNIKILDIINMDTHKEIIAKLDYEAPSCPD
FT                   CGSLMKKHDFQKPSKIPYLETTGMPSRILLRKRRFKCYHSSKMMVAETPLVKKNHQIPR
FT                   IINQKIAQKLIEKISMTDIAHQLAISTSTVIRKLNDFHFEHDFSRLPKIMSWDEYAFTK
FT                   GKMSFIAQDFDNLNIITVLEGRTQAVIRNHFLRYDRAVRCQVKIITMDMFSPYYDLAKQ
FT                   LFPCAKIVLDRFHIIQHLSRAMSRFRVQIMNQFERKSHEYKAIKRYWKLIQQDSRKLSD
FT                   KRFYRPTFRMHLTNKEILDKILSYSEDLKHHYQIYQLLLFHFQNKDPEKFFGLIEDNLK
FT                   QVHPLFQTVFKTFLKNKEKIVNALQLHYSNAKLEATNNLIKLIKRNAFGFRNFENFKKR
FT                   IFIALNIKKERTKFVLSQA"
FT   gene            complement(785809..786333)
FT                   /locus_tag="SP_0837"
FT   CDS             complement(785809..786333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0837"
FT                   /product="putative DNA topology modulation protein FlaR"
FT                   /note="identified by similarity to EGAD:40135"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0837"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74968"
FT                   /protein_id="AAK74968.1"
FT                   /translation="MKIAIIGYSGSGKSTIAEKLSNYYSIPKLHMDTLQFQPGWQDSDC
FT                   EWMLTEIKNFLTKHKAWVIDGNYSWCYYQERMQEADQIIFLNFSPLTCLFRAFKRYLKY
FT                   RGKVRESMAVDCPERFEWEFIRWILWDGRSKTQKENYQKLCQEYSHKVTILRNQRELDQ
FT                   FLDKKRKSYNS"
FT   gene            complement(786386..786622)
FT                   /gene="rpsT"
FT                   /locus_tag="SP_0838"
FT   CDS             complement(786386..786622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="SP_0838"
FT                   /product="ribosomal protein S20"
FT                   /note="identified by similarity to EGAD:37333; match to
FT                   protein family HMM PF01649; match to protein family HMM
FT                   TIGR00029"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0838"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74969"
FT                   /db_xref="GOA:Q97RH7"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RH7"
FT                   /protein_id="AAK74969.1"
FT                   /translation="MANIKSAIKRAELNVKQNEKNSAQKSAMRTAIKAFEANPSEELFR
FT                   AASSAIDKAETKGLIHKNKASRDKARLSAKLVK"
FT   gene            complement(786690..787610)
FT                   /gene="coaA"
FT                   /locus_tag="SP_0839"
FT   CDS             complement(786690..787610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="SP_0839"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="identified by similarity to EGAD:24941; match to
FT                   protein family HMM PF00485; match to protein family HMM
FT                   TIGR00554"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0839"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74970"
FT                   /db_xref="GOA:Q97RH6"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RH6"
FT                   /protein_id="AAK74970.1"
FT                   /translation="MTNEFLHFEKISRQTWQSLHRKTTPPLTEEELESIKSFNDQISLQ
FT                   DVTDIYLPLAHLIQIYKRTKEDLAFSKGIFLQRESKSQPFIIGVSGSVAVGKSTTSRLL
FT                   QILLSRTFTDATVELVTTDGFLYPNQTLIEQGILNRKGFPESYDMEALLNFLDRIKNGQ
FT                   DVDIPVYSHEVYDIVPEEKQSVKAADFVIVEGINVFQNPQNDRLYITDFFDFSIYVDAG
FT                   VDDIESWYLDRFLKMLSLAQNDPDSYYYRFTQMPIGEVESFAHQVWISINLTNLQNYIE
FT                   PTRNRAEVILHKSKNHEIDEIYLKK"
FT   gene            787800..788036
FT                   /locus_tag="SP_0840"
FT   CDS             787800..788036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0840"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0840"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74971"
FT                   /protein_id="AAK74971.1"
FT                   /translation="MKILKRYILELCFILSFALPFIKGTNADNGRCFVETYYGFTFLME
FT                   HAIVTAVFICSFLIAFLLKNDGRNGLLRVVIAF"
FT   gene            788410..789000
FT                   /locus_tag="SP_0841"
FT   CDS             788410..789000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SP_0841"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:20573; match to
FT                   protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0841"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74972"
FT                   /protein_id="AAK74972.1"
FT                   /translation="MSKMYYAENPDAAHDIHELRVDLLGEKMTFLTDAGVFSKKMVDFG
FT                   SQLLLKCLDVNQGETVLDVGCGYGPLGLSLVKVYGVQATMVDINTRALDLAQRNAEKNN
FT                   AKATIFQSNIYARVQGRFDHVISNPPIRAGKQVVHEIIEKSKDFLEIGGDLTIVIQKKQ
FT                   GAPSAKSKMEDVFGNCEILKKDKGYYILRSVKE"
FT   gene            788997..790274
FT                   /gene="pyn"
FT                   /locus_tag="SP_0842"
FT   CDS             788997..790274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyn"
FT                   /locus_tag="SP_0842"
FT                   /product="pyrimidine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.2"
FT                   /note="identified by similarity to EGAD:98225; match to
FT                   protein family HMM PF00591; match to protein family HMM
FT                   PF02885; match to protein family HMM PF07831; match to
FT                   protein family HMM TIGR02644"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0842"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74973"
FT                   /protein_id="AAK74973.1"
FT                   /translation="MRAVDLIQKKRDGQELTSSEIEWLIEGYVSGTVPDYQMSAFAMAV
FT                   YFKGMTTREISDLTMNMVKTGQEFDLSAIDGVKVDKHSTGGVGDKVTLILAPLVASFGV
FT                   PVAKMSGRGLGHTGGTIDKLESIKGYQVERSQEDFIRQVQDIGVSVIGQSDQLVKADKL
FT                   LYALRDVTATVDTIPLIASSVMSKKIAAGADAILLDVTVGEGAFMKTVDEARELAQTMV
FT                   DLGKVVGRKTVAVITDMSQPLGRAIGNRLEILEALEILQGQGRQDITHFICELAQIMLG
FT                   LANVNKTVEEVHQHLENGQALAKFEEMVQAQGGDLEDLYRPVNVAHVVEIPAQETGVIS
FT                   ALPAMDFGLYAMRLGAGRAVKSDALDYETGIVFEKKIGDSVQKGEIVAKVYTNEKIPPQ
FT                   LVTDFQKCVKISDEVKKIREIVEIIS"
FT   gene            790292..790954
FT                   /gene="deoC"
FT                   /locus_tag="SP_0843"
FT   CDS             790292..790954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="SP_0843"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="identified by match to protein family HMM PF01791;
FT                   match to protein family HMM TIGR00126"
FT                   /db_xref="EnsemblGenomes-Gn:SP_0843"
FT                   /db_xref="EnsemblGenomes-Tr:AAK74974"
FT                   /db_xref="GOA:Q97RH2"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97RH2"
FT                   /protein_id="AAK74974.1"
FT                   /translation="MKLNKYIDHTLLKQDAKKKQIDSLLSEAREYDFASVCVNPTWVEH
FT                   AKKGLEGTDVKVCTVVGFPLGATTSAVKAFETKEAIQNGADEIDMVINVGALKSGNLAL
FT                   VESDIRAVVEASGDKLVKVIIEACLLTDQEKVVVCQLAQKAGADFVKTSTGFSTGGATI
FT                   ADVTLMRETVGSDMGVKAAGGARSYADALAFVEAGATRIGTSAGVAILKGELADGDY"
FT   gene            790941..791330
FT                   /gene="cdd"
FT                   /locus_tag="SP_0844"
FT   CDS             790941..791330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdd"