spacer

EBI Dbfetch

ID   AE005176; SV 1; circular; genomic DNA; STD; PRO; 2365589 BP.
XX
AC   AE005176; AE006239-AE006456;
XX
PR   Project:PRJNA72;
XX
DT   18-JUL-2002 (Rel. 72, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Lactococcus lactis subsp. lactis Il1403, complete genome.
XX
KW   .
XX
OS   Lactococcus lactis subsp. lactis Il1403
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Lactococcus.
XX
RN   [1]
RP   1-2365589
RX   DOI; 10.1101/gr.GR-1697R.
RX   PUBMED; 11337471.
RA   Bolotin A., Wincker P., Mauger S., Jaillon O., Malarme K., Weissenbach J.,
RA   Ehrlich S.D., Sorokin A.;
RT   "The complete genome sequence of the lactic acid bacterium Lactococcus
RT   lactis ssp. lactis IL1403";
RL   Genome Res. 11(5):731-753(2001).
XX
RN   [2]
RP   1-2365589
RA   Bolotin A., Wincker P., Mauger S., Jaillon O., Malarme K., Weissenbach J.,
RA   Ehrlich S.D., Sorokin A.;
RT   ;
RL   Submitted (09-JAN-2001) to the INSDC.
RL   INRA, Genetique Microbienne, Domaine de Vilvert, Jouy en Josas 78352,
RL   France
XX
DR   MD5; 82ca38d8dd9d97e28e836abde3f47ed3.
DR   BioSample; SAMN02603339.
DR   EuropePMC; PMC1169520; 15995220.
DR   EuropePMC; PMC135457; 12446641.
DR   EuropePMC; PMC1716268; 17095711.
DR   EuropePMC; PMC1892938; 17284603.
DR   EuropePMC; PMC2632007; 19074389.
DR   EuropePMC; PMC2636762; 19171050.
DR   EuropePMC; PMC2639077; 19129208.
DR   EuropePMC; PMC2657157; 19175920.
DR   EuropePMC; PMC2705793; 19603075.
DR   EuropePMC; PMC2863553; 20348266.
DR   EuropePMC; PMC2893474; 20418430.
DR   EuropePMC; PMC2893499; 20400559.
DR   EuropePMC; PMC2962554; 20847124.
DR   EuropePMC; PMC311110; 11337471.
DR   EuropePMC; PMC3187148; 21803900.
DR   EuropePMC; PMC321303; 14711703.
DR   EuropePMC; PMC3370726; 22411612.
DR   EuropePMC; PMC3519859; 23240053.
DR   EuropePMC; PMC3697520; 23666332.
DR   EuropePMC; PMC3738903; 23929487.
DR   EuropePMC; PMC3818997; 21338475.
DR   EuropePMC; PMC3921932; 24592392.
DR   EuropePMC; PMC522089; 15466519.
DR   EuropePMC; PMC522090; 15466520.
DR   EuropePMC; PMC95238; 11371525.
DR   GOA; P49016.
DR   GOA; Q02141.
DR   InterPro; IPR000891; PYR_CT.
DR   InterPro; IPR002034; AIPM/Hcit_synth_CS.
DR   InterPro; IPR004033; UbiE/COQ5_MeTrFase.
DR   InterPro; IPR005671; LeuA_bact_synth.
DR   InterPro; IPR013709; 2-isopropylmalate_synth_dimer.
DR   InterPro; IPR023576; UbiE/COQ5_MeTrFase_CS.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01743; leu-phe_leader.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE005176.
DR   SILVA-SSU; AE005176.
DR   UniProtKB/Swiss-Prot; P49016; UBIE_LACLA.
DR   UniProtKB/Swiss-Prot; Q02141; LEU1_LACLA.
XX
CC   On or before Feb 26, 2009 this sequence version replaced
CC   gi:12722835, gi:12722840, gi:12722850, gi:12722862, gi:12722878,
CC   gi:12722894, gi:12722905, gi:12722915, gi:12722924, gi:12722939,
CC   gi:12722951, gi:12722962, gi:12722974, gi:12722989, gi:12723001,
CC   gi:12723012, gi:12723024, gi:12723033, gi:12723046, gi:12723054,
CC   gi:12723064, gi:12723076, gi:12723089, gi:12723102, gi:12723115,
CC   gi:12723124, gi:12723136, gi:12723146, gi:12723160, gi:12723171,
CC   gi:12723183, gi:12723196, gi:12723207, gi:12723217, gi:12723226,
CC   gi:12723239, gi:12723250, gi:12723260, gi:12723276, gi:12723286,
CC   gi:12723296, gi:12723303, gi:12723314, gi:12723336, gi:12723358,
CC   gi:12723365, gi:12723376, gi:12723386, gi:12723407, gi:12723424,
CC   gi:12723437, gi:12723444, gi:12723458, gi:12723474, gi:12723491,
CC   gi:12723504, gi:12723521, gi:12723531, gi:12723543, gi:12723554,
CC   gi:12723562, gi:12723574, gi:12723581, gi:12723593, gi:12723606,
CC   gi:12723613, gi:12723622, gi:12723634, gi:12723647, gi:12723658,
CC   gi:12723670, gi:12723678, gi:12723690, gi:12723702, gi:12723716,
CC   gi:12723726, gi:12723736, gi:12723745, gi:12723758, gi:12723765,
CC   gi:12723775, gi:12723781, gi:12723793, gi:12723804, gi:12723818,
CC   gi:12723831, gi:12723840, gi:12723845, gi:12723857, gi:12723870,
CC   gi:12723880, gi:12723892, gi:12723902, gi:12723916, gi:12723929,
CC   gi:12723943, gi:12723954, gi:12723974, gi:12723987, gi:12723993,
CC   gi:12724013, gi:12724024, gi:12724039, gi:12724053, gi:12724065,
CC   gi:12724073, gi:12724083, gi:12724095, gi:12724107, gi:12724121,
CC   gi:12724132, gi:12724141, gi:12724152, gi:12724159, gi:12724172,
CC   gi:12724187, gi:12724198, gi:12724208, gi:12724220, gi:12724230,
CC   gi:12724239, gi:12724249, gi:12724263, gi:12724274, gi:12724286,
CC   gi:12724300, gi:12724307, gi:12724315, gi:12724329, gi:12724342,
CC   gi:12724351, gi:12724363, gi:12724375, gi:12724391, gi:12724412,
CC   gi:12724427, gi:12724439, gi:12724448, gi:12724454, gi:12724467,
CC   gi:12724480, gi:12724490, gi:12724498, gi:12724507, gi:12724517,
CC   gi:12724527, gi:12724541, gi:12724553, gi:12724562, gi:12724575,
CC   gi:12724587, gi:12724598, gi:12724610, gi:12724624, gi:12724632,
CC   gi:12724642, gi:12724653, gi:12724663, gi:12724675, gi:12724685,
CC   gi:12724696, gi:12724708, gi:12724718, gi:12724732, gi:12724743,
CC   gi:12724755, gi:12724769, gi:12724780, gi:12724789, gi:12724802,
CC   gi:12724817, gi:12724826, gi:12724834, gi:12724843, gi:12724855,
CC   gi:12724866, gi:12724878, gi:12724889, gi:12724903, gi:12724916,
CC   gi:12724927, gi:12724938, gi:12724946, gi:12724951, gi:12724962,
CC   gi:12724971, gi:12724986, gi:12724998, gi:12725010, gi:12725022,
CC   gi:12725029, gi:12725043, gi:12725057, gi:12725068, gi:12725081,
CC   gi:12725090, gi:12725095, gi:12725105, gi:12725125, gi:12725142,
CC   gi:12725160, gi:12725172, gi:12725181, gi:12725193, gi:12725203,
CC   gi:12725211, gi:12725220, gi:12725232, gi:12725244, gi:12725248,
CC   gi:12725261, gi:12725275, gi:12725288, gi:12725297, gi:12725307,
CC   gi:12725319, gi:12725327, gi:12725338.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2365589
FT                   /organism="Lactococcus lactis subsp. lactis Il1403"
FT                   /sub_species="lactis"
FT                   /strain="IL1403"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:272623"
FT   gene            358..1725
FT                   /gene="dnaA"
FT                   /locus_tag="L0274"
FT   CDS             358..1725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="L0274"
FT                   /product="replication initiation protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:L0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04099"
FT                   /db_xref="GOA:Q9CJJ2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJJ2"
FT                   /protein_id="AAK04099.1"
FT                   /translation="MASLNENQKFWARVTELAQQSIGKQAYDFFIEPAQLMSVEQDTAN
FT                   ILLDSGMKKDYWKKQSDLITTAGFEVFGRMIDYELYANDELTELELHRLNNQSSIEEQP
FT                   RSTAKPASPLVSGLNEKYNFENFVQGPGNRWTLAAAIAVADKPGDTYNPLFIYGGAGLG
FT                   KTHLMHAIGNQILTDNPTARIKYVSSENFVNDYVNATRKNQMENFENTYRNLDLLLLDD
FT                   VQFFSDKEGTKNEFFNTFNALYDKGSQIVLTSDRIPQELNNLEDRLVSRFSWGLTTDIT
FT                   APDYETRMAILLIKSESSRLEFPSETLSYIAGQIDSNVRELEGALNRVEFVARANGIAV
FT                   VDIETASQALRSLKNATQQSLSNLTIKKIQDEVANYYHISFSDLVGPKRPKEIAFPRQI
FT                   AMYLVRELLGTSLPAIGTAFGGRDHTTVMYAYKQISDKMKNDMDVQKDIDSIKRKF"
FT   gene            1882..3024
FT                   /gene="dnaN"
FT                   /locus_tag="L0275"
FT   CDS             1882..3024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="L0275"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="EVIDENCE BY HOMOLOGY BIO10.02 DNA replication,
FT                   restriction, modification, recombination, and repair. DNA
FT                   polymerase III responsible for most of the replication
FT                   synthesis in bacteria. Exhibits also 3' to 5' exonuclease
FT                   activity."
FT                   /db_xref="EnsemblGenomes-Gn:L0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04100"
FT                   /db_xref="GOA:Q9CJJ1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJJ1"
FT                   /protein_id="AAK04100.1"
FT                   /translation="MIKFSINKNAFQNALRITKQAIGSKVTIPALTKLKIEVEENGITL
FT                   IGSNGQISIKNFLPVDNKDASMLISGTGSVLLEAAFFENVVSQLPEVTLEFTEKEQKQV
FT                   LLTSGKSEITLKGLDSEIYPHLQEISEGSSLKMKVKVLKEIFTETVFAVSTQENRPIFT
FT                   GVHLETLSTGELKAVATDSHRMSQRLLPLEDSELKFDVILPSKSINSFKNVFTNDEEEI
FT                   EIFISGSQMLFRNETISYYSRLIEGSYPDTNRLIPNEADYTLDLVFDAAQLRHTMDRAR
FT                   LLTVMTTNGTVKLTVSGDSVVTTANSPEVGSVHEELTALSKEGNDLAISFNPEYLIDAL
FT                   KVIKAPEVRIRFISNVRPFTLQPRNEESGFVQLITPVRTN"
FT   gene            3130..6429
FT                   /gene="rexB"
FT                   /locus_tag="L0252"
FT   CDS             3130..6429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rexB"
FT                   /locus_tag="L0252"
FT                   /product="subunit B of ATP-dependent exonuclease"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:9435243 BIO10.01
FT                   Degradation of DNA. this exonuclease is specifically
FT                   blocked by the putative lactococcal Chi site
FT                   (5'-GCGCGTG-3'). RexAB-mediated recombination stimulated
FT                   approximately 27-fold by lactococcal Chi."
FT                   /db_xref="EnsemblGenomes-Gn:L0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04101"
FT                   /db_xref="GOA:Q9CJJ0"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014141"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJJ0"
FT                   /protein_id="AAK04101.1"
FT                   /translation="MEILYTEITQDLTEGLLEISLEELEKNRKVYYIVPSSMSFEKEKE
FT                   ILERLAKGSDSAVFDLLVTRFKQLPYYFDKREKATTKTELGTAGLSMLFRRVLRSFSKE
FT                   EIPLYFSLQDSAGFLEMLIQLRTELLTANLSVENLPDSPKNQELKKILSRFEEKLANDY
FT                   ANYSEFGDFTSRLADGEFDFQLKDVTIVIDGYTRFSAEEELFIESIQDRVARFVIGTYS
FT                   DENSLTAGSETIYISTSQMIGRFRSKFPVELRKMAFSSVNEVYNKLTKLLDLDSRFAIS
FT                   DQNIEINSADAKYFRIWEAENQKVEIEGVAKEIRQKISQGAFFKDFTVLVGDPAAYEIT
FT                   LKEIFELYEIPFFYAQEESMSQHPLVIFFESLLSIKKNNYGTDDVVNLLKSKVYTDVNL
FT                   DEEVIDYFEYYVQKYKISGRKKFTEAFNESEFSKIELVNQLRENLLGNDSPLQVFLGTN
FT                   RQKTGKKWVSDLQVLLENGNVMANMNTYFSEAESENKHQMADKHEQVWQMLISILNEFL
FT                   AVFSDEKLKSVEFLDILLAGLKNAKYRQIPANVDVVNIKDYELVEPKTNKYIYAIGLSQ
FT                   TNFPRIKKNSTLLSDEERLEINQTTDENQFIEQLNVVNYQKNQFTVLSLVNSAKETLVL
FT                   SMPQIMANEQGEFSPVFQLFLNHSDEKILQKIQEVNLFESLEHIGNSRSVISMIGKIER
FT                   ELVETEEKNDDKRVFWSSIFRILVKSNPDFQKILLDLAKDIDTVNLSQETLDQIYGDKL
FT                   YASVSSFERFYNCEYQYFLETTLGLETFENIDINSKIVGNFFHEVFEKVMQEEALSAEN
FT                   FDEKLTKVLHDVDSNYSRYFTHDATARFTWTNLEEIVRQTATVLKETVSTDELKTLLTE
FT                   SSFGLPKSELGNFSVDDIYLRGRIDRLDQLSSDYLGAIDYKSSAHSFKLQDAYDGLSLQ
FT                   FMTYLDVIKEAFPNQKIWGALYLQFKNQPINLSEINHLSEIAGLLKESMRYDGLVLEEA
FT                   ADQIKAIENITVKKSNIYNQEEFEQLLKLNENHYQHAGQRLKSGQIAINPIMKRSEGID
FT                   QTGNVRGCRYCPLKSICRFEANVHMNDHSREIGQKSQAEILAELKGEGRNE"
FT   gene            6422..10033
FT                   /gene="rexA"
FT                   /locus_tag="L0251"
FT   CDS             6422..10033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rexA"
FT                   /locus_tag="L0251"
FT                   /product="subunit A of ATP-dependent exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:L0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04102"
FT                   /db_xref="GOA:Q9CJI9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJI9"
FT                   /protein_id="AAK04102.1"
FT                   /translation="MSEVKLTPEQNEAIHSSGKNILVSASAGSGKTFVMAQRIVEKVKQ
FT                   GIEIDRLFISTFTKKAASELRMRLERDLKKARQESSDENQACRLTLALQNLSNADIGTM
FT                   DSFTQKLTKTNFNRVNIDPNFRILADQTESDLIRQEVFEQLVESYLSGDDGLNISKEKF
FT                   EELIKNFSKDRNIAGFQKVVYTIYRFASATENPIKWLENQFLKGFETYKSLIDLSADFS
FT                   ADIKENLLIFFELLETSLTNGVVAKKGAGRDKANLILDNKNELLEAITTKDFATFTELF
FT                   LSIDTDIRVGSSKDEILSALKKDFSVQKQDLVGSKSKPGEIRKFVDKIKHGQLIEKYQN
FT                   QAFEIAENLQKFVIEFYQSYLERKKNENAFEYSDIAHFAIEILEENPDIRETLREHYDE
FT                   IMIDEYQDTSHTQERMLELLSNGHNLFMVGDIKQSIYGFRLADPGLFLEKYKDYAKTEN
FT                   PNQLIRLKENFRSRGEVLTFTNDIFKHLMDEKLGEMTYGKEEALVQGNITDYPVESEKD
FT                   FYPELLLYKENTSDEETDESEVRISDGEIKGAAQEIKKLIEAGVEPKDIAILVRSKSNN
FT                   NKIEDILLSYDIPVVLDEGRVDFLKSMEVLIMLDVLRAIDNPLYDLSLVAMLRSPLFGF
FT                   NEDELTRISTQGSHDLRFWDKILLSLNKEGQNPELINPSLENKLKAFYKKFTEWRKLVN
FT                   QVAIHDLLWKIYTETYYFDYVGALKNGEIRQANLQALAVRAESYESSGYKGLFKFVRLI
FT                   NKFMEQNNDLASVNIKLPQSAVRVMTFHKSKGLEFDYVFLMNLQSRFNDRDLKENVILS
FT                   RENGLGMKLIADLKDEADVITDFPYALVKMETFPYMVNKDLKQRAALSEEMRVLYVAFT
FT                   RAKKKLYLVGKIKETDKKSGLDLYDNASLEGKILEDKFRNSSRGFQHWILALQNATKLP
FT                   IKLNVYTKEELEAEKLEFTSQPDFKKLVEESEKFDNIMAHSDEIQKAQKIMNYEYPHQA
FT                   ATELSSIQTPSQVKKRSYEKQLQVGEIQPKSEFTRVKKLDFSDFGPKKVTAAEIGSATH
FT                   SFMQYADFSQADLFSFQATLDEMGFDEKIKNQIDIAKILTLFDTDFGQFLSENVDKTVK
FT                   EAPFSMLRTDEFAKEQYIVRGICDGFVKLTDKIVLFDYKTDRFTSSSAISEIKERYRDQ
FT                   MNLYSEALKKAYDVNQVDKYLILLGGPQQVFVEKLDD"
FT   gene            complement(10280..10837)
FT                   /gene="yabA"
FT                   /locus_tag="L10283"
FT   CDS             complement(10280..10837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabA"
FT                   /locus_tag="L10283"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General. belongs to the PBSX(XRE) family of transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:L10283"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04103"
FT                   /db_xref="GOA:Q9CJI8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJI8"
FT                   /protein_id="AAK04103.1"
FT                   /translation="MLGENLQKARLAQKLTQEEVAKELYFSRQAISRWESNKTEPNFET
FT                   LIALAELYESDLSAFAQGIEPQKRKKHINLFAGFGLVFFNFVLGFWLIITTALILLALY
FT                   AIILALFLAPFIMIFAVATHNPHITFGNANGATGFDWWYWLVAIIACSLMVLVSPLIWR
FT                   FTKLLYFWLIKYLKFNLKSVYN"
FT   gene            11119..12234
FT                   /gene="yyaL"
FT                   /locus_tag="L0161"
FT   CDS             11119..12234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yyaL"
FT                   /locus_tag="L0161"
FT                   /product="GTP-binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.10 GTP-binding proteins.
FT                   putative functional counterpart of YyaF of B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04104"
FT                   /db_xref="GOA:Q9CJI7"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJI7"
FT                   /protein_id="AAK04104.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLNKLTELIKPKKTVPTTFEFTDIAGIVKGASRGEGLGNKFLANIREVDAIIHVV
FT                   RAFDDENVMRENNREDAFIDPMADIETINLELILADLESVNKRYARVEKVARTAKDKDA
FT                   VAEFNVLKKLKPVLEDGKSARTIDFDEDEIKVLKSLFLLTSKPVLYVANVSEDEVGEPD
FT                   NIEYVKQIREFAATENAEVAVISARVEEEISELEDDEKAEFLEAIGLKESGVDMLTRAA
FT                   YHLLGLATYFTAGEKEVRAWTFKRGMKAPQMAGIIHTDFEKGFIRAVTMSYDDLLKYGS
FT                   EKAVREAGRLREEGKEYVGQDGDIMEFRFNV"
FT   gene            12346..12669
FT                   /gene="yabB"
FT                   /locus_tag="L12334"
FT   CDS             12346..12669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabB"
FT                   /locus_tag="L12334"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General. belongs to the PBSX(XRE) family of transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:L12334"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04105"
FT                   /db_xref="GOA:Q9CJI6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJI6"
FT                   /protein_id="AAK04105.1"
FT                   /translation="MEISQIIKENRKMKNLSQEELAKKMHISRQSISKWETGKSLPTTD
FT                   QIILLSEIFDCSLDTLLKGDKKMEEKAKHEIDDKRTLKLIYKVGWGFIIPFLFTLKFIL
FT                   HLF"
FT   gene            12924..13268
FT                   /gene="yabC"
FT                   /locus_tag="L12912"
FT   CDS             12924..13268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabC"
FT                   /locus_tag="L12912"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci"
FT                   /db_xref="EnsemblGenomes-Gn:L12912"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04106"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJI5"
FT                   /protein_id="AAK04106.1"
FT                   /translation="MELTMTRALIRRRNLMRKVSVLVLGTALISGTAFASAQVFVSGGW
FT                   NTNYIERFNPTITKATAHDNAQINQRHYSWAKVGKSATAFSNTVSANKIAQAKAIGAWN
FT                   AGYSGWFVKL"
FT   gene            13281..15272
FT                   /gene="yabD"
FT                   /locus_tag="L13272"
FT   CDS             13281..15272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabD"
FT                   /locus_tag="L13272"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci"
FT                   /db_xref="EnsemblGenomes-Gn:L13272"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04107"
FT                   /db_xref="InterPro:IPR006541"
FT                   /db_xref="InterPro:IPR016976"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJI4"
FT                   /protein_id="AAK04107.1"
FT                   /translation="MNKVIKFVLLVLFIVISISSANIVKNNFVDKQIEKNYDVQDFTQI
FT                   YLPSSISSDKNLISLVEGVSAKTGASFIFRSTYGGVKNDGKGHADLLKMDSKAVFYKTN
FT                   YQTSDKKTFVSHGFSCQLWSEPLKNITTVEQENSDVYIKNKNIQTSLQDFLIALNQKYG
FT                   THITSKKLTTRPSDFYPNNYTSFIGLTNDNLSLFIGISIVFFAIFLFVWLVGNNKKIAT
FT                   YRLNGVSAHRIGLRLFLKEFFIVTLLAYIFSSFLVFRGFNLQFSLQMFIMLLLVIIVSY
FT                   ISIVLVSSFSLANQINSKSFFKYSHYVLYAVKAFVFLITVSTTATLLYFVNAKLEITSK
FT                   IGQEYAILYPEFSGYDGGQPLNLSCIDLFVYAEEHDGLYISDSSIDIVENDSLNDLQIN
FT                   DNYLSKFAIYSQDNQRVEINPDTNSGIILVSEKYKSQLSKIKKYYASSDSLAFFKGSTI
FT                   KYYFIKDAQKLDLLDENSTKISPDLVEVYTRKNFTDKGNVTFQHNTVLKFKIRGTIEKT
FT                   YQPLIPILKKNSALETHPSMIKIDDISKTDNLSTVGNPYNYAVTNGLVILIFLSMILTT
FT                   TVFYFETYKKKIAVKRLYGISFFVTYKTLFAIVLVQGSLYFAFALSQRDVNITLEGLGI
FT                   YFVLEILIIILILLKLQKGLFLNVLKGE"
FT   gene            15274..15909
FT                   /gene="yabE"
FT                   /locus_tag="L15262"
FT   CDS             15274..15909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabE"
FT                   /locus_tag="L15262"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS. General. There are 60 paralogs in L.lactis"
FT                   /db_xref="EnsemblGenomes-Gn:L15262"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04108"
FT                   /db_xref="GOA:Q9CJI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR019895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJI3"
FT                   /protein_id="AAK04108.1"
FT                   /translation="MIEIEELTKSYKGHIIFDKLNLRIPEGKMTAIYGTSGAGKSTLLN
FT                   IIGLIEDYDDGKYYFNGQFAPPFNSSLALKMRRNKISYLFQNFALLEDETIEKNLEIAL
FT                   IYSRISKKEKRKKMKKLLLQVGINHRLNTKVYSLSGGEKQRVAIARALLKESQLILADE
FT                   PTGSLDTENRNEVIALLRQEVDKGKAVVIVTHDSYLKEVSDLVIEIGE"
FT   gene            16110..16580
FT                   /gene="yabF"
FT                   /locus_tag="L16101"
FT   CDS             16110..16580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabF"
FT                   /locus_tag="L16101"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L16101"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04109"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJI2"
FT                   /protein_id="AAK04109.1"
FT                   /translation="MKIYIVGTVGSGKSTLARKLSEKNSMRVFHLDNIVHEGERNRTDK
FT                   EVFESIECIFKNECFIIEDTLRERFIPLLDKVDKIIYLDLPKNLLKYRIIKRYVKQKLR
FT                   LEKSTYRPSLQMLKQMFIWQKNGRSELINAQKNKIVLHNKREIRQFIKNFQK"
FT   gene            16598..17164
FT                   /gene="pth"
FT                   /locus_tag="L0365"
FT   CDS             16598..17164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="L0365"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.06 tRNA modification. the
FT                   natural substrate for this enzyme may be the peptidil-tRNAs
FT                   which drop off the ribosomes during protein synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:L0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04110"
FT                   /db_xref="GOA:Q9CJI1"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJI1"
FT                   /protein_id="AAK04110.1"
FT                   /translation="MTKMIVGLGNPGDKYEKTKHNMGFMALDLLAKELNVDFKEEKPFM
FT                   SLVASTFVNGEKLFLVKPLTFMNESGRSVAPLLKYYNIDEADLTVMHDDLDSPVGRVRL
FT                   RQKGSSGGQNGIKSVITHVGSQTFNRVKIGIGRPKHGMTVGNHVLSGFDNEDKEIAQDG
FT                   IFKAVDAMKFYLENGDFQKTMNKFN"
FT   gene            17165..20650
FT                   /gene="mfd"
FT                   /locus_tag="L0263"
FT   CDS             17165..20650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="L0263"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:L0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04111"
FT                   /db_xref="GOA:Q9CJI0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJI0"
FT                   /protein_id="AAK04111.1"
FT                   /translation="MNIIEFFDQNWQLQKWQQGFSKRERTLLTGLSGTAKSLVMANAYE
FT                   NVADKYIIVTDSQFHANELYDELSTLLGEEKVFQFFSDDNIYAEFALASKDRVAYRLEA
FT                   LNFLLDEKSTGFLVVPFLALRSYLPSPENFLENYLLLTSGDEYDLSNLVNLLSKAGYEK
FT                   TQRVMTPGEFSMRGDIVDIYPLDAENPVRLEFFGDEVDTIRSFDVESQRSLTSLERLEI
FT                   YPASDFILTDKEFDKGAKSLTEMTNLLTDPSAKSYMEEVISAAQNHYYHKDLRKFAEYF
FT                   YDKKTSLLNYFPKNVQIFIDDFQKVNEMNNKLEMELADFILSEKAMERGFEGQTYLLDT
FT                   MAKVRNYKPATFFSNFQKGLGNLRFEQLYNFKQHSMQQFFGQLELFYTEVERFIKQEFT
FT                   VVLAVSSEKLRKSLHELDLSLQEVDRESIQVGKVNLIDLQLSNGFNFLDEKLVVMTEHE
FT                   IFGKMRKKKARKLNITNAERLKDYNELAVGDFVVHKNHGIGKYLGLQTLEVGGMHRDYL
FT                   TIQYQNGDTISVPVDHLDLLSKYTAGEGKSPKINKLNDGRWRKTMSSVSKQVEDISDDL
FT                   IKLYAERQAKKGFAFSPDDTSQEEFDSGFSYVETEDQMRSINEIKHDMELERPMDRLLV
FT                   GDVGFGKTEVAMRAAFKAINDGKQVAVLVPTTVLAEQHFNNFTERFINFGVNVEVLSRF
FT                   QTKTQQTEILAKLKKGRVDLIIGTHRLLSKDVEFFDLGLMIIDEEQRFGVKHKERLKEL
FT                   KTQVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVMETNYGVVRDAVLR
FT                   EISRGGQVYYVYNRVDTIEQKVSQLEELIPEARIGFIHGQMTEVQLENTLLAFIAGDYD
FT                   VLVATTIIETGVDIPNANTLFIENADMMGLSQLYQLRGRVGRSNRVAYAYFMYRPEKIL
FT                   SEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNLLGSEQSGFIDSVGFDLYSQLLEE
FT                   AIHAKLGTSKQKRTSNVEISLELDAFIPAYYISDERQKIEIYKRIRQIDSREIYEELQE
FT                   ELVDRFGEYPDEVAYLLEIGLLKPFADNVLVEKIEKSRFEATVTLEKVANTTYDPQDYF
FT                   KALAKTSMKASVGEKYGKMTFRFKIENRNSVVLLSEIMNFIEELSKIRDSYENK"
FT   gene            20810..21280
FT                   /gene="yacI"
FT                   /locus_tag="L20795"
FT   CDS             20810..21280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacI"
FT                   /locus_tag="L20795"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L20795"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04112"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJH9"
FT                   /protein_id="AAK04112.1"
FT                   /translation="MDLKAAKAELREKSRPYQTYSYYLIIPIFIILVFLLSLVGYNKGT
FT                   FGTIVFVFVIFAHVWASKLDLVRKRKHVAPILMYVTQGLGVVLMVLLVTEVSAGGTGNI
FT                   ALGLSSLILLPIEIIAIVFFFISANDIKKAYPTMKEDAKAARLEYQELRRSK"
FT   gene            21351..21668
FT                   /gene="yacB"
FT                   /locus_tag="L1001"
FT   CDS             21351..21668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacB"
FT                   /locus_tag="L1001"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:L1001"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04113"
FT                   /db_xref="GOA:Q9CJH8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJH8"
FT                   /protein_id="AAK04113.1"
FT                   /translation="MNKGIFKQNEICYNQTMRLDKFLKVSRLIKRRPVAKEVADKGRIK
FT                   INGKLAKSSSDVKFNDTIEIRFGNKIVEVRVAELKEFTRKEDADKMYEMISETRITEEV
FT                   E"
FT   gene            21697..22071
FT                   /gene="yacC"
FT                   /locus_tag="L21634"
FT   CDS             21697..22071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="L21634"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   30% identical to CELL DIVISION protein DIVIC OF B.SUBTILIS.
FT                   In B.subtilis REQUIRED FOR THE ACTIVATION OF GENES
FT                   EXPRESSED UNDER THE CONTROL OF THE SPORULATION
FT                   TRANSCRIPTION FACTORS SIGMA F AND SIGMA E."
FT                   /db_xref="EnsemblGenomes-Gn:L21634"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04114"
FT                   /db_xref="GOA:Q9CJH7"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJH7"
FT                   /protein_id="AAK04114.1"
FT                   /translation="MAKQVIQLNNKYTQKQKKRNLNPVPKRKHLGLILIVAILLFSLAS
FT                   MSLIKSYETLHSQVALEQSAKKQYESLSKEVTIKKEEISKLQDPNYLQKFARSDGQEYS
FT                   QSDEKVFTTDSPLIGSNGSK"
FT   gene            22071..22394
FT                   /gene="yacD"
FT                   /locus_tag="L22059"
FT   CDS             22071..22394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacD"
FT                   /locus_tag="L22059"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   homologous to HYPOTHETICAL 14.2 KD protein IN DIVIC-SPOIIE
FT                   INTERGENIC REGION OF B.SUBTILIS"
FT                   /db_xref="EnsemblGenomes-Gn:L22059"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04115"
FT                   /db_xref="GOA:Q9CJH6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJH6"
FT                   /protein_id="AAK04115.1"
FT                   /translation="MIGQVENITRFGLFVKISTDKLDESTEKLADKAVSKNRGLLRWSQ
FT                   IPKNVPKVQIGDLIGVEISNIHEDGKVDLNYQEKIFKNVYAEFLETSHQRLTELEQKNR
FT                   ELN"
FT   gene            22532..23881
FT                   /gene="yacG"
FT                   /locus_tag="L22496"
FT   CDS             22532..23881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacG"
FT                   /locus_tag="L22496"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   34% identical to a protein from Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L22496"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04116"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJH5"
FT                   /protein_id="AAK04116.1"
FT                   /translation="MLGKVLIMQKQRTKINSGVALVMLLMIITGFFAFSQTRYFADKKV
FT                   SKSKNIVAADKVTDKEKETETWTSIPQRAVAYQELTTYEDSNLTKSVGKIPAKTQLDIP
FT                   EIVGKSFKLKTGKYISTDKKAVISDLTISRESINTTIYTDKSVNVFYNPVTTYDNQIMT
FT                   NLSGTHQLSADKMAKTNWGTYYEVSLDNGQKGWVSENDISLENPKIKQVQALLNQKYND
FT                   KKYSIYVKELDDKFTAGVNQEQKMYSASLSKIPILYWTQKRLNEGLASLDDKLLYTPAI
FT                   NTFYGSYKPEGTGNLPKTADNKYYSLQDVINRTAKLSDNVGSNMLAYYETQEFNPNYQK
FT                   EINRIAGQEWNPKERNASAQMVGRMLEALYNEGGASFNALFDTSFDDVKIRAGVPKNIS
FT                   VAHKIGGADTDNHDAAIVFASKPYLLVIETDGATDDEIKAISQDVYGVMK"
FT   gene            23878..25149
FT                   /gene="mesJ"
FT                   /locus_tag="L1002"
FT   CDS             23878..25149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="L1002"
FT                   /product="cell cycle protein MesJ"
FT                   /note="EVIDENCE BY HOMOLOGY BIO04.01 Cell division"
FT                   /db_xref="EnsemblGenomes-Gn:L1002"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04117"
FT                   /db_xref="GOA:Q9CJH4"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJH4"
FT                   /protein_id="AAK04117.1"
FT                   /translation="MTPAQRKFLKIVKDEHYFDKDSKILLALSGGKDSMTLFNWLYDLK
FT                   EVLGIELGLAHINHGLREESKFEEIALREMATKLKVPIYVDKFTGEFTEKNARDFRYQF
FT                   FEKLMIGENYNILLTAHHQGDLVETVLMRQITGRPLRSLQGIADRQPFAGGQLIRPLLK
FT                   FTKEELDAQTYYEDSTNQGLDYFRNRIRNQLIPELKKENPQFSQSISDLSSEIKKALAV
FT                   INQKISELEIVDEKISSKKFISQTKELQHFILQAFFAQYPEIEVSKKKFAELLHIINRP
FT                   QQYFAKLNKEFYFVKTKDFFYLEKIQLERENSVEIVSENPQDESFMEVYLPLEGEIEIR
FT                   KRQPGDQILINGHHKKLRKFFIDNKVPLKARENPLIFVDKKLYAIVGLACSDLSKMLKN
FT                   DKIRRILWVKPSIGEEINDARKKS"
FT   gene            25130..25681
FT                   /gene="hpt"
FT                   /locus_tag="L25115"
FT   CDS             25130..25681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="L25115"
FT                   /product="hypoxantine-guanine phosphorybosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:1465108 BIO08.05 Salvage
FT                   of nucleosides and nucleotides. INVOLVED IN BIOSYNTHESIS OR
FT                   SALVAGE OF PURINES OR PYRIMIDINES. Deletion of 22 AA
FT                   compared to strain CHCC 285"
FT                   /db_xref="EnsemblGenomes-Gn:L25115"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04118"
FT                   /db_xref="GOA:Q02522"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02522"
FT                   /protein_id="AAK04118.1"
FT                   /translation="MLEKNLDKAIEKVLVSEEEIIEKSKELGEILTKEYEGKNPLVLGI
FT                   LRGSVPFLAELIKHIDCHLETDFMTVSSYHGGTKSSGEVKLILDVDTAVKGRDILIVED
FT                   IIDTGRTLKYLKELLEHRGANVKIVTLLDKPEGRIVEIKPDYSGFTIPNEFVVGFGLDY
FT                   EENYRNLPYVGVLKPEVYNK"
FT   gene            25887..27974
FT                   /gene="ftsH"
FT                   /locus_tag="L0204"
FT   CDS             25887..27974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="L0204"
FT                   /product="cell division protein FtsH"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:8000529 BIO04.01 Cell
FT                   division. In L.lactis this protein shown to be involved in
FT                   salt-, heat- and cold-resistance."
FT                   /db_xref="EnsemblGenomes-Gn:L0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04119"
FT                   /db_xref="GOA:P46469"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46469"
FT                   /protein_id="AAK04119.1"
FT                   /translation="MNNNKQPKQGNFVKNILMWVILAIVVVVGFNFFFSSNQSSVDKIS
FT                   YSQLMTKLDGNKIENVTMQPSDSLITVTGEYKEPVKVKGTNNFPLLGNSSSEVKNFQAY
FT                   IIPTDSVVKDIQNAAKSNDVKLSVVQASSSGMWVQILSYIIPMLLFVGIFWLMMGGMGA
FT                   RGGGGGGNPMSFGKSRAKQQDGKTSKVRFADVAGSEEEKQELVEVVDFLKNPKKYHDLG
FT                   ARIPAGVLLEGPPGTGKTLLAKAVAGEAGVPFYSISGSDFVEMFVGVGASRVRDLFENA
FT                   KKTAPSIIFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLVEMDGFQDDGNSVIVIAATN
FT                   RSDVLDPALLRPGRFDRKVLVGAPDVKGREAVLKVHAKNKPLASDVDLHNVATQTPGYV
FT                   GADLENVLNEAALVAARQNKKEINAADIDEGMDRAMAGPAKKDRIQSMREREIVAYHEA
FT                   GHAIVGLVLENGSTVRKVTVVPRGRIGGYMLALPDEEIMQPTNFHLQDQLASLMGGRLG
FT                   EEIVFGVATPGASNDIEKATHIARSMVTEYGMSKKLGMVSYEGDHQVFIGRDYGQTKTY
FT                   SEATAVMIDDEVRRILGEAYDRAKEAIETHREQHKAIAEALLKYETLDAKQIMSLFKTG
FT                   KMPDEAAAAEVPEPKTFEESLKDANANVDDFSNINIYNGDEKTDSKPEENKEKSEDETA
FT                   E"
FT   gene            29041..30863
FT                   /gene="mtlA"
FT                   /note="contains frameshift"
FT   gene            30922..32859
FT                   /gene="mtlR"
FT                   /locus_tag="L30901"
FT   CDS             30922..32859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlR"
FT                   /locus_tag="L30901"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.04 LysR-family
FT                   regulators. probably the regulator of the mtl operon"
FT                   /db_xref="EnsemblGenomes-Gn:L30901"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04120"
FT                   /db_xref="GOA:Q9CJH3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJH3"
FT                   /protein_id="AAK04120.1"
FT                   /translation="MFLTSREQKLIQTFLKRGKLTIAEMMEITDTSRRTLYRDLNNLQK
FT                   SLPENISLENTDEGYFLKGDINQLTQAHELIDYSISERLYGELLLLIENKASIASLTDY
FT                   FGISQPTVTSDLKQIEQALFENELVLIRDRGLKLKGAEENIRPVFVAVIYNSASIQELL
FT                   LNQLSNNKILRIIDLNKFKQVNEAFKRIDLPEKMTDKVKVLMQLFCLVVLLRLDEGDSV
FT                   SSETLGRPSKQALNFVNKLLTELPVTKFVVSEITYLASVYDILYFGFGRELLFMEKFDT
FT                   DFSYKIRQLIDKVSTILEIEFGKDDRLYGLLYAHLKESEMLPVLFPKKENDFIKKINKD
FT                   NPEIYKTVKESLREVFDKNFSEMEIAFISLHFVATLERSDLVLPLSAVLVSSRGRISCE
FT                   FIMSNLRKNFPFLKKIELIQSSIHITQEKYDVIFTTEKELDYIYINPMLDQKNLENIRH
FT                   QLRLIQQKSRALTSDSEKEKNFLNLNDLFSIGNEILKSFEILSLENKAELHDTVKQIIQ
FT                   RVNPEDSGELVHLVEERFKETHLAIPETKIALFHAVHSSISSPMFKIFDLSQPIEGIAM
FT                   DHQAIQIGRVLLLLAPPEVPEYVSFLLGKISSSIIENKLYTRIYDSGNYEIVSELLREI
FT                   IIEAVKHYDD"
FT   gene            32907..33338
FT                   /gene="mtlF"
FT                   /locus_tag="L32907"
FT   CDS             32907..33338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlF"
FT                   /locus_tag="L32907"
FT                   /product="mannitol-specific PTS system IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.07 TRANSPORT AND BINDING
FT                   proteinS. PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:L32907"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04121"
FT                   /db_xref="GOA:Q9CJH2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJH2"
FT                   /protein_id="AAK04121.1"
FT                   /translation="MEIQKSLIKINQNFSNKEEAIKYCGSLLVDGGYVKPNYISAMIER
FT                   DRELSVYMGNFIAIPHGTDESKKEVLKTGVAIVQVPRGVNFGTVENPKIATMLFGIAGI
FT                   KEEHLELIQKISIFCADVDNVVKLADAQTIEEIAKYFEN"
FT   gene            33476..34633
FT                   /gene="mtlD"
FT                   /locus_tag="L33416"
FT   CDS             33476..34633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="L33416"
FT                   /product="mannitol 1-phosphate 5-dehydrogenase"
FT                   /EC_number="1.1.1.17"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.12 ENERGY METABOLISM.
FT                   Sugars"
FT                   /db_xref="EnsemblGenomes-Gn:L33416"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04122"
FT                   /db_xref="GOA:Q9CJH1"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJH1"
FT                   /protein_id="AAK04122.1"
FT                   /translation="MKKAVHFGAGNIGRGFIGEILSKNGFDIHFVDTNKSIIAELNNRH
FT                   SYEIGIASSEHEKISVKAVSGINNSENPEAVIEAIAKADILTTAIGPNVLPYIAELIAK
FT                   GLQKRKEEKVQSPLDIIACENMIGGSEFLEEKVSDYLSESDKLYLSKFIGFPNAAVDRI
FT                   VPAQKHKDVLYVEVEPFSEWVIDASHLKNKEIKLEGVHYTTDLEPFIERKLFSVNSGHA
FT                   AVAYSSAYKGYKTILEGLQDEEILNILKAVQKETRALLLAKWAQYFKQDELIKYHELII
FT                   SRFSNPEIIDEVSRVARTPIRKLGYDERFIRPIRELNDRKLSYQNHLDIVGKIFAYHDE
FT                   NDAQAIQLQEKLKITELPMLIEEVTGLSNQKLILEIEKVINHYKK"
FT   gene            complement(35516..35839)
FT                   /gene="ps101"
FT                   /locus_tag="L35519"
FT   CDS             complement(35516..35839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps101"
FT                   /locus_tag="L35519"
FT                   /product="prophage ps1 protein 01, hypothetical regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. weak homology to
FT                   different bacterial sigma factors"
FT                   /db_xref="EnsemblGenomes-Gn:L35519"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04123"
FT                   /db_xref="GOA:Q9CJH0"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJH0"
FT                   /protein_id="AAK04123.1"
FT                   /translation="MNKTEFNIRLYLSGVMESWTDRIDSTGEETPQRFILNAMTELFES
FT                   LSDDDIELIRLRYTERLTLSEVASRYLLNERTVRNHTNPAIKQVKEIIKKATEQAQHAR
FT                   EVD"
FT   gene            complement(35864..36274)
FT                   /gene="ps102"
FT                   /locus_tag="L35867"
FT   CDS             complement(35864..36274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps102"
FT                   /locus_tag="L35867"
FT                   /product="prophage ps1 protein 02"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. 49% identical to a
FT                   hypothetical protein of Lactococcus lactis subsp. cremoris
FT                   S114 (acc no Y11901)"
FT                   /db_xref="EnsemblGenomes-Gn:L35867"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04124"
FT                   /db_xref="InterPro:IPR007927"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJG9"
FT                   /protein_id="AAK04124.1"
FT                   /translation="MKDKTDRIISDYINGRTQAKIKAIESRYIYRVKQDNLGIRTAYKG
FT                   TAEPEGNTLDKERMEEDKELIGLRRTLELLGALYNTLTVSEKRIIELRYKGYNGYTWYR
FT                   VAMELESAGIDIPIKRAKKIYFAFKEDVSRVL"
FT   gene            complement(36271..36714)
FT                   /gene="ps103"
FT                   /locus_tag="L36274"
FT   CDS             complement(36271..36714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps103"
FT                   /locus_tag="L36274"
FT                   /product="prophage ps1 protein 03, terminase subunit"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. ESSENTIAL FOR PHAGE
FT                   DNA MATURATION AND PACKAGING"
FT                   /db_xref="EnsemblGenomes-Gn:L36274"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04125"
FT                   /db_xref="GOA:Q9CJG8"
FT                   /db_xref="InterPro:IPR005335"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJG8"
FT                   /protein_id="AAK04125.1"
FT                   /translation="MTPKQRKFCDEYIKTGNATQSAINAGYSQKTAKSIGAENLTKPDL
FT                   KKYIDSKLKDISNNAIATAEETLTILTQIVRGEHTEQVITAEGDVIDKHPDTNQVIRAS
FT                   AEILKRYPLTQDINIKGNLKVSNPFENLTEEELRTLASREGEA"
FT   gene            complement(36847..37428)
FT                   /gene="ps104"
FT                   /locus_tag="L36850"
FT   CDS             complement(36847..37428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps104"
FT                   /locus_tag="L36850"
FT                   /product="prophage ps1 protein 04"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L36850"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04126"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJG7"
FT                   /protein_id="AAK04126.1"
FT                   /translation="MSQNTKTILSNLFTLTSELSEPTSKLINIEGANETPANQKDLLEG
FT                   LRENLVNLTEVLGLSVDELTETQEDEPQETVKSIIKEMQELTFAPHEISGNDTQVFADL
FT                   LTDSIERLIKALGLNEMSLSAESKNKPHELALKTQLQDLHALNHSMFKEDIHEVPRFTD
FT                   GTIITAKDLADMNINALDNIAELIGFELEE"
FT   gene            complement(37664..39292)
FT                   /gene="ps105"
FT                   /locus_tag="L37667"
FT   CDS             complement(37664..39292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps105"
FT                   /locus_tag="L37667"
FT                   /product="prophage ps1 protein 05, DNA primase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. 45% identical to
FT                   putative primase of Streptococcus thermophilus
FT                   bacteriophage DT1"
FT                   /db_xref="EnsemblGenomes-Gn:L37667"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04127"
FT                   /db_xref="InterPro:IPR004968"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJG6"
FT                   /protein_id="AAK04127.1"
FT                   /translation="MTDQLEKLVAETPQENVRSPKPKIEDFTDYGEDGKKVVNVAGYQE
FT                   CLKDWLEQEKEIINSPDYVKAHTQTLRAVKKLFFEHRNLFLSTPKEDGNAPKSLSPLDT
FT                   ARIIYKTLKVIKLDHQSGLLGVYNPELGIYETNENFFHRLIYWLEPSYSQARSKEVLFK
FT                   LETLAEVKQQTTEAHLIPVANGIFNKKTQQLEPFSPKYVFTSTIATKYNDKAKVPNING
FT                   WNVDGWLLDLMSGDKELVSLLWQIISASTNGNYSYRKGVWLVGKGNDGKGTFQSLIMNL
FT                   IGRENVASVKAEQFAERFALSQVVGKTCIIGDDSQVSYLDNAGNYFSVVTGDPVPIEAK
FT                   GKQPTLAVFNKLVIQSTNFLPKFRNKSNGTYRRLLIVPFEKSFTADNDDWKIKDDYIKR
FT                   KDVLEYVLKIALSLNFEKFDEPKATQGLLDDFKISNDNVLAFVNDMFEEFVSDFLPTAF
FT                   ISALYRAWCEDEGVKPFTKREFENKLPDYVKDQWKKTVQRPNSAGFNRAVDLHRANEME
FT                   LFRRLFYWDDEKHKKVTKGYSRKKK"
FT   gene            complement(39303..40097)
FT                   /gene="ps106"
FT                   /locus_tag="L39306"
FT   CDS             complement(39303..40097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps106"
FT                   /locus_tag="L39306"
FT                   /product="prophage ps1 protein 06"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. 25% identical to
FT                   Orf1 of Streptococcus thermophilus bacteriophage SFi18"
FT                   /db_xref="EnsemblGenomes-Gn:L39306"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04128"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJG5"
FT                   /protein_id="AAK04128.1"
FT                   /translation="MTPKEQALNCISRGFSVIAGYPVGKSERAIIKGSSSGSLDEITVS
FT                   AWFDEIPNRNIMINLRNSGLICIDLDQHQNGQNGRNVFSRLWNEHSEGEILSTYVEKTP
FT                   TGNGLHVFFKVPKTIFNSPLVSELADGVEIKTHFTPIYPSKRTDGDYIPLNDTETNEPL
FT                   TFDSLCDCPDWLLEMIQRPQARATTGTSSRTYGAEMWELFNQGARKGNRNNDTNRILHY
FT                   WRKIGIDNNSCMDLLRTFNNRTSPPLPDDELATIWKSVFKMK"
FT   gene            complement(40101..40430)
FT                   /gene="ps107"
FT                   /locus_tag="L40104"
FT   CDS             complement(40101..40430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps107"
FT                   /locus_tag="L40104"
FT                   /product="prophage ps1 protein 07"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L40104"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04129"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJG4"
FT                   /protein_id="AAK04129.1"
FT                   /translation="MKITDLQTLDQNIIKFLAEHRGIDRAVKGKILAQALDIDFRTLQS
FT                   RIEYLHKQGCAIGSIDNGYFIPTNEDERRAGIIKKQRTGIAINNAVNGYTLAELDWIDQ
FT                   LFKEE"
FT   gene            complement(40608..40862)
FT                   /gene="ps108"
FT                   /locus_tag="L40611"
FT   CDS             complement(40608..40862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps108"
FT                   /locus_tag="L40611"
FT                   /product="prophage ps1 protein 08"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L40611"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04130"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJG3"
FT                   /protein_id="AAK04130.1"
FT                   /translation="MIEHHQGYTARKRLRRNSFRTIGKHPYKMIHNARAVKYDLIQQFE
FT                   ASTSINLPSGVKSNLCTQVSPVLGKQLAIMKLQIKETKP"
FT   gene            complement(40859..41098)
FT                   /gene="ps109"
FT                   /locus_tag="L40862"
FT   CDS             complement(40859..41098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps109"
FT                   /locus_tag="L40862"
FT                   /product="prophage ps1 protein 09"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L40862"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04131"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJG2"
FT                   /protein_id="AAK04131.1"
FT                   /translation="MTNIIRACPYVAGIDSVGMRSLKGYHTELTDKQIEKIDPLNANTG
FT                   TVDYSFKVRKYKHGVRFEGEKEGGEISLFDEVAK"
FT   gene            complement(41141..41422)
FT                   /gene="ps110"
FT                   /locus_tag="L41144"
FT   CDS             complement(41141..41422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps110"
FT                   /locus_tag="L41144"
FT                   /product="prophage ps1 protein 10"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L41144"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04132"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJG1"
FT                   /protein_id="AAK04132.1"
FT                   /translation="MNDDTLTNLVARGLVDEVIHLFNKYLGTQLKIRNEKRVLPYISKK
FT                   RVMEDLDISDGTLDNWEKHGLNRYKPRYKTSLIYYLIDDICKFIVIDT"
FT   gene            complement(41419..41670)
FT                   /gene="ps111"
FT                   /locus_tag="L41422"
FT   CDS             complement(41419..41670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps111"
FT                   /locus_tag="L41422"
FT                   /product="prophage ps1 protein 11, transcriptional
FT                   regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. BELONGS TO THE
FT                   PBSX(XRE) FAMILY OF TRANSCRIPTIONAL REGULATORS"
FT                   /db_xref="EnsemblGenomes-Gn:L41422"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04133"
FT                   /db_xref="GOA:Q9CJG0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJG0"
FT                   /protein_id="AAK04133.1"
FT                   /translation="MKFTSRYTLKDLRELNHLTLKQVARKVKLNRERIAELEQDSSFIT
FT                   IDEMFRFSKFYGLSIKYIFIGEQVDFDRKLNEYLGGTP"
FT   gene            complement(41667..42188)
FT                   /gene="ps112"
FT                   /locus_tag="L41670"
FT   CDS             complement(41667..42188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps112"
FT                   /locus_tag="L41670"
FT                   /product="prophage ps1 protein 12"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. 25% identical to a
FT                   putative DNA polymerase of Neurospora crassa mitochondrion
FT                   plasmid maranhar"
FT                   /db_xref="EnsemblGenomes-Gn:L41670"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04134"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJF9"
FT                   /protein_id="AAK04134.1"
FT                   /translation="MKFKTFNLRAYHRKDETILSFVLKGGRIPTSRILYIKKGNPFKMK
FT                   ITHEIAEKYRIKQEIKQTRKKTDSPNGLYPLIEAIEKDVSQLLNKQDKDDWEGWKRVFA
FT                   YEYLYDVAFNRGVRQERQRRKTQHKALTAFDIISSEDVSELSNELGISEDKLTYAVMEV
FT                   ISKRKNGGMA"
FT   gene            complement(42192..42386)
FT                   /gene="ps113"
FT                   /locus_tag="L42195"
FT   CDS             complement(42192..42386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps113"
FT                   /locus_tag="L42195"
FT                   /product="prophage ps1 protein 13"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L42195"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04135"
FT                   /db_xref="InterPro:IPR012450"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJF8"
FT                   /protein_id="AAK04135.1"
FT                   /translation="MNTPINKETYILDDSIAFELMDLLKAKARHFIQLNEYVYRLFDGQ
FT                   SVVTFTTLENNIQVEMVKG"
FT   gene            complement(42462..43202)
FT                   /gene="ps114"
FT                   /locus_tag="L42465"
FT   CDS             complement(42462..43202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps114"
FT                   /locus_tag="L42465"
FT                   /product="prophage ps1 protein 14"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. 25% identical to Rha
FT                   protein of E.coli phage phi-80"
FT                   /db_xref="EnsemblGenomes-Gn:L42465"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04136"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJF7"
FT                   /protein_id="AAK04136.1"
FT                   /translation="MNEITVSLDVIIKNKNVIVSSLSVAKAFDRQHSHILRSIEDIKRD
FT                   WDSLIQSKNGLNRNIIPLKSQGNKQVIFTDYFKESEYIAENGRLVKFFEMNRNGFMLLA
FT                   NSFNGKRILPIKLAFIERFDELEHITLEQAKETENRKNLNQAIKESPHFKPFYYSRFSD
FT                   FLCQLITHNKYKTVKKLREDKGYYGKQFSKIPLKSLLDSEEDLKRLQKLENSIIAWLEI
FT                   DYSFREIKAFLTKEKAQPLPTKKA"
FT   gene            43689..44075
FT                   /gene="ps115"
FT                   /locus_tag="L43680"
FT   CDS             43689..44075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps115"
FT                   /locus_tag="L43680"
FT                   /product="prophage ps1 protein 15, transcriptional
FT                   regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. 28% identical to Rad
FT                   protein of Lactobacillus bacteriophage phi adh"
FT                   /db_xref="EnsemblGenomes-Gn:L43680"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04137"
FT                   /db_xref="GOA:Q9CJF6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJF6"
FT                   /protein_id="AAK04137.1"
FT                   /translation="MTIFERVQELSRKQGKTLQKVANDLGFGDNYLYTLKKQKPKADNL
FT                   EKLADYFHVSVDYLLGRAEAKPVNEPIDLAEVANSDDDAIFDSILSAGGRPLTEKDKAM
FT                   IKLVFADRWEELQQKAKDLKDSEK"
FT   gene            44085..44639
FT                   /gene="ps116"
FT                   /locus_tag="L44085"
FT   CDS             44085..44639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps116"
FT                   /locus_tag="L44085"
FT                   /product="prophage ps1 protein 16"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L44085"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04138"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJF5"
FT                   /protein_id="AAK04138.1"
FT                   /translation="MNQEELTALIVIKIENLGIDYRTFEYDNQRAWIDTRLCIGGYNPN
FT                   LATPFDHAHEYMHAYYKDDRRLGECDTLSPTEKRANKEAILMLWDWFIQNGGNFDDITQ
FT                   FCEITGCHYDATKRLITSMCCDTTTKNFRECAIDYVSHFDIITRDTLNIYNFLDFYGYH
FT                   HNAYDEARALLYELCWFELVG"
FT   gene            44750..44980
FT                   /gene="ps117"
FT                   /locus_tag="L44747"
FT   CDS             44750..44980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps117"
FT                   /locus_tag="L44747"
FT                   /product="prophage ps1 protein 17"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L44747"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04139"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJF4"
FT                   /protein_id="AAK04139.1"
FT                   /translation="MKNIVDELKKEQKINLLLFVVLNLLFIFIVKTNFVYMIALNIALI
FT                   TNIFIKHINKFAKIALYTISFILFVLSIVAF"
FT   gene            45053..45247
FT                   /gene="ps118"
FT                   /locus_tag="L45035"
FT   CDS             45053..45247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps118"
FT                   /locus_tag="L45035"
FT                   /product="prophage ps1 protein 18"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L45035"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04140"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJF3"
FT                   /protein_id="AAK04140.1"
FT                   /translation="MKLSDYLKSIDNLDEKMEKAVIIAGYEKMFGEHYRLPQEQFADLM
FT                   ELPLPKLRRVIHEMKKAID"
FT   gene            45399..45641
FT                   /gene="ps119"
FT                   /locus_tag="L45351"
FT   CDS             45399..45641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps119"
FT                   /locus_tag="L45351"
FT                   /product="prophage ps1 protein 19"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L45351"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04141"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJF2"
FT                   /protein_id="AAK04141.1"
FT                   /translation="MDNITNESDNLIQIFSHNPLALISCIILGIGLLFTFASRQFILVR
FT                   VLLGNVSFIKQRILGVIFGIVGALLLLFATGNLNL"
FT   gene            45777..46001
FT                   /gene="ps120"
FT                   /locus_tag="L45702"
FT   CDS             45777..46001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps120"
FT                   /locus_tag="L45702"
FT                   /product="prophage ps1 protein 20"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L45702"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04142"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJF1"
FT                   /protein_id="AAK04142.1"
FT                   /translation="MIITMITKKEIKDRFERTSGGILSGVEIITDKNTGVQYMVVNKDS
FT                   DGCGITPLIDKNGKPLLAKPDSESHFDLY"
FT   gene            47370..47585
FT                   /gene="ps121"
FT                   /locus_tag="L47364"
FT   CDS             47370..47585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps121"
FT                   /locus_tag="L47364"
FT                   /product="prophage ps1 protein 21"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L47364"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04143"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJF0"
FT                   /protein_id="AAK04143.1"
FT                   /translation="MGLSHNKMIKSKVGLTDFTTDYGLTQKRVALTHLFLISMVSEDSA
FT                   LLRSPKSEESTLLCSRLSEKRESSYL"
FT   gene            47988..48293
FT                   /gene="ps122"
FT                   /locus_tag="L47979"
FT   CDS             47988..48293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps122"
FT                   /locus_tag="L47979"
FT                   /product="prophage ps1 protein 22"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. 33% identical to
FT                   lactococcin A immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:L47979"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04144"
FT                   /db_xref="InterPro:IPR015046"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJE9"
FT                   /protein_id="AAK04144.1"
FT                   /translation="MADNDKTSQIKLDFLNTLYNLILSEDIKEEERRVLTKAKNLVEKG
FT                   EYIPNVIRRMQTNFTLDAINSNLSPSVSEFYSTLPKILAEILPAFPGTGSSLGIPL"
FT   gene            48543..49727
FT                   /gene="ps123"
FT                   /locus_tag="L48477"
FT   CDS             48543..49727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps123"
FT                   /locus_tag="L48477"
FT                   /product="prophage ps1 protein 23, integrase"
FT                   /db_xref="EnsemblGenomes-Gn:L48477"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04145"
FT                   /db_xref="GOA:Q9CJE8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJE8"
FT                   /protein_id="AAK04145.1"
FT                   /translation="MNIKEYTKKDGTKVYRANVYLGVDSLTGKQVRKVITAKSEKMCNT
FT                   KISRAINEFEKNGQTVRKVSVDDFKDIAMLWFDSYKLGVKPRTVQIMQTRLNNYVLPAL
FT                   GEYRIDKVNSIILQQIVNQWMINASQPLNGAYHRPKGKGKDFKIYFNIVERIFKHALSL
FT                   GLVKDNPCVNVIVPKVRLESTEKKVKHLTAEQLKIFFEYIGALPKEKYTNELMTGLCRL
FT                   LVASGLRIGEAVALSWSDIDFKTGSVSVSKTTLRAVIQSTPKTDKSNRIVLIDSKAVEV
FT                   LKHWELFQAKYFMSIGKGKQELVFPNRTGGVLDYQTMRPFLIKWLRACQLPQVGFHGFR
FT                   HSHASLLLNADVPYKEIQERLGHASIKMTMDTYSHLESDNKIKAVERFESIVNF"
FT   gene            50180..50629
FT                   /gene="yafE"
FT                   /locus_tag="L50174"
FT   CDS             50180..50629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafE"
FT                   /locus_tag="L50174"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   paralogous to yfhA"
FT                   /db_xref="EnsemblGenomes-Gn:L50174"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04146"
FT                   /db_xref="GOA:Q9CJE7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJE7"
FT                   /protein_id="AAK04146.1"
FT                   /translation="MLIRNYESKDLDEVINLFKNTIFEVNISDYTLEQVKAWVDVDTEL
FT                   FDDNLAKTYARVISNHEQLVGFGNIDDKGYIDLFYVSADYQRQGVGQKLLNDLEKSSNY
FT                   TSFMVNSSITAKPFFEKMGYKETKKNCVHLRGQNFVNFTLKKVVE"
FT   gene            50706..50948
FT                   /gene="yafF"
FT                   /locus_tag="L50682"
FT   CDS             50706..50948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafF"
FT                   /locus_tag="L50682"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L50682"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04147"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJE6"
FT                   /protein_id="AAK04147.1"
FT                   /translation="MTTKTVNKHLFVWLGSFLFGGFGVDRFMRGQIGMGICKLLFNWAT
FT                   LGIWSFVDWIVALVKAYSTYNDTEDITFINGGYSR"
FT   gene            complement(51029..52411)
FT                   /gene="yafB"
FT                   /locus_tag="L1004"
FT   CDS             complement(51029..52411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafB"
FT                   /locus_tag="L1004"
FT                   /product="sulfate transporter"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.03 TRANSPORT AND BINDING
FT                   proteinS Anions. similar to several sulfate transporters"
FT                   /db_xref="EnsemblGenomes-Gn:L1004"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04148"
FT                   /db_xref="GOA:Q9CJE5"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJE5"
FT                   /protein_id="AAK04148.1"
FT                   /translation="MAAILISLIGKYGMNGIFIATFMAGIFLLLAGIFRLGNLISLIPS
FT                   PVITGFTSGIAIIIASGQIKNFFGIEHFTGSFFDLMKFISGLHIDYPSTIIGLLTILLM
FT                   IFYPKSWGKKFPASLLAILLSTLAVLALKLDIPLVGKIPTTLIPQAHLRLTELNPQDMK
FT                   TLLIPAISITVLGMTESLLCGASAGRATNHPMDNNQELVAQGIGNIFIPFFGGIPATAA
FT                   IARTSVAIKAGAQTRLTGIIHALILLLSMFLFAPFMTHIPLSALAGVLIMTAVRMNEWE
FT                   AIRFLFKNKLKSGIIEFFVTMIITVIFDLSTAILAGIVVGFLLFIVKISQIEINSSQIE
FT                   PERISQNHHEVFTDWTVIYISGPLFFLNSSKLKQAIDELPANTNAVLSLRGVPMIDVTS
FT                   IKLLIDIYSIFHKEERQIVFASMNPKLKESFKRTGLISMVGEEAIYPSVNEFLLDLVDK
FT                   NK"
FT   gene            52656..53027
FT                   /gene="yafG"
FT                   /locus_tag="L52494"
FT   CDS             52656..53027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafG"
FT                   /locus_tag="L52494"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.04 Transposon related
FT                   functions"
FT                   /db_xref="EnsemblGenomes-Gn:L52494"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04149"
FT                   /db_xref="GOA:Q9CJE4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJE4"
FT                   /protein_id="AAK04149.1"
FT                   /translation="MELKENAVQCYLTTDLTYEAVARKFEITNFTLLASWVNHFKIYGE
FT                   VPISKKRGRRKKLESIASSMTQNPNDSQRIKELEQELRYAQIEVAYLKGLRRLEKNALM
FT                   NKNQDSSTVSVKPSNSKKS"
FT   gene            53161..53844
FT                   /locus_tag="L0466"
FT   CDS             53161..53844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="L0466"
FT                   /product="transposase of IS1077A"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:1328163 BIO14.04
FT                   Transposon related functions. BELONGS TO THE
FT                   IS3/IS150/IS904 FAMILY OF TRANSPOSASE. There are 7 such
FT                   elements in the chromosome."
FT                   /db_xref="EnsemblGenomes-Gn:L0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04150"
FT                   /db_xref="GOA:Q9CJE3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJE3"
FT                   /protein_id="AAK04150.1"
FT                   /translation="MSELLKQRGYHVNHKKVQRLMKKLGLRVTSYWHKLRNHNSYKGKV
FT                   GTVAKNKLHRRFRTSIPHQKITTDTTEFKYYEDGIQKKCYLNPYIDLFNSEVISYHISK
FT                   HPSYQSIDIALNQALAVTSDCPYRRTFHSDQGWGYQMRDYVSKLKSHRIFQSMSRKGKC
FT                   HDNSVMENFFGLLKQEIYYGHIFSSFEELEQVIVIWIRYYNTKRIKQKLNWMSPIQFRL
FT                   NYQNN"
FT   gene            complement(53900..54661)
FT                   /gene="tra904A"
FT                   /locus_tag="L0457"
FT   CDS             complement(53900..54661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra904A"
FT                   /locus_tag="L0457"
FT                   /product="transposase of IS904A"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:1328163 BIO14.04
FT                   Transposon related functions. BELONGS TO THE
FT                   IS3/IS150/IS904 FAMILY OF TRANSPOSASE. There are 9 such
FT                   elements in the chromosome"
FT                   /db_xref="EnsemblGenomes-Gn:L0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04151"
FT                   /db_xref="GOA:Q9CB05"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CB05"
FT                   /protein_id="AAK04151.1"
FT                   /translation="MHRRPSKQQVEREILSEKIKAVFHEHKGRYGAVRITKVLHNTGIM
FT                   TNTKRVGKLMHLMGLYAKGSRYKYKHYNRKGASLSRPNLINQIFKATAPNKVWLGDMTY
FT                   IPTKEGTLYLAVNIDVFSRKIVGWSMSSRMQDKLVRDCFLQACGKEHPQPGLIVHTDQG
FT                   SQYTSSRYQSTLRQVSAQSSMSRKGNPYDNAMMESFYKTLKRELINDAHFETRAEATQE
FT                   IFKYIETYYNTKRMHSGLDYKSPKDFEKYNS"
FT   gene            complement(54757..55047)
FT                   /gene="yafI"
FT                   /locus_tag="L54760"
FT   CDS             complement(54757..55047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafI"
FT                   /locus_tag="L54760"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.04 Transposon related
FT                   functions"
FT                   /db_xref="EnsemblGenomes-Gn:L54760"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04152"
FT                   /db_xref="GOA:Q9CB12"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CB12"
FT                   /protein_id="AAK04152.1"
FT                   /translation="MARRKFDKQFKNSAVKLILEEGYSVKEVSQELEVHANSLYRWVQE
FT                   VEEYGESAFPGNGTALADAQHKIKLLEKENRYLKEELELLKKFRVFLKRSK"
FT   gene            complement(55126..55389)
FT                   /gene="yafJ"
FT                   /locus_tag="L55129"
FT   CDS             complement(55126..55389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="L55129"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   homology to hypothetical protein YvdB from B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L55129"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04153"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJE2"
FT                   /protein_id="AAK04153.1"
FT                   /translation="MIKQFLCIINSEFKDYNRRKFLQDLMAGITVAAVALPLALAFGVS
FT                   SGTTAAAGLITAIVAGIIISSLSGAFYQISGPTGAIDVHPKS"
FT   gene            55599..56120
FT                   /gene="yafC"
FT                   /locus_tag="L1005"
FT   CDS             55599..56120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafC"
FT                   /locus_tag="L1005"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L1005"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04154"
FT                   /db_xref="GOA:Q9CJE1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJE1"
FT                   /protein_id="AAK04154.1"
FT                   /translation="MIIKTINLENYNEVTELIRESFSQSEHGYGNEAELVDKIRNEEGY
FT                   IKDLEIVAFEDGKIVGHGLLSEVEIVSDSQKFKGLVLAPLDVLTTYQGKGIGAAVLLEL
FT                   EKRAKILDYPFISILGHETYYPKFGYVPASQYQIKAPFEVPDKNFMIKELTDGGLEGKS
FT                   GVIHYSEAFN"
FT   gene            56584..57759
FT                   /gene="araT"
FT                   /locus_tag="L56488"
FT   CDS             56584..57759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araT"
FT                   /locus_tag="L56488"
FT                   /product="aromatic amino acid specific aminotransferase"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:10543798 BIO06.02 ENERGY
FT                   METABOLISM. Amino acids and amines. involved in catabolism
FT                   of aromatic amino acids. BELONGS TO CLASS-I OF
FT                   PYRIDOXAL-PHOSPHATE-DEPENDENT AMINOTRANSFERASES."
FT                   /db_xref="EnsemblGenomes-Gn:L56488"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04155"
FT                   /db_xref="GOA:Q9CJE0"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJE0"
FT                   /protein_id="AAK04155.1"
FT                   /translation="MDLLKKFNPNLDKIEISLIRQFDQQVSSIPDVIKLTLGEPDFYTP
FT                   EHVKQAGIVAIENNQSHYTGMAGLLELRQAASEFMNKKYGLSYAAEDEILVTVGVTEAI
FT                   SSVLLSILVAGDEVLIPAPAYPGYEPLITLAGGSLVEIDTRANDFVLTPEMLEQAIVER
FT                   EGKVKAVILNYPANPTGVTYNRGQIKALAEVLKKHEVFVIADEVYSELNYTDQPHVSIA
FT                   EYAPEQTIVLNGLSKSHAMTGWRIGLIFAARELVAQIIKTHQYLVTSASTQSQFAAIEA
FT                   LKNGAYDALPMKKEYLKRRDYIIEKMSDLGFKIIEPDGAFYIFAKIPADLEQDSFKFAV
FT                   DFAKENAVAIIPGIAFGQYGEGFVRLSYAASMDMIEQAMARLTDYVTKKRG"
FT   gene            57858..58613
FT                   /gene="yafD"
FT                   /locus_tag="L1006"
FT   CDS             57858..58613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="L1006"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   25% identical to RecO from different bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:L1006"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04156"
FT                   /db_xref="GOA:Q9CJD9"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJD9"
FT                   /protein_id="AAK04156.1"
FT                   /translation="MRDAETQGLVLYSRNYKEKDKLVKIFTESFGKRMFFVKNFGKSPY
FT                   ASSLQAFTDGKLTATINDGGFSFIEDVSEVVVYKNISSDIFINAHASYIISLADAAISD
FT                   NQYDPGLYGFLKRSLELLDQGFDMEVVTNIFELQVLHRFGISLNFSECAFCHKTVGPFD
FT                   FSYKFSGCLCPQHFDEDLRRSHLDPNVIYLVNLFQEISLDELKKISIKADMKLKIRQFI
FT                   DGLYDEYVGIHLKSKKFLDGMSGWADIMK"
FT   gene            complement(58971..60389)
FT                   /gene="pdhD"
FT                   /locus_tag="L0036"
FT   CDS             complement(58971..60389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhD"
FT                   /locus_tag="L0036"
FT                   /product="lipoamide dehydrogenase component of PDH complex"
FT                   /EC_number="1.8.1.4"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.11 Pyruvate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:L0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04157"
FT                   /db_xref="GOA:Q9CJD8"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJD8"
FT                   /protein_id="AAK04157.1"
FT                   /translation="MVVGAQATEVDLVVIGSGPGGYVAAIRAAELGKKVTIIEKDNVGG
FT                   VCLNIGCIPSKALINIGHHYQESLEEEKGENPFGLSVGNVKLNWESAQKWKQDKVVNQL
FT                   TGGVKMLLKKHKVDVIQGTAEFIDNNTINVEQEDGFQLLQFNDVIISTGSRPIEIPSFP
FT                   FGGRIIDSTGALSLPEVPKHLIIVGGGVIGSELGGAYRMLGSKITIVEGLDHILNGFDK
FT                   EMSDIIANRVKSAGSEIFTSAMAKSATQTDKDVTLTFEVDGKEQTVTGDYLLVSVGRRP
FT                   NTDLIGLNNTDVKLTDRGLIEVDDSYATNVPHIYAIGDVVPGPMLAHKASFQAKVAAAA
FT                   IAGAEDDVDLHVALPAVAYTTTELATVGETPESVKDRKDVKISKFPFAANGRAISMNDT
FT                   TGFLRLITETKEGALIGAQIVGPGASDLISGLSLAIENGLTSKDISLTIQPHPTLGEAI
FT                   MDTAELADGLPIHV"
FT   gene            complement(60583..62181)
FT                   /gene="pdhC"
FT                   /locus_tag="L0035"
FT   CDS             complement(60583..62181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhC"
FT                   /locus_tag="L0035"
FT                   /product="dihydrolipoamide acetyltransferase component of
FT                   PDH complex"
FT                   /EC_number="2.3.1.12"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.11 Pyruvate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:L0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04158"
FT                   /db_xref="GOA:Q9CJD7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJD7"
FT                   /protein_id="AAK04158.1"
FT                   /translation="MTEIFKMPDIGEGMHEGDIANWLVKVGDVVKEDDPIAEVQNDKLM
FT                   QEILSPYSGTVTKLFVEAGTTVEVDSPLVEFDGDGSGSSAAAPTPQETAGSDTATTDAP
FT                   SGEAQIFTMPDIGEGMHEGDIANWLVKVGDEIKEDDPVAEVQNDKLMQEILSPYSGKVT
FT                   KLFVEAGTTVEVGAPLIEYNGNGAAPAAASPAPVAEAPKAASPASPANAPLTKTTSTGH
FT                   ILAMPSVRHYARKAGIDLSQVPATGRHGHTTLADVKAFESGSVAPIAQTTPEAAPAPKA
FT                   DKPAAPVAEKAPSVKAGAGDRREAMNPTRKVVSKVMTAQHTHIPPVTNFDQVEVSKLVK
FT                   HRAVFKEIAAKQDIKLTYLAYVAKALATTAHKFPDINASVDYEKQEIVYHEHVNLGIAV
FT                   NAPTGLYVPVIHEAETKSILEIAKEIAELATATREGTLKPQQMQGSTITISNIGSARGS
FT                   WFTPIINGSDVVILGLGSIVKEPIVNGEGEIVVGQNMKLSMTYDHRLIDGMLGQTSLNY
FT                   LKSLLADPEFMLMEI"
FT   gene            complement(62174..63154)
FT                   /gene="pdhB"
FT                   /locus_tag="L0034"
FT   CDS             complement(62174..63154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhB"
FT                   /locus_tag="L0034"
FT                   /product="PDH E1 component beta subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.11 Pyruvate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:L0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04159"
FT                   /db_xref="GOA:Q9CJD6"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJD6"
FT                   /protein_id="AAK04159.1"
FT                   /translation="MAVKTYIAAITEALDLALEKDKDALIFGEDVGQNGGVFRATDGLQ
FT                   AKYGEERVFNTPLAESGIGGMAIGLATQGFHPIMEIQFGTFIFEVFDSIAGQMSRTRYR
FT                   FNNTRSNNIVVRTPYGIGTKTPEMHADSIEGLFSQIPGIRVVMPSNPADAKGLLLASIE
FT                   NNDPVIFLENLHLYRSLKGEVPEGYYTTPLDTAAVAKEGSDVSIIAYGGTVPLALKAAE
FT                   QLEKDGIKAEVLDLRTVAPLDIESIGKTVEKTGRVVVVQEAQRTAGIAANVMAEISERF
FT                   VLNLKAPIGRVSGPDSIFPFAQAENDWAVKAEDIVNKVKEVVDYD"
FT   gene            complement(63157..64281)
FT                   /gene="pdhA"
FT                   /locus_tag="L0033"
FT   CDS             complement(63157..64281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /locus_tag="L0033"
FT                   /product="PDH E1 component alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.11 Pyruvate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:L0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04160"
FT                   /db_xref="GOA:Q9CJD5"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJD5"
FT                   /protein_id="AAK04160.1"
FT                   /translation="MSNSEQILDFKAQLELQDTTFPMLQILNEEGKIVDEDGLKRAGLS
FT                   DEKLVELFKSMLFARQVDIRSMKLAKQGRMGFFGPHAGQEASQMASSFAFTDEDWLFPG
FT                   YRDLPQIYAKGWPIWKGLLWSRGHQLGNEYTTDDGKPVNSWFPQIIIGAQYVEAAGVAL
FT                   GLKKRKKDAVAFVYTGDGGSSQGDTYEGINFAGAYKAPLVAFIQNNGYAISTPRSLQSA
FT                   APHLAAKGWAAGAPSIVVDGMDAIAMYLASKEARAWAVAGNGPVVIEAITNRLEPHSTA
FT                   GDDPLRYRTKEDIEAWWKKEPLVRMRNFLTEKGLWDTEKEEAYIAELDAGIDADIKKAN
FT                   NVEKQKISSFIKNTLEVPSQAMAEQIAKFESEGK"
FT   gene            complement(64370..65371)
FT                   /gene="lplL"
FT                   /locus_tag="L64373"
FT   CDS             complement(64370..65371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplL"
FT                   /locus_tag="L64373"
FT                   /product="lipoate-protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:L64373"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04161"
FT                   /db_xref="GOA:Q9CJD4"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJD4"
FT                   /protein_id="AAK04161.1"
FT                   /translation="MQFINYLGQDAYTNIAMDSWLLYHLKPTEPVFALWQNKRAVIVGR
FT                   NQNTFAEVNQDYIDSHDVQVVRRVSGGGAVYHDEGNICFTFFVPVENSGSVNFKKFVQP
FT                   MYEALHAVGIKAEITGRNDLEVEGKKISGNAQRYAGGYLMHHGTLLWDTDVEAMIRSLN
FT                   VSDEKFVSKAAKSVRARVGNIKDFAPEDLTLDSFIDALKYYLTDEGKDGELVLTDDQLS
FT                   SIKKIRDEQFATWDWNYGESPKFSFQNHAKFTGGAIDIQVNVENGKITEINFQGDFLGV
FT                   RDWRDIKEQFIGLEFEPSAILEVLETNKEGQYFGTIQNTELSEMFKADYRTD"
FT   gene            complement(65571..66416)
FT                   /gene="yagA"
FT                   /locus_tag="L1007"
FT   CDS             complement(65571..66416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagA"
FT                   /locus_tag="L1007"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved. 33% identical to glycerophosphoryl diester
FT                   phosphodiesterases from different bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:L1007"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04162"
FT                   /db_xref="GOA:Q9CJD3"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJD3"
FT                   /protein_id="AAK04162.1"
FT                   /translation="MSGFTKIVFKLHNFLDRNKIKNNLKFKPSLTSKTLVFAHRGSKSN
FT                   CPENTLAAFHEAVRVHADGIELDVHLSLDNELIVIHDEKIDRTTNGKGLVKNMNAVDLK
FT                   KFDAGSWFNPKFTDEKIPTLSEVLKLLTDLSFTGYLNIEIKTDKFDYPGIEKKLSDLMK
FT                   ETKWPFSYIYSSFNFDSLKKIHTFDSKAEVNYLTKNLLTLKSHYKGSSTDFISGIHPRR
FT                   TYAFKHPLLLKSSKRPLRLWTVNQETEIRQAFQQHVAGIITDFPERALEIRREIQDQSK
FT                   "
FT   gene            complement(66497..67147)
FT                   /gene="yagB"
FT                   /locus_tag="L1008"
FT   CDS             complement(66497..67147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagB"
FT                   /locus_tag="L1008"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved. the protein exists in AT rich Gram positives and
FT                   in Archae"
FT                   /db_xref="EnsemblGenomes-Gn:L1008"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04163"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJD2"
FT                   /protein_id="AAK04163.1"
FT                   /translation="MIDLKKIKRFAQEIHDKNNDGHGFDHIERVVALARKILLTEPSAN
FT                   QELVLATCYLHDTYDEKLTDDVPKQKVKVAQFLNELKIDKKLIDELFMIIDNMSFSSNL
FT                   IERKTLSLNGQIVQDADRLDAMGAWGIVRTLEYGWAKNRVFYDPNLPPLDYNSKEDYHS
FT                   QKNNSTLNHFYEKLFLLKDLLNTTEGKRLGEKRDKIMHLFVSQIEEEYKETHL"
FT   gene            complement(67264..68289)
FT                   /gene="trpS"
FT                   /locus_tag="L0358"
FT   CDS             complement(67264..68289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="L0358"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.01 Amino acyl tRNA
FT                   synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:L0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04164"
FT                   /db_xref="GOA:Q9CJD1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJD1"
FT                   /protein_id="AAK04164.1"
FT                   /translation="MTKPTILTGDRPTGKLHIGHYVGSLQNRVKMQNEDKYNMFVFLAD
FT                   QQALTDHAKEPELIRQSVGDVALDYLAAGLDPEKSTIFIQSQIPELAELSMYYMNLVSL
FT                   ARLERNPTVKTEIAQKAFGESIPAGFLVYPVSQAADITAFKATHVPVGNDQKPMIEQTR
FT                   EIVRSFNNAYHTDVLVEPEGIYPENEAAGRLPGLDGNAKMSKSLGNGIFLADDMDTLKK
FT                   KVMSMYTDPDHIKVEDPGKIEGNMVFHYLDVFGKAEDAEQISEMKAQYQAGGLGDVKTK
FT                   RFLLDVLDRELSPIRERRIEFAQNMDYVYDMLKAGSLKAQAVASQTLDEVKSAMGINYF
FT                   K"
FT   gene            68791..69228
FT                   /gene="osmC"
FT                   /locus_tag="L68759"
FT   CDS             68791..69228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmC"
FT                   /locus_tag="L68759"
FT                   /product="osmotically inducible protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.01 Adaptations and
FT                   atypical conditions. there are three paralogs in L.lactis.
FT                   49% identical to osmotically inducible protein OsmC of
FT                   E.coli"
FT                   /db_xref="EnsemblGenomes-Gn:L68759"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04165"
FT                   /db_xref="GOA:Q9CJD0"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJD0"
FT                   /protein_id="AAK04165.1"
FT                   /translation="MKNISTASAHWEDTLENGFGTISAESSQIFTETPYNFKARSESQA
FT                   HITTPEELLGAAHAACFSMAFSMVLGQKGLVATSIDTTADVTFEATADGPAITKIKLTN
FT                   RSVVPGLSEADFQEIAKVVKESCPVSKALSGVDIELEATLG"
FT   gene            69389..70702
FT                   /gene="yagE"
FT                   /locus_tag="L69353"
FT   CDS             69389..70702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagE"
FT                   /locus_tag="L69353"
FT                   /product="amino acid permease"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.02 TRANSPORT AND BINDING
FT                   proteinS. Amino acids, peptides and amines. similar to many
FT                   amino acid permeases"
FT                   /db_xref="EnsemblGenomes-Gn:L69353"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04166"
FT                   /db_xref="GOA:Q9CJC9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJC9"
FT                   /protein_id="AAK04166.1"
FT                   /translation="MKENKLLSPAAIFLLGVNSIIGSGIFLLSGKIYEDAGIWSLLAIL
FT                   CAGLSIFVIAFAYANMSKIYSKNGGAFVYAKETFGRFPGFIVGMVTWLLGTVTLATEVS
FT                   VLLTAMKMILPNLNSRLIGIIIILALGIISYFGSSIIAGLDNLTSFVKIVLVLVFIFTC
FT                   LWLVRGLNFSSPNLLTASSANLGGFKGFLSAYGTVFFFFTGFSFLPVNAEKMKNPAKNL
FT                   PKMMSLVMLTCLAVYLIIQTITIGALGPELTKTLVPAATAFSKIVGSIGIPLFVVGICF
FT                   SIFGVIVATTFNTPTILASLAQAHEDVPMFVSKNNRFGTPTWAIILTTVCGIALFLSGN
FT                   YVFLSGLTVFMSFVQYLSTGLANIKKKFLLIGIGSVLFSLVLLTSFTLSVLILGLGILI
FT                   LLVMIYFVVKLDDDEREKWLKEHQEKSKGADVNTVKRL"
FT   gene            70762..71112
FT                   /gene="yahC"
FT                   /locus_tag="L70747"
FT   CDS             70762..71112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahC"
FT                   /locus_tag="L70747"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L70747"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04167"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJC8"
FT                   /protein_id="AAK04167.1"
FT                   /translation="MTKKEYTFWLLSSIFLIIGLILQFIPSHSIQNASFTALIIGLVLV
FT                   FFIKDKNESRKPLPEKFYQKKVFWAWIFIPLFVILFIYSIFLKKESPYNFMMIILVVDM
FT                   IIFNYFGTKYKW"
FT   gene            complement(71171..72166)
FT                   /gene="plsX"
FT                   /locus_tag="L71174"
FT   CDS             complement(71171..72166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="L71174"
FT                   /product="fatty acid/phospholipid synthesis protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO07.01 FATTY ACID AND
FT                   PHOSPHOLIPID METABOLISM. General. exact biochemical
FT                   function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:L71174"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04168"
FT                   /db_xref="GOA:Q9CJC7"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJC7"
FT                   /protein_id="AAK04168.1"
FT                   /translation="MKIAIDAMGGDFAPENIVKGVNLAKKELSDVTFQLYGDGAKIRQF
FT                   LDDETNIEIVETTEIIDFHDDPVAAIKSKKDSSLVRAVTAVKKGEADAVLSAGSTGALL
FT                   TAGLLLVKRIKQVSRPALMSTLPTADGRGFDMLDLGANTENTAHHLVDFAILGSYYAEN
FT                   VRGINKPRVALISNGAEESKGSPTVKEAHEILSAMSEINFIGNIESRDLLSGGADVVVT
FT                   DGFTGNAILKAIEGTATVLMKEIKSAIMAGSVTTKIGGALIKKPLSVLKDLMSTDGAGG
FT                   AAFVGLKAPVVKAHGNSSELAIASALKQIHKMLESDVSGKLVEHFEKMDK"
FT   gene            complement(72269..73081)
FT                   /gene="yahA"
FT                   /locus_tag="L1009"
FT   CDS             complement(72269..73081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahA"
FT                   /locus_tag="L1009"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved. there are nine paralogs in L.lactis"
FT                   /db_xref="EnsemblGenomes-Gn:L1009"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04169"
FT                   /db_xref="GOA:Q9CJC6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJC6"
FT                   /protein_id="AAK04169.1"
FT                   /translation="MNQNLKLFATDMDGTFLHNDHSYNHKKLAEVIKKIQDRNLLFAAS
FT                   SGRSLLGLIEVFSEYKDQMAFVAENGGVVAYKGEILFAKDLTVAQTQELIDDLQEMPFS
FT                   PKNDYLISGLKGAYYPEGISKEYLTHAKLYYPNCQLYHRLDEIDDKLLKVTTNFPEDHV
FT                   RDCEQWITDRLSFVRATTTGFTSIDIVPNGISKASGLVHLLAHFNWLPENLAVFGDQMN
FT                   DLEMFEYAGSSFAVSNAAPEILELADKVILSNDEDAVLVEIENILNEE"
FT   gene            complement(73207..74844)
FT                   /gene="yahG"
FT                   /locus_tag="L73210"
FT   CDS             complement(73207..74844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahG"
FT                   /locus_tag="L73210"
FT                   /product="ABC transporter ATP binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS. General. contains two ATP binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:L73210"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04170"
FT                   /db_xref="GOA:Q9CJC5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJC5"
FT                   /protein_id="AAK04170.1"
FT                   /translation="MLTVSDISLQFSDRKLFDEVNIKFTPGNCYGLIGANGAGKSTFLK
FT                   ILDGEIQPTTGHISMGPNERMSVLRQNHYDYEDQTPLDVVMMGNEKLFAINQEKNAIYM
FT                   NPDATDDDFMKAAELEAEFGEMGGYEAEADAARLLQNLGIKAEQHTDLMANLTSGEHVK
FT                   VLLAKALFGKPDVLLLDEPTNGLDIQAIAWLEEFLINFENTVIVVSHDRHFLNNVCTYM
FT                   ADLDYGKIKLYPGNYDFWKESSELALRLQGDQNRKAEEKIAELKEFIARFSANASKSKQ
FT                   ATSRKKMLDKIEVEEFVPSSRKYPFVGFEQEREIGNDLLRVENLSVAIEGEMIIENTSF
FT                   ILNPGDKTVFIGQNDIQQTTLLRALMDDVEDNWTVTGDIKWGVTSSRSYLPKDNTKDFD
FT                   TSDSILDWLRQFVLTKEEDDNTYLRGFLGRMLFKGEESLKAVNVLSGGEKVRVMLSKMM
FT                   LQRANVLVLDDPTNHLDLESISALNDGLKSFKGSILFASHDHEFINTIANHIVVLGKSG
FT                   VIDRIGETYDDFLDNAEVQEKVKALWAD"
FT   gene            complement(75972..77252)
FT                   /gene="cysD"
FT                   /locus_tag="L75975"
FT   CDS             complement(75972..77252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="L75975"
FT                   /product="O-acetylhomoserine sulfhydrylase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO01.08 Serine family.
FT                   TRANSFORMS O-ACETYLHOMOSERINE INTO HOMOCYSTEINE"
FT                   /db_xref="EnsemblGenomes-Gn:L75975"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04171"
FT                   /db_xref="GOA:Q9CJC4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJC4"
FT                   /protein_id="AAK04171.1"
FT                   /translation="MTNHNYKFDTLQVHAGQVPDPVTGSRAVPLYQTTSFVFNNSDHAE
FT                   ARFALQDPGAIYSRLGNPTNDVFEARIAALEGGSAALGVGSGSAAITYAILNIATVGDN
FT                   IVSASTLYGGTYHLFSGTLPKYGITTKFVNPDDPKNFEEAIDEKTKAIYYETLGNPGNN
FT                   VIDYDAIGQIAKKHGIPVIVDATFTTPVTFKPFEHGANVIVHSATKFIGGHGTSIGGVI
FT                   VDGGNFDWANGNFPDFTQADESYNGIKFAELGEIAFVTRVRAILLRDTGAALSPFHSWL
FT                   FLQGLETLSLRVERHISNTKKIVEFLDNHPKVELVNHPLLESNSYHALYQKYYPKDAGS
FT                   IFTFELKDKDEKKARDLIDHLEIFSLLANVGDTKSLAIHPASTTHQQLNAEELASAGIS
FT                   KGTIRLSVGIEDVTDLIADLEQALEKI"
FT   gene            complement(77479..78312)
FT                   /gene="yahI"
FT                   /locus_tag="L77482"
FT   CDS             complement(77479..78312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahI"
FT                   /locus_tag="L77482"
FT                   /product="short-chain type dehydrogenase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.01 ENERGY METABOLISM.
FT                   Aerobic"
FT                   /db_xref="EnsemblGenomes-Gn:L77482"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04172"
FT                   /db_xref="GOA:Q9CJC3"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJC3"
FT                   /protein_id="AAK04172.1"
FT                   /translation="MTQKIVAITGASNGMGFEAAELFAKRGWKVYAGARRVEKIPQYEN
FT                   NIKALKLDVTSSESNQAFVKKILDEAGHIDVLINNAGYGEYGPAEEIPMDKIRNQFETN
FT                   FFGAVELTQLVLPTMRAQNYGRIVNISSIGGDVYMPLGAYYHATKAALQQWSDVLDLEV
FT                   AQFGIRSVCVQPGGTQSSWGNIALENSKKNMSSNSAYQPLVNSVASGLDRFMKNSAKAS
FT                   DLAEVFYKAATEIKPSLRYLHSFGDKFMVNVARKHPKIFRKALLITMRYFEKHNQ"
FT   gene            78713..79180
FT                   /gene="yahB"
FT                   /locus_tag="L1010"
FT   CDS             78713..79180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahB"
FT                   /locus_tag="L1010"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved. there are six paralogs in L.lactis"
FT                   /db_xref="EnsemblGenomes-Gn:L1010"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04173"
FT                   /db_xref="GOA:Q9CJC2"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJC2"
FT                   /protein_id="AAK04173.1"
FT                   /translation="MSKNYKKILVAIDGSEQAEEALKEAIVLAKRDNSQLFVLHATDKN
FT                   SIYAAGNPVPVVPAPAIPVVPAVPVLEESADNEAKEVLDKALAIINNEVKFEEIRVDGS
FT                   AKNEIVDFAKEHEIDMIVMGSSGKGALDRMLLGSTAVYVVKHAPCSVTIIK"
FT   gene            79537..80157
FT                   /gene="yahD"
FT                   /locus_tag="L79507"
FT   CDS             79537..80157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahD"
FT                   /locus_tag="L79507"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L79507"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04174"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="PDB:3OG9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJC1"
FT                   /protein_id="AAK04174.1"
FT                   /translation="MTDYVFKAGRKDLAPLLLLHSTGGDEHQLVEIAEMIAPSHPILSI
FT                   RGRINEQGVNRYFKLRGLGGFTKENFDLESLDEETDWLTDEVSLLAEKHDLDVHKMIAI
FT                   GYSNGANVALNMFLRGKINFDKIIAFHGMQLEDFEQTVQLDDKHVFLSYAPNDMIVPQK
FT                   NFGDLKGDLEDSGCQLEIYESSLGHQLMQEEVLAANKWLTETK"
FT   gene            80208..81377
FT                   /gene="yaiA"
FT                   /locus_tag="L80191"
FT   CDS             80208..81377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="L80191"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:L80191"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04175"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJC0"
FT                   /protein_id="AAK04175.1"
FT                   /translation="MAELTKIETKIPENLTLGGVHHVTAITSSAQKIYDFFTNILGLRL
FT                   AKLTVNQDDYETYHLFFTEEDGHGADMTFFDFKDIPKGNHGVNNIERASFRVPTDASLD
FT                   YWTRRFDNAHVKHGEISSKFGQKTLEFEDFDGQLYQLISDQNNSGDDSKGRSWQLSNVP
FT                   QEHGITGLGPVFVKVENAENLRTILETVFGFRYAGQEDDLHLFEVANGGNGAALILQEA
FT                   GEKEAYAYQGYGTIHHLALGTANPETLNYWIERIKAFRLPHSGLVDRFYFSSEYVRVAP
FT                   GVLFEIATYTPGIGALDMAKSGLGAVDSYEEALITSGFWIDQTKEESGLSLSLPPHLFP
FT                   GDEATKARTAASLRPLDTSDAHRDRTKDELWTVEKVLEHKAGTPAETVQ"
FT   gene            81388..81978
FT                   /gene="yaiB"
FT                   /locus_tag="L81206"
FT   CDS             81388..81978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiB"
FT                   /locus_tag="L81206"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L81206"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04176"
FT                   /db_xref="GOA:Q9CJB9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJB9"
FT                   /protein_id="AAK04176.1"
FT                   /translation="MKSYQANELDEKTVYKLLSGSIVPRPIAWVTSQNLEGLVNVAPFS
FT                   FFNVASSNPPLLSISFTGNKDSLNNLLTTKEAVVHLVNEDNVELMNQTAAPLAEHISEA
FT                   EEFSLELVPSQKVQVPSLKESNVRLETKLYHHLPLGESGHLVLLEVVNFSFAEELLDEE
FT                   NFHVNLNKLKPVGRLAGDDYSTLGNRFSLLRPR"
FT   gene            82576..84723
FT                   /gene="lcnC"
FT                   /locus_tag="L82520"
FT   CDS             82576..84723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lcnC"
FT                   /locus_tag="L82520"
FT                   /product="lactococcin A ABC transporter ATP binding and
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:L82520"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04177"
FT                   /db_xref="GOA:Q9CJB8"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJB8"
FT                   /protein_id="AAK04177.1"
FT                   /translation="MKFKKKNYTSQVDEMDCGCAALSMILKSYGTEKSLASLRLLAGTT
FT                   IEGTSALGIKKAGEGLGFVVQVLRADASLFEMKKVPYPFIAHVIKNQKYPHYYVITGAN
FT                   KNSVFIADPDPTVKMTKLSKEVFLSEWTGISLFLSPTPSYQPTKEKTSSLLSFIPIITR
FT                   QKKVILNIVIASFIVTLINILGSYYLQSMIDSYIPNALMGTLGIISVGLLLTYIIQQVL
FT                   EFAKAFLLNVLSQRLAIDVILSYIRHIFQLPMSFFSTRRTGEITSRFSDASSILDAIAS
FT                   TILSLFLDLTIVLMTGLILGLQNMQLFLLVLLAIPLYIVVIIIFTPLFERQNHEVMQTN
FT                   AILNSSIIEDINGIETIKALASEQERYQKIDYEFASYLKEAFTLQQSEAIQTAIKTTVQ
FT                   LVLNVLILWFGATLVMHQKITLGQLITFNALLSYFTNPITNIINLQTKLQKARVANERL
FT                   NEVYLVPSEFEEKKTELSLSHFNLNMSEISYQYGFGRKVLSEIKLSIKENEKLTIVGIS
FT                   GSGKSTLVKLLVNFFQPTSGTITLGGIDLQQFDKHQLRRLINYLPQQPYIFTGSIMDNL
FT                   LLGASEATSQEEIIRAVELAEIRADIEQMQLGYQTELSSDASSLSGGQKQRIALARALL
FT                   SPAKILILDEATSNLDMITEKKILKNLLALDKTIIFIAHRLSVAEMSHRIIVIEQGKVI
FT                   ESGSHSELLAQNGFYAQLYHN"
FT   gene            84738..86159
FT                   /gene="lcnD"
FT                   /locus_tag="L84721"
FT   CDS             84738..86159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lcnD"
FT                   /locus_tag="L84721"
FT                   /product="lactococcin A ABC transporter permease protein"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:8633867 BIO13.08
FT                   TRANSPORT AND BINDING proteinS. Multidrug resistance. IN
FT                   THE STRAIN DIACETYLACTIS WM4 INVOLVED IN THE SECRETION OF
FT                   LACTOCOCCIN A. BELONGS TO THE HLYD FAMILY OF SECRETION
FT                   proteinS"
FT                   /db_xref="EnsemblGenomes-Gn:L84721"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04178"
FT                   /db_xref="GOA:Q9CJB7"
FT                   /db_xref="InterPro:IPR005696"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJB7"
FT                   /protein_id="AAK04178.1"
FT                   /translation="MFDKKLLESSELYDKRYRNFSTLIILPLFILLVGGVIFTFFAHKE
FT                   LTVISTGSIEPTKIVAKIQSTNANPIIENNLKEGKVVKENSLLLKYNGTPEQTQLSELL
FT                   TQKKQVLDKKAQLDLLQKSLTNEKNEFPTTDSFGYEKSFENYESQVKSLEATIQKSNQA
FT                   VEDQNKSTESQKQAIQNQVATLQQAIQNYSEIENAVSSGGGVSQDNPYLSQYNSYQAQQ
FT                   ATLEADLKNQKNPDETAKQATKSQEESLKSQFLSGLASSKDSLKSQIQSFNVQESSLTG
FT                   SNAYDNSQSSQILTLKTQALSASNKEMTDLNSTLTDLETKISLQKQDDQYSQVFAEQTG
FT                   VLHVLPDILGMKKIPIGTPIAEIYPLLKAETQVNLTSYIPSTQISGMKVGQKVRFTVQQ
FT                   NLPKPEILTGIIKQIDSAPTAFKEGNAYKVSATTAINAKDLPNIRYGLQGKTVTIIGKK
FT                   TYFNYFLDKIMGRTS"
FT   gene            86620..87072
FT                   /gene="yaiE"
FT                   /locus_tag="L86606"
FT   CDS             86620..87072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="L86606"
FT                   /product="transporter"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS General. There are three paralogs in L.lactis,
FT                   also yajA and yxdG"
FT                   /db_xref="EnsemblGenomes-Gn:L86606"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04179"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJB6"
FT                   /protein_id="AAK04179.1"
FT                   /translation="MLLYLSNLKRWSLLIYSIFSAIVTVIYIMFNSTFYKLDLVRYSND
FT                   IDYYNKMSAILPKGLLQLNGNFSQLDSPLLIIVYLLGILICLIFLILNWNPYYKRTYTP
FT                   LISMLGFLLPLLIRNGENIIWMLLLGLIIAFIGSIFYVFAVGKTYK"
FT   gene            87111..87767
FT                   /gene="yaiF"
FT                   /locus_tag="L87100"
FT   CDS             87111..87767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiF"
FT                   /locus_tag="L87100"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L87100"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04180"
FT                   /db_xref="GOA:Q9CJB5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJB5"
FT                   /protein_id="AAK04180.1"
FT                   /translation="MKFIFSKSIIIATAFFLFILSQLPAVFLNFLNSNGDTYGIAHKNT
FT                   PPFIILTLVVVTICIFIGIKCGFYQNYRKSLEWKNILLIFSLLIITFFIQKFVVQFITS
FT                   HNLYNVSHQITNQMKVENILSSLLFPGQFVAVSILAPILEESIYRACFYKLFGYYRWTF
FT                   FLSCFFFSYVHSGFSWDILGYLPLSIALTYVYHRRQVLTDSILLHALFNTLLFVF"
FT   gene            complement(87870..88151)
FT                   /gene="yaiI"
FT                   /locus_tag="L87874"
FT   CDS             complement(87870..88151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiI"
FT                   /locus_tag="L87874"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L87874"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJB4"
FT                   /protein_id="AAK04181.1"
FT                   /translation="MKYFVTSLSPSKNMGTMNWQTMILDKHRVEDSYWENAKLELSKEV
FT                   EWVTQSELYKKAKRNDGSGDDIILSLPVSITLETIKSDFPNANVWVYK"
FT   gene            complement(88161..88397)
FT                   /gene="yaiJ"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci; start codon not
FT                   identified"
FT   gene            88652..88870
FT                   /gene="yaiG"
FT                   /locus_tag="L88635"
FT   CDS             88652..88870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiG"
FT                   /locus_tag="L88635"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   interrupted homology to LcnD of L.lactis"
FT                   /db_xref="EnsemblGenomes-Gn:L88635"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04182"
FT                   /db_xref="GOA:Q9CJB3"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJB3"
FT                   /protein_id="AAK04182.1"
FT                   /translation="MKLTGIFLLFLIFKSFPTIFKEENAYKVSATTAINAKDLPNIRYG
FT                   LQGKTVTIIGKKTYFNYFLDKIMGRTS"
FT   gene            89117..89827
FT                   /gene="yaiH"
FT                   /locus_tag="L89118"
FT   CDS             89117..89827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiH"
FT                   /locus_tag="L89118"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   homology to OrfX from AbiG region of plasmid pCI750 from
FT                   Lactococcus lactis subsp. cremoris UC653"
FT                   /db_xref="EnsemblGenomes-Gn:L89118"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04183"
FT                   /db_xref="GOA:Q9CJB2"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJB2"
FT                   /protein_id="AAK04183.1"
FT                   /translation="MMDDSFKNYWMNKLKYFSLFILLFAIYWFPDVILGYPEIYLKSLV
FT                   GYDRQATATWIFLGNMAISLFLGILICYKLGYYKNTLSIFKIKNILFLLFTTIVLFIIY
FT                   FFTFTYYNSHFITPGIAKEQAAYSRQIVFPFVQFISFAICAPIFEEAAFRTTIYRFFKN
FT                   DKIAFIVSSISFAWMHTGANPILIVYLPMSVVLTLIYHRRRVLGESILVHCLMNALLPT
FT                   IIVFLQTITGLYYL"
FT   gene            90253..90705
FT                   /gene="yajA"
FT                   /locus_tag="L90239"
FT   CDS             90253..90705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajA"
FT                   /locus_tag="L90239"
FT                   /product="transporter"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS General. 25% identical to several membrane
FT                   proteins. There are three paralogs in L.lactis, also yaiE
FT                   and yxdG."
FT                   /db_xref="EnsemblGenomes-Gn:L90239"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04184"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJB1"
FT                   /protein_id="AAK04184.1"
FT                   /translation="MNPLFSSLKRWLLLIYTIFATIITVIYIMFNSTFYKLDLVKYNND
FT                   IDYHNKMSSILSKGLLQLNGNFAQLDSFLLIFVYVLGILICFISLLLNWNTYNKRTYTP
FT                   LISMLGFCLPLTVHNGENILWMVLLGLIIAFVGSIFYIFAIGKTYN"
FT   gene            complement(91052..91891)
FT                   /gene="tra981A"
FT                   /locus_tag="L0432"
FT   CDS             complement(91052..91891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra981A"
FT                   /locus_tag="L0432"
FT                   /product="transposase of IS981A"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:8389385 BIO14.04
FT                   Transposon related functions. related to a family of IS
FT                   elements that includes IS2, IS3, IS150, IS600, IS629,
FT                   IS861, IS904 and ISL1. There are 10 such elements in the
FT                   chromosome."
FT                   /db_xref="EnsemblGenomes-Gn:L0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04185"
FT                   /db_xref="GOA:Q7DAW1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAW1"
FT                   /protein_id="AAK04185.1"
FT                   /translation="MAQTIQTLALNVRLSCQLLDVPESSYYERINRHPSKTQLRRQYLS
FT                   LKISQLFNANRGIYGAPKIHHLLLKQGEKVGLKLVQKLMKQLQLKSVVIKKFKPGYSLS
FT                   DHINRKNLIQTEPTKKNKVWSTDITYIPTQQGWAYLSTIMDRYTKKVIAWDLGKRMTVE
FT                   LVQRTLNKAIKSQDYPEAVILHSDQGSQYTSLEYEELLKYYGMTHSFSRRGYPYHNASL
FT                   ESWHGHLKREWVYQFKYKNFEEAYQSIFWYIEAFYNSKRIHQSLGYLTPNQFEKVSA"
FT   gene            complement(91903..92163)
FT                   /gene="yajE"
FT                   /locus_tag="L186703"
FT   CDS             complement(91903..92163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajE"
FT                   /locus_tag="L186703"
FT                   /product="transposase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.04 Transposon related
FT                   functions. orf1 of IS981."
FT                   /db_xref="EnsemblGenomes-Gn:L186703"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04186"
FT                   /db_xref="GOA:Q7DAW0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAW0"
FT                   /protein_id="AAK04186.1"
FT                   /translation="MQKRYSKEFKETLIAFYHSGQSVTQLSKEYDVAPATIYKWIDLYS
FT                   KSNESSVSKADFLELKRQLAKVKEERDILKKVLTIFAEKKK"
FT   gene            complement(92200..92805)
FT                   /gene="yajF"
FT                   /locus_tag="L92204"
FT   CDS             complement(92200..92805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajF"
FT                   /locus_tag="L92204"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   28% identical to OrfX from AbiG region of plasmid pCI750
FT                   from Lactococcus lactis subsp. cremoris UC653"
FT                   /db_xref="EnsemblGenomes-Gn:L92204"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04187"
FT                   /db_xref="GOA:Q9CJB0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJB0"
FT                   /protein_id="AAK04187.1"
FT                   /translation="MINIWNKSKTVILALFLLFLSQVPLYYVEYENERQNLFGVANKIT
FT                   VNFILIGLLIILIAIMLGIKNGFYKNAKRTLEWKNIILILILIIPSVALDILFSQFIQF
FT                   HHLGRMDNQIAIDSVMGSLLWFGKILGVALLAPILEESIFRASIYKIFSNNKIAFVFSS
FT                   LLFTFMHSGYSWVFLIYLPMSLAVTFIYHRRSDVILKS"
FT   gene            complement(93031..93870)
FT                   /pseudo
FT                   /gene="tra981B"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:8389385 BIO14.04
FT                   Transposon related functions. pseudogene ORF frameshift,
FT                   related to a family of IS elements that includes IS2, IS3,
FT                   IS150, IS600, IS629, IS861, IS904 and ISL1. There are 10
FT                   such elements in the chromosome."
FT   gene            complement(93882..94142)
FT                   /gene="yajG"
FT                   /locus_tag="L93886"
FT   CDS             complement(93882..94142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajG"
FT                   /locus_tag="L93886"
FT                   /product="transposase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.04 Transposon related
FT                   functions. orf1 of IS981."
FT                   /db_xref="EnsemblGenomes-Gn:L93886"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04188"
FT                   /db_xref="GOA:Q9CJA9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJA9"
FT                   /protein_id="AAK04188.1"
FT                   /translation="MKKRYSKEFKETLIAFYHSGQSVTQLSKEYDVAPATIYKWIDLYS
FT                   KSNESSVSKADFLELKRQLVKVKEERDILKKVLTIFAEKKK"
FT   gene            94253..94621
FT                   /gene="yajB"
FT                   /locus_tag="L94197"
FT   CDS             94253..94621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajB"
FT                   /locus_tag="L94197"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L94197"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04189"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJA8"
FT                   /protein_id="AAK04189.1"
FT                   /translation="MLLEKYISYLILWKNYDKANELLKVGLLLYPNNMAFIFFKGMIQI
FT                   ESVKNLSKTYLIRDLKKYIESDKQTLCDSSYRDTSSLELIIAELNELAGKKKVAKKIIT
FT                   EINDDNLKYFWDQWNDNL"
FT   gene            complement(94841..95143)
FT                   /gene="yajH"
FT                   /locus_tag="L94845"
FT   CDS             complement(94841..95143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajH"
FT                   /locus_tag="L94845"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L94845"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04190"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJA7"
FT                   /protein_id="AAK04190.1"
FT                   /translation="MTKYIFPNLKDNQRDLFNIINQILSRDKLSIEERKCFLIAKKNIE
FT                   SGRNFDPQISELISSLQYLAHSSDVQYFFSEAQKRMLVNPGTGGSLYGWSNFESK"
FT   gene            complement(95879..96028)
FT                   /gene="rpmGB"
FT                   /locus_tag="L0096"
FT   CDS             complement(95879..96028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmGB"
FT                   /locus_tag="L0096"
FT                   /product="50S ribosomal protein L33"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.05 Ribosomal proteins:
FT                   synthesis and modification. BELONGS TO THE L33P FAMILY OF
FT                   RIBOSOMAL proteinS."
FT                   /db_xref="EnsemblGenomes-Gn:L0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04191"
FT                   /db_xref="GOA:P0A489"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A489"
FT                   /protein_id="AAK04191.1"
FT                   /translation="MRVNITLEHKESGERLYLTQKNKRNTPDKLELKKYSKKLRKHVIF
FT                   KEVK"
FT   gene            complement(96058..96231)
FT                   /gene="rpmF"
FT                   /locus_tag="L00096"
FT   CDS             complement(96058..96231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="L00096"
FT                   /product="50S ribosomal protein L32"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.05 Ribosomal proteins:
FT                   synthesis and modification. BELONGS TO THE L32P FAMILY OF
FT                   RIBOSOMAL proteinS."
FT                   /db_xref="EnsemblGenomes-Gn:L00096"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04192"
FT                   /db_xref="GOA:Q9CJA6"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJA6"
FT                   /protein_id="AAK04192.1"
FT                   /translation="MAVPARHTSSAKKNRRRTHYKLTAPTVTFDETTGDYRHSHRVSLK
FT                   GYYKGRKVRDTK"
FT   gene            96595..98376
FT                   /gene="cadA"
FT                   /locus_tag="L96595"
FT   CDS             96595..98376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadA"
FT                   /locus_tag="L96595"
FT                   /product="cadmium efflux ATPase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.05 TRANSPORT AND BINDING
FT                   proteinS. Cations. BELONGS TO THE CATION TRANSPORT ATPASES
FT                   FAMILY (E1-E2 ATPASES)"
FT                   /db_xref="EnsemblGenomes-Gn:L96595"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04193"
FT                   /db_xref="GOA:Q9CJA5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJA5"
FT                   /protein_id="AAK04193.1"
FT                   /translation="MKNWKKLILVFVIAGVALIAYFGFNQPFLARLIVTIAGGVLAFSM
FT                   LIEMIKTLRSGSYGVDLLAITAIIATLLVGEYWASLIIILMLDGGESLEDYANGRAHRA
FT                   LAALLDKSPDIAHVQKGDKVVDLPIEHVEVGSHLLIRPMEIIPIDGKLISEAVVLDTAS
FT                   LTGETKPNELVKGDPVLSGAINGNSSIQIETTVIAAESQFQKIVELVKETEKTPAQFVR
FT                   LADRYAVPFTIIAYLIAAVAYFIAGDPVRIAEVLVVASPCPLILAAPIAFVSGMSRSSQ
FT                   NGALIKNGTVIEKLAKAREIFLDKTGTITEGTIKVDSLKPIETVDEVELLQLVYTVEKS
FT                   SGHILAKAVVEYAENKKVQPLKLTSLTEVAGLGVIGEIEGQEIKIGRSSFAFAPDNLNY
FT                   ETAFYVSKAGKYVGAVTFSDTLRPEAKETIAQMRKIGLEKITMLTGDNQLVADKIASTV
FT                   GIDNVYAGLMPDEKLKFIKNATNRPVIMIGDGVNDAPALATADVGISIGVGSGTVASEA
FT                   ADIVLLQNDLRKVTTSIEISRDTLKIAKQAVMIGIIICIILMFVAALGVIPAVIGALFQ
FT                   EIIDVVSILYALRALRG"
FT   gene            complement(98429..99214)
FT                   /gene="parA"
FT                   /locus_tag="L0210"
FT   CDS             complement(98429..99214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="L0210"
FT                   /product="chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:L0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04194"
FT                   /db_xref="GOA:Q9CJA4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR013741"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJA4"
FT                   /protein_id="AAK04194.1"
FT                   /translation="MVEQITQLKLSTIVKNPYQPRLVFDEDKLKELANSIQENGVLQPI
FT                   IVRKSKLVGYELLAGERRFQASKLAGLETIPAIIRSYSDEEMMTLSILENLQRENLNPL
FT                   EESKSLAQLADKLGMTHDQIAKALGKSRSYVSNLIRLLGLPDTILKHVENRDISPAHAR
FT                   TLLAEKNPKKQLELVDKIIKEQLNVRALEAIIYGEEKFTDKSISKLNINLFTDETEKEL
FT                   MKKLGNRVKIQANKKYQGNLSIHFDNLDELEHLIKLLKK"
FT   gene            complement(99269..100528)
FT                   /gene="cshA"
FT                   /locus_tag="L99272"
FT   CDS             complement(99269..100528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cshA"
FT                   /locus_tag="L99272"
FT                   /product="chromosome segregation helicase"
FT                   /db_xref="EnsemblGenomes-Gn:L99272"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04195"
FT                   /db_xref="GOA:Q9CJA3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJA3"
FT                   /protein_id="AAK04195.1"
FT                   /translation="MAQNLARRMRPRNIDEIVGQKHLVGKGKIIRRMVETQLLSSMILY
FT                   GPPGIGKTSIASAIAGTMNVAFRTFNATTDTKKRLQEIASEAEFSGQLVLLLDEIHRLD
FT                   KPKQDFLLPLLENGQIILIGATTENPYFSVVPAIRSRVQIFELKPLEPEDLEFAVNLSL
FT                   QDKERGFDFDVTIDDDALYFLIHSTNGDLRSTFNALELAVLSSEEHHVTLDDMENSLQR
FT                   KAATFDKDGDAHYDLLSALQKSIRGSDVNASLHYAARLIEGGDLQSLARRLTVMAYEDI
FT                   GLANPDAALHTVSALSAAEKLGFPEARIPLANIIIDLALSPKSNAAYLAMDEAIADLGK
FT                   YGNLAVPPHLQDGHYAGAKDLGRSVEYQYAHNFPNHWVNQQYLPDKIKNADYFRPDDMG
FT                   RYEKALHSRKEWIDEQKKRS"
FT   gene            complement(100572..101060)
FT                   /gene="ybaH"
FT                   /locus_tag="L100575"
FT   CDS             complement(100572..101060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaH"
FT                   /locus_tag="L100575"
FT                   /product="acetyl transferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO10.02 DNA replication,
FT                   restriction, modification, recombination, and repair.
FT                   similar to several acetyltrasferases. Functional category
FT                   assignment based on the functions of cotranscribed genes."
FT                   /db_xref="EnsemblGenomes-Gn:L100575"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04196"
FT                   /db_xref="GOA:Q9CJA2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJA2"
FT                   /protein_id="AAK04196.1"
FT                   /translation="MEIRKIEPRDFVKVAQLENENWILASTPHVMDSSAEKIIGKIMTG
FT                   TTYFLAVENDEILGILDYGPRHKSEFGRHTVTFGIMTAQEARGKGVATTLINFFIDFAK
FT                   KEGFKKITIQVMGSNPAALKLYNKLGFVEEGRLKKEFFIDGEYIDDCILAFYLDKSLM"
FT   gene            101212..101679
FT                   /gene="ybaA"
FT                   /locus_tag="L101209"
FT   CDS             101212..101679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="L101209"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 58%
FT                   identical to a protein from Streptococci"
FT                   /db_xref="EnsemblGenomes-Gn:L101209"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04197"
FT                   /db_xref="InterPro:IPR021380"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJA1"
FT                   /protein_id="AAK04197.1"
FT                   /translation="MAKFGFLDVLEEVLEKGFTYDFEMNWDKRNFAVEVSFLLEAENSS
FT                   GALLTDAEGVESAENIVYEDAVLFYNPAKSRFDENDYLATIPYGEKGLSREFLAYFAQF
FT                   LQESADQGLDDLMDFLADEAAEEFSVNWDKEAFENGIADLSETDFYKYPRY"
FT   gene            101709..103262
FT                   /gene="ybaB"
FT                   /locus_tag="L101706"
FT   CDS             101709..103262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="L101706"
FT                   /product="ABC transporter ATP binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS. General. contains two ATP binding domains. There
FT                   are 60 paralogs in L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L101706"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04198"
FT                   /db_xref="GOA:Q9CJA0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJA0"
FT                   /protein_id="AAK04198.1"
FT                   /translation="MSILNVKNLSHGFGDRAIFEDVSFRLLKGEHIGFVGANGEGKSTF
FT                   MNIITGTLVPDEGKVIWSKKHRVGYMDQHAVLGKGKTTREALAEAFQYLFDIEAQINDT
FT                   YMKMAEMSEDEMNAALENVGELQEELDNSDFYLIDAKVEETARGLGLTPLLDKDVAELS
FT                   GGQRTKILLGKLLLEKPDILLLDEPTNYLDEEHILWLKNYLKNYENAFILISHDVPFMD
FT                   EVVNIIYHVHGLGITRYSMGYAEFERVFEEKKAQLESLHNAQVAEQAKLKDFIARKKAN
FT                   VATSGQAKAREKKLAKMEIVETISEKPKPHFDFKFSRKPSRLVFEAKDLVIGYNEPLSS
FT                   EINLKVESGQKIAFIGSNGIGKSTLLKSLMGLIPSLDGEVEKGNFQDIAYYEQEIKNPS
FT                   QKTVLDDLWDEYPSWNQAELRGALARVGLTAKQIESRVYVLSGGEQAKLRFAKLMNTES
FT                   NILILDEPTNHLDVDAKEELKRALIEYPGTVLMVSHEPEFYEGLVSDVINCEEWTTRIL
FT                   "
FT   gene            103393..103677
FT                   /gene="ybaC"
FT                   /locus_tag="L103321"
FT   CDS             103393..103677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaC"
FT                   /locus_tag="L103321"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci"
FT                   /db_xref="EnsemblGenomes-Gn:L103321"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04199"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ99"
FT                   /protein_id="AAK04199.1"
FT                   /translation="MTQKLHPWENPEQDYARTLAKRRSERRYRSLQLVKTLKILLTEFK
FT                   KYDVNNFNSEILSWIDLLEDAVEYVDDEDFKSAKKFVSRMQRELKKLEK"
FT   gene            103715..104203
FT                   /gene="ybaD"
FT                   /locus_tag="L103661"
FT   CDS             103715..104203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaD"
FT                   /locus_tag="L103661"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci"
FT                   /db_xref="EnsemblGenomes-Gn:L103661"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04200"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ98"
FT                   /protein_id="AAK04200.1"
FT                   /translation="MKSYSFQAELEIIGINPFVAVPPDILQKIFQDSGREKSPIPICGQ
FT                   INEKTYQQNLMFFKGDWRLYVNTTMLKNSPKRIGEIFDFTISYDSEPRIVKQPQVLSEA
FT                   LAKNPEAKKVFDQLIPSKQVEINRYIARLKTEEAIERNVRRAIGFLLGKNSFVGRDKP"
FT   gene            104221..105174
FT                   /gene="prmA"
FT                   /locus_tag="L104221"
FT   CDS             104221..105174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="L104221"
FT                   /product="methyltransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.05 Ribosomal proteins:
FT                   synthesis and modification. 31% identical to
FT                   enterobacterial ribosomal protein L11 and to other
FT                   methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:L104221"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04201"
FT                   /db_xref="GOA:Q9CJ97"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR010456"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ97"
FT                   /protein_id="AAK04201.1"
FT                   /translation="MNNWNSITIKISREAGEAISALLIEAGSAGVEINDSADYLNHEDQ
FT                   FGEVLPEIEQSDFVEITAYYPENMPIVELKAEIEHKIANLSDYFSLTGLSVTTNNLSET
FT                   NWAEAWKKYFEPARITHDLTIVPSWTEDYVATGSEKLIRLDPGMAFGTGTHPTTKMSLY
FT                   ALEQVLRGGETLLDVGTGSGVLSVAASYLGAAEIFAYDIDEVAVRVALENIELNPGHEK
FT                   IHVSANNLLEGIDKKADVIVANILADILVLMTEDAFRLVKEEGYLIMSGIIADKADMVI
FT                   ASAEKAGFFLETRMIQGEWNCLIFKKTENREGVIGG"
FT   gene            105274..106026
FT                   /gene="ybaF"
FT                   /locus_tag="L105256"
FT   CDS             105274..106026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaF"
FT                   /locus_tag="L105256"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:L105256"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04202"
FT                   /db_xref="GOA:Q9CJ96"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ96"
FT                   /protein_id="AAK04202.1"
FT                   /translation="MANQYFVFKKLPELGEEFIIENQAAAHHIFTVMRAKSGDQIRLVF
FT                   TDGEIGLSEVISPSDQSVKLIKLLTESSELPVQITVAVGFPKGDKLDFIVEKSTELGAT
FT                   AIWSAPFKASVSKWDKKKLTKKQEKLEKVALGAAEQSRRQMIPELQLFEQFTDLLDKFS
FT                   DFDQVLIAYEESAKMGEKTMFKQALTEMSLNQKVLIIFGPEGGISPDEITKFSDLGAKM
FT                   IGLGPRILRAETAPLYALSSISAYFELL"
FT   gene            106055..107011
FT                   /gene="ybaG"
FT                   /locus_tag="L106031"
FT   CDS             106055..107011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaG"
FT                   /locus_tag="L106031"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:L106031"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04203"
FT                   /db_xref="GOA:Q9CJ95"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ95"
FT                   /protein_id="AAK04203.1"
FT                   /translation="MKKRAQRNKKRIRWASVLTVFVLLIGIIAIAFAGVHLLSPKTNTS
FT                   PKSSQTSSQEKAKSTASSSASQPKETKWLAGTNENQLPILMFHYVTSRADQLPQDSNNI
FT                   NIVTFENELKALKEKGYTTVSGSDAEKILTTKEKPSDKMVWLTFDDGSVTMYTEIFPLL
FT                   KKYNMHATNFIITGYVNKGQGGILTWEQIKEMKASGLVDFGSHTVSHPDLGKLTLEAQR
FT                   TELEQSKADLDKNLEQKTDIICYPAGGYNQNTLNLANELGYKFGLLDPGRNGAIAIAAK
FT                   ESDGLLTLPRFRMMSSTTTEQMLQMIQPSTDYNEKNK"
FT   gene            107212..109434
FT                   /gene="relA"
FT                   /locus_tag="L0213"
FT   CDS             107212..109434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relA"
FT                   /locus_tag="L0213"
FT                   /product="ppGpp synthetase I"
FT                   /EC_number="2.7.6.5"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General"
FT                   /db_xref="EnsemblGenomes-Gn:L0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04204"
FT                   /db_xref="GOA:Q9CJ94"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ94"
FT                   /protein_id="AAK04204.1"
FT                   /translation="MPKEPDLTGAEVVNICSDYMNETDILLVEKALACASLAHADQYRA
FT                   SGEAYFVHPTQVAGILAKLKLDAVTVSCGFLHDVVEDTNFTQGDLQELFGDEIAEIVDG
FT                   VTKLGKVEYKSHEEQLAENHRKMLMAMSKDIRVILVKLADRLHNMRTLKHLRPDKQKRI
FT                   SRETMEIYAPLAHRLGIASIKWELEDLSFRYLEEAEFYRIRGLMNEKRTAREALVAEVI
FT                   GKLQERVEKAGVDAEIYGRPKHIYSIYRKMHDKKKRFDEIYDLIAIRCITETTSDVYTT
FT                   LGYIHDLWKPMPGRFKDYIANPKANGYQSVHTTVYGPKGPMEFQIRTREMHQIAEFGVA
FT                   AHWAYKQGIKAKVDVHEISETLNWIHELVELREEAGDSAEDFVKAVQEDILSDKIYVFT
FT                   PNGEVQELPRGSGPIDFAYAIHTKVGDHATGAKVNGRMKPLSVQLKTGDRVEIITSSSS
FT                   FGPSRDWINLVKTNKARNKIKQFFKNQDKELSVNKGREMLQEALEEGGFVPNQYLDKKH
FT                   LDEVFNKISYRNAEALYAAIGFGELSATTIANRLTENERREVERAKQKAEAEELMKGEV
FT                   KRESSKNIMKIRHDGGVSVSGIDSLLVRIAKCCNPVPGDPIVGYITKGRGVSVHRADCQ
FT                   NVRSMEDFEQRLVEVEWDDSENLVKEYVANIDVYGFNRPGLLNDVMQVLSNSTKNLISI
FT                   NAQPTKDKKMANIHIALGIKNLSDLTLIVDKIKMTPDVYSVKRTNA"
FT   gene            complement(109450..110385)
FT                   /gene="ybaI"
FT                   /locus_tag="L109453"
FT   CDS             complement(109450..110385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaI"
FT                   /locus_tag="L109453"
FT                   /product="glycosil transferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved. BELONGS TO THE GLYCOSYLTRANSFERASE FAMILY 2"
FT                   /db_xref="EnsemblGenomes-Gn:L109453"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04205"
FT                   /db_xref="GOA:Q9CJ93"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ93"
FT                   /protein_id="AAK04205.1"
FT                   /translation="MEELAIVVPVYNEEETLELFIKEVNDKTEKLELKKVFYFVNDGSS
FT                   DQTLPLIKKLASQVDNINYISFSRNFGKEAALLAGLEATTEPLVTVMDVDLQDPPELLV
FT                   SMYQKLQEGYDSVGARRISRSGESPLISFFSRLFYKIINKVSTTPIVDGARDFRLMTRQ
FT                   VVDSILTLRENNRFSKGLFSWVGYDVTYLEYENHERSAGQTSWSFSQLLRYSIDGIINF
FT                   SEMPLNIATFVGFFSFLASLLLSIFYLLKTLIYGDPVQGFPTLIVLILLLGGLQLLSLG
FT                   IIGKYIAKIFLETKKRPNYIIKESNLKELD"
FT   gene            110576..111031
FT                   /gene="ybbA"
FT                   /locus_tag="L110564"
FT   CDS             110576..111031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="L110564"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:L110564"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04206"
FT                   /db_xref="GOA:Q9CJ92"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ92"
FT                   /protein_id="AAK04206.1"
FT                   /translation="MKIVIQRVKSASVSIDGVIKGKINQGFLLLVGVEDADSNFDLDYA
FT                   VRKIAQMRIFSDEADKMNLSVQDIQGEILSISQFTLYAETKKGNRPSFSAAGKPDFAKA
FT                   MYEKFNDSLAQIVPVKAGVFGADMQVELINDGPVTIILDTKEARKNA"
FT   gene            111024..112019
FT                   /gene="ybbB"
FT                   /locus_tag="L111003"
FT   CDS             111024..112019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbB"
FT                   /locus_tag="L111003"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   there are six paralogs in L.lactis. Homologs not detected
FT                   in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L111003"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04207"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ91"
FT                   /protein_id="AAK04207.1"
FT                   /translation="MPKRLQKSSVKKWVPVRSVSKIKTYQSSEKPDQVGEIWQNNIIGS
FT                   LDNGYSKEQARKQQSQNLTERQKRKIEEMQSNPEMIQAREELKEEFLNTHPQYAKMTSE
FT                   ELQESMTHHALEDEKLRKQKLRHHIEAFADGIIAVIITIMLLEIPVPSGNQGYWEFISS
FT                   VGIFLVSFVVTANFWFNRHKIFALTEEITEKIIVQDFIFIGLLSLIPLLTKWIMVAPTS
FT                   FSALNFGLVLIVILLQQELLSYSITKDHFHKMPKSFKFWRRVWLIRLFSTILMNVVIMI
FT                   IAIIFPFYGHWLFVIVPIFNFLFRMVNDRNQEEEVYAATRSIGVPYLKEG"
FT   gene            112022..112645
FT                   /gene="ybbC"
FT                   /locus_tag="L111950"
FT   CDS             112022..112645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbC"
FT                   /locus_tag="L111950"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   there are six paralogs in L.lactis"
FT                   /db_xref="EnsemblGenomes-Gn:L111950"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04208"
FT                   /db_xref="GOA:Q9CJ90"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ90"
FT                   /protein_id="AAK04208.1"
FT                   /translation="MTVKNIIFDLGGVILDLGFERMVNSFENLGIKDFSAYFNPQKQVD
FT                   FFEKLELGLISPEIFYDKFREATNSQLTDEIIEKNWNLILKDFQKERMDLLTELSADFS
FT                   LYLFSNTNAIHAKCFEQRCIEEMGQPLSTYFRKTYYSHDLHLRKPTVESFQEVLRQSNL
FT                   KADETLFIDDNADNILGAQAAGLKTYHLKAPKVLTELNFQEIIY"
FT   gene            112785..114194
FT                   /gene="ctrA"
FT                   /locus_tag="L112776"
FT   CDS             112785..114194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctrA"
FT                   /locus_tag="L112776"
FT                   /product="cationic amino acid transporter"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.02 TRANSPORT AND BINDING
FT                   proteinS. Amino acids, peptides and amines. similar to many
FT                   cationic amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:L112776"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04209"
FT                   /db_xref="GOA:Q9CJ89"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ89"
FT                   /protein_id="AAK04209.1"
FT                   /translation="MGFMRKADFELYRDADKHYNQVLTTRDFLALGVGTIISTSIFTLP
FT                   GQVAAQFAGPGVVFSYLLAALVAGFVALAYAEMSTVMPFAGSAYSWISVLFGEGFGWIA
FT                   GWALLAEYFIAVAFVGSGFSANLQQLLAPLGFHLPKVLANPFGTDGGVVDIISLLVILL
FT                   SAIIVFRGASDAGRISQILVVLKVAAVIAFIIVGITVIKPANYHPFIPPHNPKTGFGGF
FT                   SGIWSGVSMIFLAYIGFDSIAANSAEAKKPQKTMPRGIIGSLLIAVVLFAAVTLVLVGM
FT                   HPYSAYAGNAAPVGWALQQSGYSVLSEVVTAIALAGMFIALLGMVLAGSRLLYAFGRDG
FT                   LLPKGLGKMNARNLPANGVWTLAIVAIVIGAFFPFAFLAQLISAGTLIAFMFVTLGIYS
FT                   LRRRQGKDLPEATYKMPFYPVLPALGFIGSLFVFWGLDVQAKLYSGIWFLIGILIYFAY
FT                   GNRRSRKSEEK"
FT   gene            114343..114984
FT                   /gene="ybbE"
FT                   /locus_tag="L114325"
FT   CDS             114343..114984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbE"
FT                   /locus_tag="L114325"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L114325"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04210"
FT                   /db_xref="GOA:Q9CJ88"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ88"
FT                   /protein_id="AAK04210.1"
FT                   /translation="MKEYEKQHRIFYVFLRNLVAFLLLILNGKSKYYNVDRIPKDENYI
FT                   LVAPHRMAWEPVWFAFATRPKQFIFMAKKELFKGFGGWWIKMCGAFPVDRENPGIKPLK
FT                   HAVKMLKESDKSMIMFPSGSRHSAEMKGGVAVIAKMAKVRIVPAVYQGPLTMKGVFKRQ
FT                   KVSINIGHPIDISDIKKMDEAGIAEVNRRMEVAFAELDKELNPDFHYEAK"
FT   gene            complement(115022..115513)
FT                   /gene="rmaD"
FT                   /locus_tag="L115025"
FT   CDS             complement(115022..115513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmaD"
FT                   /locus_tag="L115025"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.08 MarR-family
FT                   regulators. belongs to the MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:L115025"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04211"
FT                   /db_xref="GOA:Q9CJ87"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ87"
FT                   /protein_id="AAK04211.1"
FT                   /translation="MTSADLNQQISKELHELRHATDNRSQERSWILAQLDNDKLEKEVL
FT                   TLSVVALHILSALTKEDLTGIELATKLSVTRGGVTRAVQNLIKYQFLTTYQSESDKKKI
FT                   FYHLTVKGRKVATIHDKMHKIMDIRLGQIFDKYNEQEKSIILSFLSDFNLTEAGLFDSE
FT                   "
FT   gene            complement(115548..116192)
FT                   /gene="acpD"
FT                   /locus_tag="L115551"
FT   CDS             complement(115548..116192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpD"
FT                   /locus_tag="L115551"
FT                   /product="acyl carrier protein phosphodiesterase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO07.01 FATTY ACID AND
FT                   PHOSPHOLIPID METABOLISM. General. converts holo-ACP to
FT                   apo-ACP by hydrolytic cleavage of the phosphopantetheine
FT                   residue from ACP. Probably NAD(P)H dehydrogenase."
FT                   /db_xref="EnsemblGenomes-Gn:L115551"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04212"
FT                   /db_xref="GOA:Q9CJ86"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ86"
FT                   /protein_id="AAK04212.1"
FT                   /translation="MTTLLIILAHPHTDDFSWSLATVEEFKKSYQESHPLDKIIIRDLF
FT                   SEKVPALDNETFAAWKRNKYAPDTLSAEDKNLLHRHEEYLEEFLSADKYVFVNPMYNGF
FT                   VTAELKQYIDVIAVPRKLFRYTENGPIGLLEGKKSLHIQSAGGFYHNEQDPTHMANDLG
FT                   AAYIDQTMKMVGLTDENRQQLFVEGYARYPERADELKEKAFTSAENFGKAF"
FT   gene            116366..118963
FT                   /gene="secA"
FT                   /locus_tag="L0334"
FT   CDS             116366..118963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="L0334"
FT                   /product="preprotein translocase SecA subunit"
FT                   /note="EVIDENCE BY HOMOLOGY BIO04.05 protein and peptide
FT                   secretion"
FT                   /db_xref="EnsemblGenomes-Gn:L0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04213"
FT                   /db_xref="GOA:Q9CJ85"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ85"
FT                   /protein_id="AAK04213.1"
FT                   /translation="MPNIIRKLVENDKKELKKLNRMALQVESFADEMEHLTDEQLKAKT
FT                   PELKERIAKGESLDDLLYEAFAVCREAARRVLGLYPFHVQIMGGIVLHNGDVPEMRTGE
FT                   GKTLTATMPVYLNALSGKGVHVVTVNEYLATRDMTEMGELYSWLGLTVGLNLNSKSPEE
FT                   KREAYNCDITYSTSAELGFDYLRDNMVTRAEDMVQKPLNYALVDEVDSILVDEARTPLI
FT                   ISGQAESSSALYYRADQFTKTLKGQNLNVATSEYEEGDDYKIDLQSKTISLTEEGIDKA
FT                   EKFFQIENLYDMENVALTHFVDNALRANFIMLHDIDYMVDENQEVLIIDQFTGRTMPGR
FT                   RYSDGLHQAIEAKEAVPIQDESKTMASITIQNYFRMYKKLSGMTGTAKTEEEEFREIYN
FT                   IQITPIPTNRPVQRLDHPDLLYPTLEAKFKAVIDDIKRRHAEGQPILIGTVAVETSELI
FT                   SKKLVEAKIPHEVLNAKNHFREAQIIMNAGQQGAVTIATNMAGRGTDIKLGPGVIDHVD
FT                   PEFRGLAVIGTERHESRRIDNQLRGRSGRQGDPGVSQFYLSLEDELMKRFGSERVSAFL
FT                   DRMRISGEDAVIKSGLITRQIESSQKRVEGNNYDSRKQVLQYDDVIREQREVIYAQRQE
FT                   VILATEDMTPVLMGMFKRTIDRQVDGHELAGSLKDEENVKNLLQTLHNTMLPEDGIELS
FT                   ELTGLSVQAMKDLIFDKVKARYASQMEKLSDPERQLEFQRAVILRVVDNNWSEHIDALD
FT                   QMRQSVGLRGYAQNNPIVEYQEESYKMYNNMIGAIEFEVTRLMMKAQIQPQTAIRQEAP
FT                   RMTTTASQENITNVDTEHSVSEEISFENVGRNDLCPCGSGKKFKNCHGRTHIA"
FT   gene            119092..120129
FT                   /gene="aroF"
FT                   /locus_tag="L0063"
FT   CDS             119092..120129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroF"
FT                   /locus_tag="L0063"
FT                   /product="Tyr-sensitive phospho-2-dehydro-deoxyheptonate
FT                   aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="EVIDENCE BY HOMOLOGY BIO01.02 Aromatic amino-acid
FT                   family. can be aroG or aroH gene (Phe-sensitive or
FT                   Trp-sensitive)"
FT                   /db_xref="EnsemblGenomes-Gn:L0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04214"
FT                   /db_xref="GOA:Q9CJ84"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ84"
FT                   /protein_id="AAK04214.1"
FT                   /translation="MSFKEISPKINIDAIKMLGHLNSEQQEKKLQRDKELEAIIKGEDD
FT                   RLLLIIGPCSSDNEEAVLEYARRLAKLQEAVKDKIFMVMRVYTAKPRTNGDGYKGLIHE
FT                   PDADGHTDLINGIKMVRDLHYKVITETGLTTADEMLYPENLPMVDDLVSYHAIGARSVE
FT                   NQQHRFVASGIDVPTGLKNPTSGNLKVMFNGIYAAQQSQDFLFGRAEVQTSGNPLAHAI
FT                   LRGGQDENGKYHPNYYTDNLLDTIEIYEKMGLKNPFIVIDTNHDNSGKKFMEQIRIVRQ
FT                   TLVNRDWDDKIRQNVRGFMIESYLEDGRQDKPEVFGKSITDPCLGWDKTEALVQEIYEA
FT                   ENKNN"
FT   gene            120380..120646
FT                   /gene="ptsH"
FT                   /locus_tag="L120335"
FT   CDS             120380..120646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="L120335"
FT                   /product="phosphocarrier protein Hpr"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.07 TRANSPORT AND BINDING
FT                   proteinS. PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:L120335"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04215"
FT                   /db_xref="GOA:Q9CJ83"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ83"
FT                   /protein_id="AAK04215.1"
FT                   /translation="MASKEFHIVVETGIHARPATLLVHTASKFTSEITLEYKGKSVNLK
FT                   SIMGVMSLGVGQGADVTISAEGADADDAISTIAETMTKEGLAE"
FT   gene            120649..122376
FT                   /gene="ptsI"
FT                   /locus_tag="L120628"
FT   CDS             120649..122376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="L120628"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.07 TRANSPORT AND BINDING
FT                   proteinS. PTS system. also called PTS system enzyme I"
FT                   /db_xref="EnsemblGenomes-Gn:L120628"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04216"
FT                   /db_xref="GOA:Q9CJ82"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ82"
FT                   /protein_id="AAK04216.1"
FT                   /translation="MTTMLKGIAASSGVAVAKAYLLVQPDLSFETKTIADTANEEARLD
FT                   AALATSQSELQLIKDKAVTTLGEEAASVFDAHMMVLADPDMTAQIKAVINDKKVNAESA
FT                   LKEVTDMFIGIFEGMTDNAYMQERAADIKDVTKRVLAHLLGVKLPSPALIDEEVIIVAE
FT                   DLTPSDTAQLDKKFVKAFVTNIGGRTSHSAIMARTLEIPAVLGTNNITELVSEGQLLAV
FT                   SGLTGEVILDPSTEQQSEFHKAGEAYAAQKAEWAALKDAETVTADGRHYELAANIGTPK
FT                   DVEGVNDNGAEAIGLYRTEFLYMDAQDFPTEDDQYEAYKAVLEGMNGKPVVVRTMDIGG
FT                   DKTLPYFDLPKEMNPFLGWRALRISLSTAGDGMFRTQLRALLRASVHGQLRIMFPMVAL
FT                   VTEFRAAKKIYDEEKAKLIAEGVPVADGIEVGIMIEIPAAAMLADQFAKEVDFFSIGTN
FT                   DLIQYTMAADRMNEQVSYLYQPYNPSILRLINNVIKAAHAEGKWAGMCGEMAGDQTAVP
FT                   LLMGMGLDEFSMSATSVLQTRSLMKRLDSKKMEELSSKALSECATMEEVIALVEEYTK"
FT   gene            122491..122805
FT                   /gene="ybcC"
FT                   /locus_tag="L122461"
FT   CDS             122491..122805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcC"
FT                   /locus_tag="L122461"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci"
FT                   /db_xref="EnsemblGenomes-Gn:L122461"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04217"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ81"
FT                   /protein_id="AAK04217.1"
FT                   /translation="MCYFNVKGATRMISGEEGYSLILILILPSQININFWLILTSKQTS
FT                   GSVFNIIALPILMALPNLIQRVMTSNSIYWTKQKYIILILNYILLLVTTFWLLTLPFGQ
FT                   "
FT   gene            complement(122846..123145)
FT                   /gene="ybcG"
FT                   /locus_tag="L122849"
FT   CDS             complement(122846..123145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcG"
FT                   /locus_tag="L122849"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:L122849"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04218"
FT                   /db_xref="GOA:Q9CJ80"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ80"
FT                   /protein_id="AAK04218.1"
FT                   /translation="MMNMQSMMKQAQKLQKQMQVSQEEIANTTFVGKSAQDLVTVEFSG
FT                   DRTLKSLDIKPDVIDPEDPETLQDMVTDAVNDALSQIEKVTEQKLGKFTKGLPF"
FT   gene            complement(123533..124468)
FT                   /gene="ybcH"
FT                   /locus_tag="L123536"
FT   CDS             complement(123533..124468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="L123536"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L123536"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04219"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ79"
FT                   /protein_id="AAK04219.1"
FT                   /translation="MKKFRKKQIWRVIIGLFALLLVINLGATLYFYQIACVRNNQQIGQ
FT                   VKSSSPNYSLVQKFDKLSKSTESIKNDGLKLDAWYVPAEHKTNNTVIVVHGFRQDKSAM
FT                   RQYGQLFHELGYNVLMPDNRGAGQSEGKFITFGYHDKFDVIAWANYLTDKNPESQISLY
FT                   GLSMGASTVMMASSEKSLPSSVKNIIEDCGYTNAWDEITYQAKESYNIPPFPLVYSVSL
FT                   ESKLRQGWFFQEASATKALTKDKLPILLIHGSNDTYVPTSMVYENYKAVKKGTPKELLV
FT                   IKGAAHAKSFETNPELYRQTISKFMKAYNP"
FT   gene            124677..125030
FT                   /gene="sugE"
FT                   /locus_tag="L124677"
FT   CDS             124677..125030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="L124677"
FT                   /product="SugE protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO04.03 Chaperones. could act
FT                   as a chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:L124677"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04220"
FT                   /db_xref="GOA:Q9CJ78"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ78"
FT                   /protein_id="AAK04220.1"
FT                   /translation="MVVLFLAEEAKMTWIYLLIAGTFEVAWATTMKLSHGFSNLKFTLL
FT                   TIIGMIASFGFLALALKKLPLGIAYPIWTGIGAVGSILIGLILFKDKIPPLTWLFIACL
FT                   VVGIIGIKVTSGH"
FT   gene            125152..126315
FT                   /gene="blt"
FT                   /locus_tag="L125116"
FT   CDS             125152..126315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blt"
FT                   /locus_tag="L125116"
FT                   /product="multidrug efflux transporter"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.08 Multidrug resistance"
FT                   /db_xref="EnsemblGenomes-Gn:L125116"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04221"
FT                   /db_xref="GOA:Q9CJ77"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ77"
FT                   /protein_id="AAK04221.1"
FT                   /translation="MKNKKSMMNLAISNLFLVFLGAGLVIPVLPTLKEQMHFSGTTMGM
FT                   MISIFAIAQLVASPVAGALSDKIGRKKLIAIGMIIFSFSELLFGLAQAKTGFYISRALG
FT                   GVAAAMLMPSVTAYVADMTTIAERPKAMGLVSAAISGGFIIGPGVGGFIAHFGIRVPFY
FT                   VAAILAFLGFILTITILKEPERTIESHQEIEKVSFLDILKNPLFGSLFIIILISSFGLQ
FT                   AFESIYSIMASINFGFSMSEIALVITVSGILALFFQLFLFDAIVNKIGELGLIQLTFFA
FT                   SAIFIAVIAFTKSNLVVALSTFVVFLAFDLFRPAVTTYLSKHAGNRQGAINGLNSAFTS
FT                   FGNILGPMAAGYMFDLNHLFPYYISAIILLGTGFLSLFLNRKNFSKI"
FT   gene            126754..127950
FT                   /gene="argG"
FT                   /locus_tag="L126739"
FT   CDS             126754..127950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="L126739"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="EVIDENCE BY HOMOLOGY BIO01.05 Glutamate family.
FT                   penultimate step of the arginine biosynthetic pathway"
FT                   /db_xref="EnsemblGenomes-Gn:L126739"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04222"
FT                   /db_xref="GOA:P57799"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57799"
FT                   /protein_id="AAK04222.1"
FT                   /translation="MMGNKKIVLAYSGGLDTSVAVKWLTDKGFDVIADCMDVGEGKDLN
FT                   FIHDKALQVGAVESVVLDCKEEFAKIFVGAALKGNLMYENKYPLVSALSRPLIAQKLVE
FT                   VAKEKGATAIAHGCTGKGNDQVRFEVAIHSLAPELEVIAPVREWHWAREEEIEYANQNG
FT                   VPIPADLDNPYSIDMNLWGRAIEAGVLENPWNTCPEDAFFMTNSVENAPNEAEFIEVEF
FT                   KEGLPIALNGKSLELHEIIKKVNIIAGKHGIGRIDHIENRLVGIKSREFYECPAAITLL
FT                   KAHKDLEDLTFVRELAHFKPVLENELANLIYNGLWFNPATKALIAYLDETQKVVNGIVK
FT                   IKLYKGLATPVGRKSTNSLYSEKLATYTAADEFDQAAAVGFIKLWGLPTQVNAQVNLK"
FT   gene            127981..129360
FT                   /gene="argH"
FT                   /locus_tag="L0114"
FT   CDS             127981..129360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="L0114"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="EVIDENCE BY HOMOLOGY BIO01.05 Glutamate family. the
FT                   last step of arginine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:L0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04223"
FT                   /db_xref="GOA:Q9CJ76"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ76"
FT                   /protein_id="AAK04223.1"
FT                   /translation="MVEKLWGGRFEASLDKQTEEFGASIKFEQRLAPFDLKGSLAHVKM
FT                   LGETGIITTEESKKIAEGLKKVEEKLLNGQIEFKMENEDIHMNMESYLHQEIGPLAGKL
FT                   HTARSRNDQVVTDMHLYLKSILEAVLEALKVLRETIVKLAVNQIDTIMPGYTHLQHAQP
FT                   ISFGQHLMAYYQMLTRDFERFEFNVKHTDMNPLGAAALAGTTFPIDRMLTTKLLGFEKA
FT                   YDNSMDAVSDRDFILEFLSNASLLMMHLSRFCEELLLWSSHEFKFVSLSDTYSTGSSIM
FT                   PQKKNPDMAELIRGKTGRVYGNLTALLTVMKGLPLAYNKDFQEDKEGMFDSADTIITSL
FT                   TVMNGMLSTLTVNRVNMEKSTEQDFSNATELADYLATKGLPFRKAHELVGLLVLDCIKK
FT                   GIYLQDVNLQDYQMLSPLINEDVYEVLKSRTAVSRRNSLGGTGFESVKKQIEEAKKELQ
FT                   I"
FT   gene            complement(129376..130572)
FT                   /gene="pmrB"
FT                   /locus_tag="L129379"
FT   CDS             complement(129376..130572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmrB"
FT                   /locus_tag="L129379"
FT                   /product="multidrug resistance efflux pump"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.08 TRANSPORT AND BINDING
FT                   proteinS. Multidrug resistance. 36% identical to PmrA of
FT                   Streptococcus pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:L129379"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04224"
FT                   /db_xref="GOA:Q9CJ75"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ75"
FT                   /protein_id="AAK04224.1"
FT                   /translation="MKESWQRNLIVLWFGTFMTGIGSSLIAPFISLYISTLGHYSKTEL
FT                   NIWSGLVFSSTFIVLAIVSPLWGRLADQKGRKLMLLRASLGMAISISLMAFVTAAWQLL
FT                   ILRMLLGAFSGFVSNSMALMASSAPKEKSGAVLSLLTTGSVAGTLIGPIIGGILVNITG
FT                   YRRVFSVTGIIMFLVFFLALFFVKEIFKPVEKKNMLSYKQVWEVVTHPAIIWGMFFATL
FT                   ITQMTNQSINPVLSLYVQELMHGQGNITFMAGIVAAAPGIVTLVAAPFLGRLGDKVGQR
FT                   KILGFGLFFSLIVFSITAMTTNVWFLIVMRLLVGVSDAAILPSVQAILAKESPQAITGR
FT                   IFSYNQSAQSIGAFAGPLLGSAIAGFIDYRYVFVGSAILVVFNLINYFTHTKSLAVKN"
FT   gene            130767..131342
FT                   /gene="ybdA"
FT                   /locus_tag="L130713"
FT   CDS             130767..131342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdA"
FT                   /locus_tag="L130713"
FT                   /product="transcription regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General. similar to E.coli tetracycline repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:L130713"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04225"
FT                   /db_xref="GOA:Q9CJ74"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ74"
FT                   /protein_id="AAK04225.1"
FT                   /translation="MARIALTRDKIVQATIELAGKIGLSNVSFPRLAEYFGIKAPSLYN
FT                   HFKNMEEVRVATAVYLQKELNCELTHAMVGLTPLAALRAYAESYKRFAEKYEAVYELIN
FT                   VIHQTNNGELEYLAKENIRLVRRSLENFHLSEEENFHISRMFRSTLHGFITLTQLGYFR
FT                   QSGSISKEESFTYMVDHLLSRLDNPENI"
FT   gene            131494..131847
FT                   /gene="rnpA"
FT                   /locus_tag="L131443"
FT   CDS             131494..131847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="L131443"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.06 tRNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:L131443"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04226"
FT                   /db_xref="GOA:Q9CJ73"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ73"
FT                   /protein_id="AAK04226.1"
FT                   /translation="MAIKKTYRVKRSKDFDQIFSAKHSFANKKFVVYKLNTNQPHFRVG
FT                   LSVSKKLGHAVLRNRIKRLLRHAIAEFKPYLTDEDFVIIARSGVETLSFEEVKKNLKHV
FT                   LKLSKIYVDGEND"
FT   gene            131844..132653
FT                   /gene="ybdC"
FT                   /locus_tag="L131778"
FT   CDS             131844..132653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdC"
FT                   /locus_tag="L131778"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   40% identical to SpoIIIJ protein of B.subtilis. This
FT                   protein is attached to membrane by a lipid anchor."
FT                   /db_xref="EnsemblGenomes-Gn:L131778"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04227"
FT                   /db_xref="GOA:Q9CJ72"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ72"
FT                   /protein_id="AAK04227.1"
FT                   /translation="MKKKFSLIAMAGAALLLLTACGTTAVTSSSTNLWDQIVYGFAQVI
FT                   RFLSFGGLTGVGIILFTIVIRAALLPLMNIQIKSSQRMQEIQPEIKKIQAKYPSKDMES
FT                   RRLMNEEIQKLYAENKVNPYMGCLPLVVQMPVLWALYQALSRVDFLKHGTFLWFEIGAK
FT                   DPTFILPILAAVFTFLSSYLMMKSAPERNAMTTSMTYIMPIFILIMGVNFAAGIALYWV
FT                   ISNAFQVFQTMLLANPYKIIAAREAKVQVEKDKIKAREKALKKARKK"
FT   gene            132742..133656
FT                   /gene="ybdD"
FT                   /locus_tag="L132712"
FT   CDS             132742..133656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdD"
FT                   /locus_tag="L132712"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   30% identical to spoIIIJ-associated protein Jag protein
FT                   from differenr species"
FT                   /db_xref="EnsemblGenomes-Gn:L132712"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04228"
FT                   /db_xref="GOA:Q9CJ71"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ71"
FT                   /protein_id="AAK04228.1"
FT                   /translation="MAIFTGETVEDAIERGLNRLNVKRENVHIHIEQKEKKGFLGFGKK
FT                   RARVNIEPIHEETVRKADHLAERGVDDTINLGVPKSQSAMEATLELSQVVKAVRAAERE
FT                   QNGEITEEERNAIIEVAKKTVVQNRQGTADLSDVVSAVKEEVEAKKEVSNEDEKIASKI
FT                   SSYLTTITQEMGIATRVSVSCDGNLTVFNLTSNHDALLIGKHGKILQSLQILAKAYANS
FT                   ILNTRMNIAVNVGDYHEKRKAYIVSLAHRAAERARGGETVYINDLQSNERKIVHTIIGQ
FT                   ENGVSSHSEGQEYNRYIVVAKEI"
FT   gene            133788..133922
FT                   /gene="rpmH"
FT                   /locus_tag="L133770"
FT   CDS             133788..133922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="L133770"
FT                   /product="50S ribosomal protein L34"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.05 Ribosomal proteins:
FT                   synthesis and modification. BELONGS TO THE L34P FAMILY OF
FT                   RIBOSOMAL proteinS."
FT                   /db_xref="EnsemblGenomes-Gn:L133770"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04229"
FT                   /db_xref="GOA:Q9CJ70"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ70"
FT                   /protein_id="AAK04229.1"
FT                   /translation="MKRTYQPHKKSRKTTHGFRSRMATKNGRRVLAARRRKGRASLTV"
FT   gene            134130..135041
FT                   /gene="ybdE"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.01 ENERGY METABOLISM.
FT                   Aerobic. There are six paralogs in L.lactis. Probably this
FT                   gene contains a frameshift mutation"
FT   gene            135110..135430
FT                   /gene="ybdG"
FT                   /locus_tag="L135065"
FT   CDS             135110..135430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdG"
FT                   /locus_tag="L135065"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General. belongs to the PBSX(XRE) family of transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:L135065"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04230"
FT                   /db_xref="GOA:Q9CJ69"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004288"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ69"
FT                   /protein_id="AAK04230.1"
FT                   /translation="MDFSKYFKKKNDSKVKNFSKLEIFEKVNDEELIEVSGGNFSSNLR
FT                   QKRAIAGLTQKELGKLLYSSKQAVCNWEHGRREPSLEVVQEMANVFKCSIDDLLKDSEN
FT                   IN"
FT   gene            135561..135788
FT                   /gene="ybdH"
FT                   /locus_tag="L135555"
FT   CDS             135561..135788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdH"
FT                   /locus_tag="L135555"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci"
FT                   /db_xref="EnsemblGenomes-Gn:L135555"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04231"
FT                   /db_xref="GOA:Q9CJ68"
FT                   /db_xref="InterPro:IPR004288"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ68"
FT                   /protein_id="AAK04231.1"
FT                   /translation="MLKTSPERTRKCVFMELQTIFEEFEVLTDEELLEVSGGGVTGNHS
FT                   LNSLLCDGGSGGGGGYDVVENYTNNFLKRG"
FT   gene            135966..136511
FT                   /gene="ybdI"
FT                   /locus_tag="L135900"
FT   CDS             135966..136511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdI"
FT                   /locus_tag="L135900"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   homology to OrfX from AbiG region of plasmid pCI750 from
FT                   Lactococcus lactis subsp. cremoris UC653"
FT                   /db_xref="EnsemblGenomes-Gn:L135900"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04232"
FT                   /db_xref="GOA:Q9CJ67"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ67"
FT                   /protein_id="AAK04232.1"
FT                   /translation="MEAVHDFYPILFLVILFIVLYIAIKTGVFAHFKETFRLQNLLWLL
FT                   GFVIVGYILGNIAHYLYLRFVPALDTIVENEATNNFVDSFLPTWFVYILMVVIAPIYEE
FT                   LMFREYFYRFFSHKWLAYILSILLFTLIHTRLTWSFFEYLPMSVIVTSTFHRYKRVSDS
FT                   IIVHGGYNLMVLIFHIII"
FT   gene            136564..137244
FT                   /gene="ybdJ"
FT                   /locus_tag="L136552"
FT   CDS             136564..137244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdJ"
FT                   /locus_tag="L136552"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   homology to OrfX from AbiG region of plasmid pCI750 from
FT                   Lactococcus lactis subsp. cremoris UC653"
FT                   /db_xref="EnsemblGenomes-Gn:L136552"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04233"
FT                   /db_xref="GOA:Q9CJ66"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ66"
FT                   /protein_id="AAK04233.1"
FT                   /translation="MIERIKKFLRTKFKPLLLLLVTVILYNGWTPHLGIFPPTFYDFAF
FT                   NYYGFVDILTFLVIIVIAYKNDAFKKIFDIFRPKNLLFILFFIVGGNIFIALAHHLYFQ
FT                   MTPALEAFPEHSIDLANYFARTPFWTHSLDLFVIGPISEELIYREYLYRLFDKKCLACF
FT                   VSVTMFAWVHTGFTYSFFLYLPISLVVTLAYHRRKAIGESIALHSSINLINTYLPNLLS
FT                   FWVF"
FT   gene            137413..137703
FT                   /gene="ybdK"
FT                   /locus_tag="L137335"
FT   CDS             137413..137703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdK"
FT                   /locus_tag="L137335"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.04 Transposon related
FT                   functions"
FT                   /db_xref="EnsemblGenomes-Gn:L137335"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04234"
FT                   /db_xref="GOA:Q7DAX3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAX3"
FT                   /protein_id="AAK04234.1"
FT                   /translation="MARRKFDKQFKNSAVKLILEEGYSVKEVSQELEVHANSLYRWVQE
FT                   VEEYGESAFPGNGTALANAQHKIKLLEKENRYLQEELELLKKFRVFLKRSK"
FT   gene            137799..138560
FT                   /gene="tra904B"
FT                   /locus_tag="L0458"
FT   CDS             137799..138560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra904B"
FT                   /locus_tag="L0458"
FT                   /product="transposase of IS904B"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:1328163 BIO14.04
FT                   Transposon related functions. BELONGS TO THE
FT                   IS3/IS150/IS904 FAMILY OF TRANSPOSASE. There are 9 such
FT                   elements in the chromosome."
FT                   /db_xref="EnsemblGenomes-Gn:L0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04235"
FT                   /db_xref="GOA:P35878"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35878"
FT                   /protein_id="AAK04235.1"
FT                   /translation="MHRRPSKQQVEREILSEKIKAVFHEHKGRYGAVRITKVLHNTGIM
FT                   TNTKRVGKLMHLMGLYAKGSRYKYKHYNRKGASLSRPNLINQIFKATAPNKVWLGDMTY
FT                   IPTKEGTLYLAVNIDVFSRKIVGWSMSSRMQDKLVRDCFLQACGKEHPQPGLIVHTDQG
FT                   SQYTSSRYQSTLRQVGAQSSMSRKGNPYDNAMMESFYKTLKRELINDAHFETRAEATQE
FT                   IFKYIETYYNTKRMHSGLDYKSPKDFEKYNS"
FT   gene            138617..139174
FT                   /gene="ybdL"
FT                   /locus_tag="L425"
FT   CDS             138617..139174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdL"
FT                   /locus_tag="L425"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.04 Transposon related
FT                   functions"
FT                   /db_xref="EnsemblGenomes-Gn:L425"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04236"
FT                   /db_xref="GOA:Q9CB10"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CB10"
FT                   /protein_id="AAK04236.1"
FT                   /translation="MVKYSIELKQRIIQDYLSGKGGSTYLAKLHNVGSSSQVRHWIRNY
FT                   RAEGLPTAHSKVNKNYSMELKENAVQCYLTTDLTYEAVARKFEITNFTLLASWVNHFKI
FT                   YGEVPISKKRGRRKKLESIASSMTQNPNDSQRIKELEQELRYAQIEVAYLKGLRRLEKN
FT                   ALMNKNQDSSTVSVKPSNSKKS"
FT   gene            139171..139989
FT                   /gene="tra1077B"
FT                   /locus_tag="L0467"
FT   CDS             139171..139989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra1077B"
FT                   /locus_tag="L0467"
FT                   /product="transposase of IS1077B"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:1328163 BIO14.04
FT                   Transposon related functions. BELONGS TO THE
FT                   IS3/IS150/IS904 FAMILY OF TRANSPOSASE. There are 7 such
FT                   elements in the chromosome."
FT                   /db_xref="EnsemblGenomes-Gn:L0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04237"
FT                   /db_xref="GOA:Q9CJ65"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ65"
FT                   /protein_id="AAK04237.1"
FT                   /translation="MKVTGFPKATYYYWVNCFERVNKDELIEKEMLKIRQEHANAGYRP
FT                   MSELLKQRGYHVNHKKVQRLMKKLGLRVTSYWHKLRNHNSYKGKVGTVAKNKLHRRFRT
FT                   SIPHQKITTDTTEFKYYEDGIQKKCYLNPYIDLFNSEVISYHISKHPSYQSIDIALNQA
FT                   LAVTSDCPYRRTFHSDQGWGYQMRDYVSKLKSHRIFQSMSRKGKCHDNSVMENFFGLLK
FT                   QEIYYGHIFSSFEELEQVIVIWIRYYNTKRIKQKLNWMSPIQFRLNYQNN"
FT   gene            complement(140045..140806)
FT                   /gene="tra904C"
FT                   /locus_tag="L0459"
FT   CDS             complement(140045..140806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra904C"
FT                   /locus_tag="L0459"
FT                   /product="transposase of IS904C"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:1328163 BIO14.04
FT                   Transposon related functions. BELONGS TO THE
FT                   IS3/IS150/IS904 FAMILY OF TRANSPOSASE. There are 9 such
FT                   elements in the chromosome."
FT                   /db_xref="EnsemblGenomes-Gn:L0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04238"
FT                   /db_xref="GOA:P35878"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35878"
FT                   /protein_id="AAK04238.1"
FT                   /translation="MHRRPSKQQVEREILSEKIKAVFHEHKGRYGAVRITKVLHNTGIM
FT                   TNTKRVGKLMHLMGLYAKGSRYKYKHYNRKGASLSRPNLINQIFKATAPNKVWLGDMTY
FT                   IPTKEGTLYLAVNIDVFSRKIVGWSMSSRMQDKLVRDCFLQACGKEHPQPGLIVHTDQG
FT                   SQYTSSRYQSTLRQVGAQSSMSRKGNPYDNAMMESFYKTLKRELINDAHFETRAEATQE
FT                   IFKYIETYYNTKRMHSGLDYKSPKDFEKYNS"
FT   gene            complement(140902..141192)
FT                   /gene="ybeG"
FT                   /locus_tag="L140905"
FT   CDS             complement(140902..141192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeG"
FT                   /locus_tag="L140905"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.04 Transposon related
FT                   functions"
FT                   /db_xref="EnsemblGenomes-Gn:L140905"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04239"
FT                   /db_xref="GOA:Q7DAX3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAX3"
FT                   /protein_id="AAK04239.1"
FT                   /translation="MARRKFDKQFKNSAVKLILEEGYSVKEVSQELEVHANSLYRWVQE
FT                   VEEYGESAFPGNGTALANAQHKIKLLEKENRYLQEELELLKKFRVFLKRSK"
FT   gene            141497..141763
FT                   /gene="ybeA"
FT                   /locus_tag="L141485"
FT   CDS             141497..141763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeA"
FT                   /locus_tag="L141485"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L141485"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04240"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ64"
FT                   /protein_id="AAK04240.1"
FT                   /translation="MSFTDETVRFEFGDSDKKEIGETLVDVYNVLEAKGYNPINQIVGY
FT                   VLSGDPAYIPRHDDARNKIRRFDRDDIVEELIKNYLKDNGVNL"
FT   gene            141835..142194
FT                   /gene="ybeB"
FT                   /locus_tag="L141748"
FT   CDS             141835..142194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeB"
FT                   /locus_tag="L141748"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L141748"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04241"
FT                   /db_xref="GOA:Q9CJ63"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ63"
FT                   /protein_id="AAK04241.1"
FT                   /translation="MTAQPVETIKIDSEAGELGFERLGVLIKEYKPEKVVLGLPKHMNG
FT                   DEGIRAEASRDYGTKLANEFGLEVAYQDERLTTAQAEKVLIDGGVRRKERKKSIDKLAA
FT                   VLILQNYLDAHALKL"
FT   gene            142347..142670
FT                   /gene="ybeC"
FT                   /locus_tag="L142332"
FT   CDS             142347..142670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeC"
FT                   /locus_tag="L142332"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   46% identical to YrzB of B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L142332"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04242"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ62"
FT                   /protein_id="AAK04242.1"
FT                   /translation="MTHTHDHEHDHNHEPDYITLVDENGNESLFQILITIDGQEEFGKN
FT                   YVVLQPTEFEEDEQGLIDVLAYSFTENADGTEGDLQPIPEDAEDEWDMIEEVFNSFMDE
FT                   QED"
FT   gene            complement(142701..143252)
FT                   /gene="ybeH"
FT                   /locus_tag="L142704"
FT   CDS             complement(142701..143252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeH"
FT                   /locus_tag="L142704"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   there are six paralogs in L.lactis"
FT                   /db_xref="EnsemblGenomes-Gn:L142704"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04243"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ61"
FT                   /protein_id="AAK04243.1"
FT                   /translation="MEKERFLAFTDAIIAIIATIMVLEFKTPDKSGWPALAELTIPLLA
FT                   YALSFFMIMTVWYNHHQLYRDIKNITPRIFLLNTLWLFIMSFFPFTTGWVGKHASEFLP
FT                   EFFYLIVIFLWAAVFHLMDHELLKENPDKEYKELTHSLSGRNLFLINFLSIVIVWFWPP
FT                   IGLVCVAMLATISLISFLKK"
FT   gene            complement(143347..144132)
FT                   /gene="cbr"
FT                   /locus_tag="L143350"
FT   CDS             complement(143347..144132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbr"
FT                   /locus_tag="L143350"
FT                   /product="carbonyl reductase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.01 ENERGY METABOLISM.
FT                   Aerobic. belongs to the short-chain
FT                   dehydrogenases/reductases family"
FT                   /db_xref="EnsemblGenomes-Gn:L143350"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04244"
FT                   /db_xref="GOA:Q9CJ60"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ60"
FT                   /protein_id="AAK04244.1"
FT                   /translation="MKTLITGENKGIGFALAQNLGHRGYEVLVGARNETRGQEAVEKLK
FT                   AEGITAKFVKVDLDDLNQLTSLSALTDIDLLINNAGISGNIHSDKGHLDMEKSAFDYST
FT                   TDLEETIKTNFLGTHAVIKELLPHSLTENAKIINITVPVSQEYWMPLAYVTSKAAQNAM
FT                   TFAFGHQFKKDKSKKQIFAVMPGAVATDLNGAKVGDSPFVKSPEETAQMISKFIFDDKN
FT                   HNAQIINFDGTIYDNYEPGLRNKVIKDVAKNGLKRKFKK"
FT   gene            complement(144152..144397)
FT                   /gene="ybeI"
FT                   /locus_tag="L144155"
FT   CDS             complement(144152..144397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeI"
FT                   /locus_tag="L144155"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci"
FT                   /db_xref="EnsemblGenomes-Gn:L144155"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04245"
FT                   /db_xref="InterPro:IPR018757"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ59"
FT                   /protein_id="AAK04245.1"
FT                   /translation="MSLNPLQMHNTKKELRKNFELTRLSKSEVATDLKISEVKLEKIEK
FT                   TGQQPVPFTALSGDWHRHWFLNSNLIDQQQMSKGDN"
FT   gene            complement(144407..145192)
FT                   /gene="dltE"
FT                   /locus_tag="L144410"
FT   CDS             complement(144407..145192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltE"
FT                   /locus_tag="L144410"
FT                   /product="oxidoreductase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.03 Surface
FT                   polysaccharides, lipopolysaccharides and antigens.
FT                   BIOSYNTHESIS OF D-ALANYL-LIPOTEICHOIC ACID. BELONGS TO THE
FT                   SHORT-CHAIN DEHYDROGENASES/REDUCTASES FAMILY"
FT                   /db_xref="EnsemblGenomes-Gn:L144410"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04246"
FT                   /db_xref="GOA:Q9CJ58"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ58"
FT                   /protein_id="AAK04246.1"
FT                   /translation="MTFTGHTILITGGTSGIGLGFAKKFSELGNKVIITARNEKRLNQI
FT                   LNENLTFTGFVSDVADKDSLPQLVNFIKENFPQLDVIMNCAGIMRAINLFEQADNSLKV
FT                   LTEEIHINLLGTIAVTQAFLKILVANNGLVINVSSGLSNLADGAHPIYNLTKAGVHFYS
FT                   DALREQAKYFEKTLKVIELVPPLVTETNLESHTNTDAPNNMALSDLISETLAGLENGLD
FT                   RIDAGFAKQLHQMGKVNSDENTKLLSQQMLSNYFPKMKD"
FT   gene            145304..145849
FT                   /gene="ybeD"
FT                   /locus_tag="L145301"
FT   CDS             145304..145849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeD"
FT                   /locus_tag="L145301"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General. BELONGS TO THE TETR/ACRR FAMILY OF TRANSCRIPTIONAL
FT                   REGULATORS"
FT                   /db_xref="EnsemblGenomes-Gn:L145301"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04247"
FT                   /db_xref="GOA:Q9CJ57"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ57"
FT                   /protein_id="AAK04247.1"
FT                   /translation="MNTREKILGKTEEFILENGIEKLTISKIAKELNISQPAIYKHFKS
FT                   KDELLTILALRWLNGQTLVKIFPFDTSKYEHQKEIVHDWLWSVAIAKYEAHRKTPEMFA
FT                   LYTTYIGENLELGRKHILEMVESLKTAAKFESEEEAAAYIQAFVYFHHPKIAPQWDDQF
FT                   QNQFENLWTLLEPNLNAF"
FT   gene            complement(145931..147876)
FT                   /gene="glgB"
FT                   /note="EVIDENCE BY HOMOLOGY BIO05.06 CENTRAL INTERMEDIARY
FT                   METABOLISM. Other. THIRD STEP IN STARCH BIOSYNTHESIS.
FT                   Probably a frameshift in this gene."
FT   gene            complement(148003..148323)
FT                   /gene="ybeM"
FT                   /locus_tag="L148007"
FT   CDS             complement(148003..148323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeM"
FT                   /locus_tag="L148007"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci"
FT                   /db_xref="EnsemblGenomes-Gn:L148007"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04248"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ56"
FT                   /protein_id="AAK04248.1"
FT                   /translation="MDYNDFMKSKHIAERWGELQANYKNLNKTSELKAYHDLLTEFYDY
FT                   IQSLEAHFFNDEKVADQKNLLTENVATPSQIFNAPKIPETLSFGQEALKGEEDPWFGFN
FT                   DE"
FT   gene            148795..154746
FT                   /gene="ybeF"
FT                   /locus_tag="L148778"
FT   CDS             148795..154746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeF"
FT                   /locus_tag="L148778"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L148778"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04249"
FT                   /db_xref="GOA:Q9CJ55"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR008970"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ55"
FT                   /protein_id="AAK04249.1"
FT                   /translation="MKSRKKVISIILGLMLLLQYVITPVGAIAGAINEETNDSDITLSQ
FT                   FKIDESESNADLMTFDLSLKINQSILKSKTTIIELDKSIKINEPNEANRQKSTASYTAD
FT                   ENRLTIDLNSLNTGEVKVNFSISKELLKNFERLTAKLNDSQVDVLLPKTSSTSETPSQS
FT                   TSTVTQNTVTPEIKEKESSTTKHSEQAIKTVESQDIRKLLEDSGISPATIIDSAKVIYL
FT                   DKEGKPYPDQTDVPIDAEVQIDYTWSIPEDILPLKSGDYFDFKLPDGVTIEQATSSLGD
FT                   YGTYTINADGTVRFVFNEKVETYHDIKGTFHYDAHFDKTIVPGEVVVDTPTEENFPPSE
FT                   IHVRPTYDQAIDKSGHFDKTPNPSEVIWEININRPLNTMENATLTDPMPEGTTYESVEI
FT                   YPETVGKNGEIISIDKEHPLVKGTDYTVDSNGKITFIGKYATTDQAFNVVYTTTIDESS
FT                   FPEKEGAVSFKNTATLNDGKTDTNESASVTAQYKGPIKKNGPFTTGNDQIYNWNIEYNY
FT                   NEKNHKAGSFIEDTMSDAIELVNGSVKLYKITFDSNGKEIKGAQLKEGEDYKLVQDPDN
FT                   PQKFKIEFITDIDYAVKVEYQTKVKDIVDGNVTIDNSVTTDTGDNSESGGNATQQGIVK
FT                   NIDGDIDYENREIPWKIDINSPGYWMENWSLEDKMSEGLTFLENTFQIIDKTAGNKVLS
FT                   PTEYTLIKTTAGFSVSFNSPLKEGTDHKYQIKYKTKFDTSVIDNGSGHEGDIKFVNDAS
FT                   MTWKDKNGGDHTNNDHKEFKPIPPFQYNGQKSGSYNATSKKITWTIAANFNQQELSNAS
FT                   ITDPISDDQNYVSGSAKVYEATINKNGTYTLGAEVTSDMGIKIVESKGSVKVELPDGST
FT                   KAYVLIFETSLEGNLINQKEYKNKATFTNKDISHDLSASVTPAHQGEFVTKDGSQSSTD
FT                   SNYVNWKLTVNASQSTLKNVEVTDNPSSNQYIVAKDILIYGTSIDASGNITENKNIILE
FT                   QGKDYSVDIQTDNSTGAQTVKIKFLSEINTAYVVEYRALITSDKANDVVTNQAHITGDN
FT                   EKIIEQDVEKDVPVTNHNGSANGSKGSVTLEKVGPGKAKLAGAHLQLWSIGTDGKKDKL
FT                   IREGDTDKNGDLKLGNLRVTDYLLIETKAPTGYTLDEELVKGKKITVAKDGEVSNFPIQ
FT                   DVENEPTKVILKKVGLTIENGKEVKNPLQGAEFKVLDSNGQVVSGYEKLTSDSSGNVTI
FT                   EKLTPGKYSLVETKAPAGYILDPTPIDFELKANEEGIIPDINLEKVNYQGSAQLIKHNS
FT                   NGQALSGAIFKVIDKDGNTIQTNLSSDKDGKVTATGLSPGDYSFVETKAPTGYILNTIP
FT                   VHFTISAEEEGQPQMVIASDNFINYQGSAELIKQDNEGQPLSGAVFKIVDKAGKTIQAN
FT                   LTSGKDGKVVVDGLAPGEYSFVETKAPTGYILNTNPVHFTISDKEEGQPKTIIASDSFV
FT                   NYQGSAQLIKRDSQGQPLLGAIFKVVDNTGKLVKEGLTSDKAGKVNVTGLAPGDYSFIE
FT                   TQAPTGYILNTIPTPFTILAESEGQPQLVVASDNFINYQGSAELIKHDINGQALSGAIF
FT                   KVIDADGKTIKEGLTSDETGKVLIEGLVPGDYSFVETKAPEGYILNTLPVNFSISGEEE
FT                   GKVKVVMASDNFINYQGSAELIKHDSQGQALEGAIFKVVDSKGKIIKEDLASDKTGKVL
FT                   IDNLAPGDYSFVETKAPSGYILNTSKVDFTISTKEEGQPKVVMASDNFINYQGSAELIK
FT                   HDSQGQALEGAVFKVIDSKGKSIKENLVSDKEGKVLIENLVPGDYSFVETKPPSSYILN
FT                   TSKVDFTISTKEENKPKIVMASENFINYQGSAELIKVDENGKSLSGAVFNVTNSETHEV
FT                   VIKGIKTDANGVIKANHLKPGKYTFVETEAPAGYQLSQETRAFEIKASAENKPQVVNTG
FT                   KFVNKRLPITPKKPELPKTGEERNTFLPIVGVGLLMVGATLYVFFKRRKM"
FT   gene            complement(155375..156523)
FT                   /gene="tgt"
FT                   /locus_tag="L0361"
FT   CDS             complement(155375..156523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="L0361"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.06 tRNA modification.
FT                   exchanges guanine residue with 7-aminomethyl-7-deazaguanine
FT                   in tRNAs with GU(N) anticodons (tRNA-Asp, Asn, His and
FT                   Tyr)."
FT                   /db_xref="EnsemblGenomes-Gn:L0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04250"
FT                   /db_xref="GOA:Q9CJ54"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ54"
FT                   /protein_id="AAK04250.1"
FT                   /translation="MTEHAIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATV
FT                   KTMSPEELKTLGSGIILSNTYHLWLRPGDELVAEAGGLHKFMNWDQPILTDSGGFQVYS
FT                   LVQNKKNITEEGVKFKSHLDGRELFLNPEKAISIQNNLGSDIMMSFDECPPFYQPYDYV
FT                   KASVERTSRWAERGLNAHRRPNDQGLFGIVQGAGFEDLRRQSARDLTSMDFAGYSIGGL
FT                   AVGESHKEMNAVLDFTTPMLPEDKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARN
FT                   GTLMTHFGRVNIRNAKYEHDFTPLDPMCDCYTCTNYTRAYLRHLIKADETFGLRLCSYH
FT                   NLHFLVNLMKDVRGAIMDDNLLEFREDFCERYGYNQPNAKDF"
FT   gene            156715..157407
FT                   /gene="ybfA"
FT                   /locus_tag="L156674"
FT   CDS             156715..157407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /locus_tag="L156674"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L156674"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04251"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ53"
FT                   /protein_id="AAK04251.1"
FT                   /translation="MSRWELKNQAKGALKDNFGSKMLLFIIPIIAGILGGGNGVKQSMD
FT                   YNTSNFDSIPGSVWMVISFATLLIAILMIVVALFVSVVTVGAIFNYIKIFRGERNNPQF
FT                   KNVFGPFYDGSAGKIILLSIVKGVIFVALMFIPVIGWAFAIYLGLGWSQATYVLFDQLE
FT                   EGRYSGVMSVLSESATMMKGLRGNYFIFKLSFFWWYVLYGISGGLAGFWTTPYLNMASI
FT                   AYYENIGK"
FT   gene            complement(157468..158649)
FT                   /gene="ybfD"
FT                   /locus_tag="L157472"
FT   CDS             complement(157468..158649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfD"
FT                   /locus_tag="L157472"
FT                   /product="transporter"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.08 TRANSPORT AND BINDING
FT                   proteinS. Multidrug resistance. homology to several
FT                   quinolene resistance proteins NorA"
FT                   /db_xref="EnsemblGenomes-Gn:L157472"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04252"
FT                   /db_xref="GOA:Q9CJ52"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ52"
FT                   /protein_id="AAK04252.1"
FT                   /translation="MKEKLWTTTFVVNMLLNFIFYLVFYLPTVVIGTMAMERYHASASI
FT                   AGILSGIFIVGGFIARLWAGNNMKRLGAKKLLYIGTLIYFLLTFAYFFVHSVVLLLILR
FT                   LVHGLGFGIAATASGTLAGAIVPSSRRGEGIGYYALSVTLSSAVGPFLSMFLYRTSGFY
FT                   SLIWLSALLLFIALVGIFFIHVEKTTDSSNSVDNKVHKKFAWSNYFEKEALPISLIAFL
FT                   IGISYSSILSFMDAYARNIHLSEAASFFFLVYAITVLLSRPITGRVFDGFGDNFVMYPT
FT                   YLFFALGLLLIGFAHSGWMLLLAAIFIGLGYGSFSPFGQAIAIRNSEAHRLGITTSTFF
FT                   GFMDMGVGFGPFILGMFMPLLGYRNLYFASAILALLIAVIYHFVHGRHAKREN"
FT   gene            complement(158830..159267)
FT                   /gene="ybfE"
FT                   /locus_tag="L158834"
FT   CDS             complement(158830..159267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfE"
FT                   /locus_tag="L158834"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:L158834"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04253"
FT                   /db_xref="GOA:Q9CJ51"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ51"
FT                   /protein_id="AAK04253.1"
FT                   /translation="MYEFENPEQEVMFDYLKNAKIIAVVGISDKTDRSSFLIAQGLQQN
FT                   GYHVIPVNPRLAGRELLGEKVYASIKEVPFHIDIVDIFRRSEFLADVARDFIETDADIF
FT                   WAQLGLQSQEAEQILREAGRNKIVMNRCIKIEYAYSGLGKK"
FT   gene            159402..160193
FT                   /gene="ybfB"
FT                   /locus_tag="L159400"
FT   CDS             159402..160193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfB"
FT                   /locus_tag="L159400"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   25% identical to streptodornase (DNAse) from Streptococcus
FT                   pyogenes"
FT                   /db_xref="EnsemblGenomes-Gn:L159400"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04254"
FT                   /db_xref="GOA:Q9CJ50"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ50"
FT                   /protein_id="AAK04254.1"
FT                   /translation="MNKKQIKTLTSVIVVIIALAVGYFGSGRLHLGQGNNSATDNSSQV
FT                   STKSLASSVKQAPLTFKNQRQMVMANTDALGRAVDSHIQLKDSQEPKVKREPLTYNPVG
FT                   WHNYNFYYKKSDGSIGKMWLMARGHLVGYQFSGLNNEARNLVPETAWFNGGNFTGTNDG
FT                   NTASMLYYENRLDSWLANHPNYYLDYQVTPLYEGNELLPRQIRLAYVGIDKNGQTLSIK
FT                   LGGGREKSGNGGATVVVLDNVAPNAKINYADGTAVNTVSPK"
FT   gene            160358..160567
FT                   /gene="ybfC"
FT                   /locus_tag="L160332"
FT   CDS             160358..160567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfC"
FT                   /locus_tag="L160332"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   there are two paralogs in L.lactis, also ybgA. Homologs not
FT                   detected in Streptococci"
FT                   /db_xref="EnsemblGenomes-Gn:L160332"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04255"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ49"
FT                   /protein_id="AAK04255.1"
FT                   /translation="MFLLLILFLAMLLFIKGFFKIVLPALIILMILKFLFGGLMLLLSP
FT                   HFWGTLLVISIIVWLVRASRSRYY"
FT   gene            160579..160818
FT                   /gene="ybgA"
FT                   /locus_tag="L160556"
FT   CDS             160579..160818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgA"
FT                   /locus_tag="L160556"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   there are two paralogs in L.lactis, also ybfC. Homologs not
FT                   detected in Streptococci"
FT                   /db_xref="EnsemblGenomes-Gn:L160556"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04256"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ48"
FT                   /protein_id="AAK04256.1"
FT                   /translation="MFVGFLSGLIVMGALLSILLVLLGVMALRVFVRYILPILLILLII
FT                   RLIISGIVLLFNPHFWLFIAVVALVLWILGKIRN"
FT   gene            161014..162597
FT                   /gene="ybgB"
FT                   /locus_tag="L160937"
FT   CDS             161014..162597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgB"
FT                   /locus_tag="L160937"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 28%
FT                   identical to a protein from Streptococci"
FT                   /db_xref="EnsemblGenomes-Gn:L160937"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04257"
FT                   /db_xref="InterPro:IPR016978"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ47"
FT                   /protein_id="AAK04257.1"
FT                   /translation="MSNEYRSRSSRRERRSSRWANKDSDVVEAAANQANRHLEEEPEGQ
FT                   NVERTSRQKLTHEKTLRIPLAVYGLLTGLSVLLALSFYAFPLWKPVATASQSQNLYSGF
FT                   AMHHGLVPFNDFYGTGGTVFYLINWLGNIGGTTWLLWLFEIIALLISGILVYRLVGQQT
FT                   KNQTASLTVSVFTLVIIAGLARGGDSPTLFALPFALWAARFLSSYFQDSSTDRGFIRFG
FT                   MAAAFALVISPVMSVFFILSAIALIIHNVGSRKIGRGFYQMLATILGVLLVGYSVAYYS
FT                   LEEQTIYTSIEQSILIPFTHFGPSGDLLLTLAKALVLTLIFGIVAGFVQGIVQLKKGGP
FT                   ARVWYVMMLIGIVGLTTMIVFAQTFDSSNLLAVLPFTIVFAGLGLTDSDQILLKYLQNR
FT                   LFAPILAILFVVFTPISYHFMNRTIASEEQSVAQYIKANATGSDRVYVVADGKNINNLT
FT                   KTISTLDNVPANYPIKFTQSYDLKVGKLSDKFVVLQASEKAPTSLKKVLDKDYKVTNYA
FT                   GKYFQVYKKK"
FT   gene            162666..163880
FT                   /gene="aspC"
FT                   /locus_tag="L162604"
FT   CDS             162666..163880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="L162604"
FT                   /product="aspartate aminotransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO01.03 AMINO-ACID
FT                   BIOSYNTHESIS. Aspartate family"
FT                   /db_xref="EnsemblGenomes-Gn:L162604"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04258"
FT                   /db_xref="GOA:Q9CJ46"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ46"
FT                   /protein_id="AAK04258.1"
FT                   /translation="MRKFEKSHKLDNVSYDIRGPVLDEAQRMRANGEKILRLNTGNPAE
FT                   FGFLAPDEVISDLIQHAVDSEGYSDSKGIFSARKAIMQYCQLKGFPNLDINDIFTGNGV
FT                   SELIVMAMQGLLDTGDEVLIPMPDYPLWTASVSLAGGTAVHYLCDEQAGWFPDIDDIRS
FT                   KITSNTKAIVLINPNNPTGALYSKDLLLEIVQVARENNLIIFSDEIYDRLVMDGAVHVP
FT                   IASLAPDLFVVTMNGLSKSHRIAGFRVGWMVLSGEKSHVKGYIEGLNMLASMRLCSNVL
FT                   AQSVVQTSLGGTQSVDKLLLPGGRVYEQREFIYKAINDIPGLSAVKPQAAFYIFPKIDR
FT                   EMYKIDNDEQFVLDFLKQEKILLVHGRGFNWKEPDHFRIVYLPRVDELAEIQEKMERFL
FT                   WQYRK"
FT   gene            164033..164821
FT                   /gene="codY"
FT                   /locus_tag="L0243"
FT   CDS             164033..164821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codY"
FT                   /locus_tag="L0243"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General. BELONGS TO THE CODY FAMILY OF TRANSCRIPTIONAL
FT                   REGULATORS. Regulates proteolytic system."
FT                   /db_xref="EnsemblGenomes-Gn:L0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04259"
FT                   /db_xref="GOA:Q9CJ45"
FT                   /db_xref="InterPro:IPR010312"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013198"
FT                   /db_xref="InterPro:IPR014154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ45"
FT                   /protein_id="AAK04259.1"
FT                   /translation="MATLLEKTRKITAILQDGVTDLQQELPYNSMTERLANVIDCNACV
FT                   INTKGELLGYSLPYNTNNDRVDQFFYDRKLPDEYVRAAVRIYDTMANVPVDRPLAIFPE
FT                   ESLGDFPKGVTTLAPIYGSGMRLGTFIMWREDGEFTDDDLVLVELATTVIGVQLSNLKL
FT                   EQMEENIRKDTMATMAVNTLSYSEMKAVKAIIEELDGEEGHVIASVIADKIGITRSVIV
FT                   NALRKLESAGVIESRSLGMKGTYLKVLNTGLFDKLAGRNF"
FT   gene            165330..165635
FT                   /gene="gatC"
FT                   /locus_tag="L0475"
FT   CDS             165330..165635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="L0475"
FT                   /product="Glu-tRNA amidotransferase subunit C"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.06 tRNA modification.
FT                   ESSENTIAL COMPONENT OF TRANSLATIONAL APPARATUS"
FT                   /db_xref="EnsemblGenomes-Gn:L0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04260"
FT                   /db_xref="GOA:Q9CJ44"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ44"
FT                   /protein_id="AAK04260.1"
FT                   /translation="MSQITEEQVKHVALLSKLEFSENEVKSFTDTFGKIIDMVEMLDEV
FT                   DGEGVPFTMNVADNLNFMREDVAEKGLDREKLMAAVPEKEDGFIKVPAMLSDGGDA"
FT   gene            165635..167095
FT                   /gene="gatA"
FT                   /locus_tag="L0473"
FT   CDS             165635..167095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="L0473"
FT                   /product="Glu-tRNA amidotransferase subunit A"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.06 tRNA modification.
FT                   ESSENTIAL COMPONENT OF TRANSLATIONAL APPARATUS"
FT                   /db_xref="EnsemblGenomes-Gn:L0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04261"
FT                   /db_xref="GOA:Q9CJ43"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ43"
FT                   /protein_id="AAK04261.1"
FT                   /translation="MSYNNKSIKELHELLVNKEISALELTKATLSDISAREPQIDAFLK
FT                   ITEEKALQDAAAIDARGINPDVVTDGISIAVKDNIVTEGIETTAASKILGGWIPPYNAT
FT                   VANKLSESGLITIGKLNMDEFAMGGSGENSSVKPTKNAWDQTKVPGGSSSGSAASVASG
FT                   QVRLSLGSDTGGSIRQPAAFNGIVGLKPTYGRVSRFGLIAFASSLDQIGPLAPTVEENA
FT                   QLLNVISGFDKNDSTSSNVAVPDFTSKIGQDIKGMKIALPKEYFGEGIDEKVKEQILAA
FT                   AKHLEKLGAIVEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGYRAQDIKNLEDL
FT                   YVKSRSEGFGPEVQRRIMLGTFSLSAGSYDKHFKKAGQVRTLIINDFAKVFEKYDLILG
FT                   PTTPTPAWDLGARVDDPLSMYLADLLTIPVNLAGLPGISIPAGFADGLPVGMQLIGKRY
FT                   DEETIYKVAAAFEATTDFHKKQPIIFGK"
FT   gene            167099..167701
FT                   /gene="ybgD"
FT                   /locus_tag="L167097"
FT   CDS             167099..167701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgD"
FT                   /locus_tag="L167097"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   40% identical to several MutT-like proteins"
FT                   /db_xref="EnsemblGenomes-Gn:L167097"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04262"
FT                   /db_xref="GOA:Q9CJ42"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ42"
FT                   /protein_id="AAK04262.1"
FT                   /translation="MEFDELIKRLNAVADAGLFYGKDVFDIERYHEIKAILPQLLKHST
FT                   TLTKEELTDLFRPNNSYPTPMIDVRAFIQNEEKEILFVRDKMQGDWALPGGYGEIGFTP
FT                   SENLLKELKEEAGVSGEIERLLAIFDTDKCQPQGKQYYKFVFKCKALSIDFLENSETSE
FT                   TKFIKRSELTNLSVKRTTMSQLSLLEKLSKTGKQYID"
FT   gene            167708..169174
FT                   /gene="gatB"
FT                   /locus_tag="L0474"
FT   CDS             167708..169174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="L0474"
FT                   /product="Glu-tRNA amidotransferase subunit B"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.06 tRNA modification.
FT                   ESSENTIAL COMPONENT OF TRANSLATIONAL APPARATUS"
FT                   /db_xref="EnsemblGenomes-Gn:L0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04263"
FT                   /db_xref="GOA:Q9CJ41"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ41"
FT                   /protein_id="AAK04263.1"
FT                   /translation="MTFLKKVSEKIMNFETVIGLEVHVELSTNSKIFSPASTKFGGDPN
FT                   TNTNVIDWSLPGVLPVMNKGVIDSGIKAALALNMDIHKSMHFDRKNYFYPDNPKAYQIS
FT                   QFDEPIGYNGSIEIELEDGHKATIRIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIE
FT                   IVSEADMRTPEEAYAYLTALKEAILYTGISDVKMEEGSMRCDANVSLRPYGQEAFGVKT
FT                   EVKNMNSFSNVKKALDFEVDRQAKILRAGGEIRQETRRFNDKTGETILMRVKEGASDYR
FT                   YFPEPDVPRFEISEEWVEQMRESLPMTAKARRAHYINDLALSDYDARQLTATKEVSDFF
FT                   DQAIKFDTDPKLVSNWLQGEVAQYLNSEKKELHEIGLTPENLTEMIRLISDGTISSKIA
FT                   KKVFIELAKNGGSAEEFVKKAGLVQISDPAVLLPIIHDVFAKNEQSVADYRGGKQNAAK
FT                   ALVGQLMKATKGQANPTVAQKLLYQELDNF"
FT   gene            169398..170897
FT                   /gene="ybgE"
FT                   /locus_tag="L169390"
FT   CDS             169398..170897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgE"
FT                   /locus_tag="L169390"
FT                   /product="amidase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   26% identical to 6-aminohexanoate-cyclic-dimer hydrolase of
FT                   Flavobacterium sp, belonding to the amidase family"
FT                   /db_xref="EnsemblGenomes-Gn:L169390"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04264"
FT                   /db_xref="GOA:Q9CJ40"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ40"
FT                   /protein_id="AAK04264.1"
FT                   /translation="MLEIKDATYWAEQLKSGNLSAKALLEMTNDKIQKLNPRYNAIVAY
FT                   DLEKAKADLALTSQGFFAGLPFALKMLGQTHKGLPDTASSHLFSENVASEDDNYVKGLL
FT                   EAGFTPFGQTNSPEFGFKNISDSKLYGDTRNVWNEAYYSGGSSGGAASAVVSGMFAIAG
FT                   ASDGGGSIRIPASFSGLIGLKMTRGRMPQGPDSYRGWQGASISGALTVSVRDTARFVLE
FT                   MQTLQEAAPYQAKLLDEKELIALTKSTGQAVSNNLSRKIKIAYSLQSPISGIELSKDAI
FT                   NACLKAVEFLERQGHELTEVDFPIEARPLIQSYYRMNAAEIVAMLEPWERAAGRKLTSQ
FT                   DVELLTYALLEAGRKAPVSSYINALAQWDLAARDFTDKIYKDYDLFLTATTAKTAPKIG
FT                   QELMTAEVLKEMSEISQYEFEQQIEIIEAAFERSLAFTPYNFISNLTGQPALSLPVYVN
FT                   EETNLPLGIQLWGPKNSEIELLKVAKEFEEAGQFILPKAYQ"
FT   gene            complement(170979..172319)
FT                   /gene="dinF"
FT                   /locus_tag="L170983"
FT   CDS             complement(170979..172319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinF"
FT                   /locus_tag="L170983"
FT                   /product="damage-inducible protein DinF"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.01 Adaptations and
FT                   atypical conditions. 34% identical to DinF protein from
FT                   S.pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:L170983"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04265"
FT                   /db_xref="GOA:Q9CJ39"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ39"
FT                   /protein_id="AAK04265.1"
FT                   /translation="MKDLTKGNILTGLIAFTLPLLMGNFFQVLYNTADTLIVGQTLGKD
FT                   ALASVGATGSINFLIVGFAQGMTAGLTILTAQRFGAKDELAIKKSYVTGLYFTIAISIL
FT                   LSILSLIFVGPLLQVMQTPSQIFEGAKTFLSIMLGGMIATNLYAYLSNALRALGDSKTP
FT                   LYALIAASILNIAFEYFAILVLKLGIAGASGATILAQMISVLFLFWHIKRKVPEFQISK
FT                   NLWRLDRAEIVHHARLGIPMGFQSSIIAIGSITLQVALNKMGTNAVATQAIVSKIDQFA
FT                   MLPMISIGLAMATFGAQNYGAKQYKRINQGLTRALTIAVGWSIIFAIILNLAHFYFTTA
FT                   FISSSQTAVIEMSSHYYLVNGSFYWLLAILFVTRSTIQGLGNAKIPTLCGFAELFMRAG
FT                   VAIIGVLLLNYTVIISSNPAAWLGSTSILIPTTIRMIKRFRQNQDLA"
FT   gene            complement(172501..172698)
FT                   /gene="cspE"
FT                   /locus_tag="L172505"
FT   CDS             complement(172501..172698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspE"
FT                   /locus_tag="L172505"
FT                   /product="cold shock protein E"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.01 Adaptations and
FT                   atypical conditions. BELONGS TO THE COLD-SHOCK DOMAIN (CSD)
FT                   FAMILY"
FT                   /db_xref="EnsemblGenomes-Gn:L172505"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04266"
FT                   /db_xref="GOA:Q9CJ38"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ38"
FT                   /protein_id="AAK04266.1"
FT                   /translation="MAQGTVKWFNATKGFGFITTEEGNDVFAHFSAIQTDGFKTLDEGQ
FT                   KVTFDVEDGPRGPQAVNIQK"
FT   gene            172816..173349
FT                   /gene="ybhA"
FT                   /locus_tag="L172782"
FT   CDS             172816..173349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhA"
FT                   /locus_tag="L172782"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   similar to several 5-FORMYLTETRAHYDROFOLATE CYCLO-LIGASES"
FT                   /db_xref="EnsemblGenomes-Gn:L172782"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04267"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ37"
FT                   /protein_id="AAK04267.1"
FT                   /translation="MESKAENRKKILQMLKNFSDYEKRRQNKDVLKQLTASSKWKSAKK
FT                   IALYMSMPIEFNLTELFDQSDDKEILIPKCLPERQMIFAKYDKENLVRSKFGLLEPKSE
FT                   IAVEPDFILVPGLIWNDEGYRIGFGGGYYDRYLANFEGSTASVLYDFQKMDFEAESHDI
FT                   AVQELFIGRKNNEF"
FT   gene            173339..174031
FT                   /gene="ybhB"
FT                   /locus_tag="L173329"
FT   CDS             173339..174031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhB"
FT                   /locus_tag="L173329"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:L173329"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04268"
FT                   /db_xref="GOA:Q9CJ36"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ36"
FT                   /protein_id="AAK04268.1"
FT                   /translation="MNFNEIKRDFTRYKATYILSIITLLVWLWQFFTYGISATSAINLF
FT                   NSGAILGQVMLFDPSQMWRLFTALFIHIGWAHVLLNVATLFFIGRQIENVFGWLRFTLI
FT                   YLLSGIFGNAMVFLLTPRVVSAGASTSIFGLFAAVVGLAFFTKHPFLQQIGRMFTVLIV
FT                   ANLVMNLFSLGNVSIWAHIGGAIGGLLLSAIFAPKAFIPSIPKQYRIFATGAFVILLVL
FT                   FIGLPFFK"
FT   gene            174131..174562
FT                   /gene="ybhC"
FT                   /locus_tag="L174251"
FT   CDS             174131..174562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhC"
FT                   /locus_tag="L174251"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 36%
FT                   identical to a protein from Enterococcus faecalis."
FT                   /db_xref="EnsemblGenomes-Gn:L174251"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04269"
FT                   /db_xref="InterPro:IPR021701"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ35"
FT                   /protein_id="AAK04269.1"
FT                   /translation="MRIDKIVDAPREFIFEKIIDSCLFDIEKNTGKRPKVRSLNGYEYS
FT                   KSFGKNQRGSIKITELTEPSIYAFTTKTNRNTFSTRWELHKIDDRSTQVVIEEHQTSNG
FT                   FIQMINDKAVGFFLGRFKKRQMVAVLDNVNRAYNGGRAR"
FT   gene            174953..176005
FT                   /gene="ybhD"
FT                   /locus_tag="L174946"
FT   CDS             174953..176005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhD"
FT                   /locus_tag="L174946"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 36%
FT                   identical to a protein from Enterococcus faecalis."
FT                   /db_xref="EnsemblGenomes-Gn:L174946"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04270"
FT                   /db_xref="GOA:Q9CJ34"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ34"
FT                   /protein_id="AAK04270.1"
FT                   /translation="MNANTKNNKEFLDLATYAFHKPKTKERAKAFDKLLEFSTPYGHYE
FT                   NQKLTSMVIDSHFNVYWKNQEVKTSGIGYVASYPQFRGNGAIRQLMTKSLRDNYEKGVI
FT                   FSYLAPFSYAFYEKFGYHYAFNQKHYRLAAQDFPKGKRSAGEISREKFEFDDENASEFS
FT                   ISKNTALFKVLTEVHQKADNQGSLIRSPELWSYFFSFKSQPHCAIYRENGKALGYLLYE
FT                   FSEMTFVIKELITLTDEAKQAFYRFISSHAGSFSEISWQAPSDILLEEELTEPQRAEIK
FT                   LVPYMQARIVNLQEFLKVHGQPDFSVEITDEIIPENNISLGEGKREKMTIGQFTAKILK
FT                   ENQAILREYF"
FT   gene            176338..177432
FT                   /gene="ybhE"
FT                   /locus_tag="L176316"
FT   CDS             176338..177432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhE"
FT                   /locus_tag="L176316"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   40% identical to outer surface protein of Borrelia
FT                   burgdorferi"
FT                   /db_xref="EnsemblGenomes-Gn:L176316"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04271"
FT                   /db_xref="GOA:Q9CJ33"
FT                   /db_xref="InterPro:IPR008589"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ33"
FT                   /protein_id="AAK04271.1"
FT                   /translation="MGKLGVSIYPERSNFEADKAYLDLAHQYGFKRVFTSLLEIDGDKE
FT                   GVLAAFKKVVDYANQLGMEVMVDINPGLFTQLNISYDDLSFFHEMGADGVRLDIGFTGA
FT                   EEARMTRNPYGIKIEINMSQGTTYVDSIMDYSPDTEKLLGSHNFYPHRYTGLEFNHYLK
FT                   CTEKFKGYNLNTMAFVNSQAATFGPWPTQDGLCTLEDHRSLEIATQVKHYKLLGGIDDV
FT                   TIANAYASEEELKAMSQAFNASMPEIKVVPRETISENERKCLFEATHSYRGDKSAYMLR
FT                   STMTRITYKDLEFPAHDTDKIQRGDVIIDNEGYGQYKGETQIALREMENDGRVNVVGRI
FT                   ADDELFLLDFLKPWSSFKLIESKK"
FT   gene            177530..179014
FT                   /gene="celB"
FT                   /locus_tag="L177520"
FT   CDS             177530..179014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="celB"
FT                   /locus_tag="L177520"
FT                   /product="cellobiose-specific PTS system IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.07 TRANSPORT AND BINDING
FT                   proteinS. PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:L177520"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04272"
FT                   /db_xref="GOA:Q9CJ32"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ32"
FT                   /protein_id="AAK04272.1"
FT                   /translation="MNGITAWMEKYLVPVAAKIGSQKHLVALRDSFIGMLPATLAGALA
FT                   AMISAIVTTFPSAIQQMMLGATAFSKLAPEKVWTLANTPIIGDLNNISALVNQGTLTVI
FT                   GLIFAFSWGYNLARAYGVNDLAGGIVSLATLFAGLPNQMGKFTAALGTGKAGVAATDKL
FT                   NGVLGDQGLAAWKPLFASAHLDAGAYFTVIIMGALAVIIYAKLMLADITIKMPESVPPA
FT                   VAKAFLAIIPTIAALYIVGLIYYIIGKLTNDSVINLITHYIAEPFQILSQNIFSVLIVT
FT                   LFVSVFWFFGLHGPNVLAPVLDGIWGPLGLNNQALYFQVHSQGIRDLIAKGAVDKAHAI
FT                   NGDYVNLWVRGSWDAFAWFGGSGGTITLVIAIILFSKRKDYKIVGRLGLAPGIFNINEP
FT                   VLFGLPVVLNAIFFIPFAVAPLISVIIAYTATALHLVDPVVNAVPWVTPPIMNAFMATG
FT                   FDWRAIVLTIINLIITFVIWVPFVIAANKLEETELD"
FT   gene            179668..181104
FT                   /gene="bglS"
FT                   /locus_tag="L179659"
FT   CDS             179668..181104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglS"
FT                   /locus_tag="L179659"
FT                   /product="beta-glucosidase A"
FT                   /EC_number="3.2.1.21"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.12 ENERGY METABOLISM.
FT                   Sugars. HYDROLYSIS OF TERMINAL, NON-REDUCING BETA-D-GLUCOSE
FT                   RESIDUES WITH RELEASE OF BETA-D-GLUCOSE"
FT                   /db_xref="EnsemblGenomes-Gn:L179659"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04273"
FT                   /db_xref="GOA:Q9CJ31"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ31"
FT                   /protein_id="AAK04273.1"
FT                   /translation="MEHKKLKAFPNDFLWGSASAAYQVEGAPFEDGKKASVWDNFVRIP
FT                   GKTFKGTNGDVAVDHYHRYKEDVALMKELGLKSYRFSIAWTRILPDGRGEVNQAGLKFY
FT                   EDLIDELIANEIEPIVTIYHWDLPQALEDLYGGWESREIIADFVNYAEVLFNAFKGKVK
FT                   YWVSLNEQNIFTSQGWSLATHPPGKRDMKLFYQVNHIANLTNAAVINKFHELEMDGQIG
FT                   PSFAYTPQYAKDSDPLNVLAAENAEELYSHFWMDVYLYGEYPIAAMAYLRENGLAPEFE
FT                   AGDAELLKSAKPDFLGINYYQTATNAWNPVDGGVGVGSFNTSGKKGTTKESGIPGLHKK
FT                   IQNPFIDRTNWDWEIDPEGLRIALRRITSRYRIPVMITENGLGEYDKVEDGKIHDDYRI
FT                   KYLESHVKAIKEAMTDGAKVIGYHTWSYTDLLSWLNGYQKRYGFVYVDQDETMEGSLKR
FT                   IPKDSYYWYQHLIETNAEEV"
FT   gene            181168..181620
FT                   /gene="dut"
FT                   /locus_tag="L181168"
FT   CDS             181168..181620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="L181168"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidhydrolase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO08.04 Pyrimidine
FT                   ribonucleotide biosynthesis. DE NOVO SYNTHESIS OF
FT                   THYMIDYLATE. BELONGS TO THE DUTPASE FAMILY"
FT                   /db_xref="EnsemblGenomes-Gn:L181168"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04274"
FT                   /db_xref="GOA:Q9CJ30"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ30"
FT                   /protein_id="AAK04274.1"
FT                   /translation="MKIRGFEVVTKYKNAGINIPKRSTEHSAGYDIEAAETVSFAPGEI
FT                   KLIPTGLKAYMQAGEVLYMYDRSSNPRKKGLVLINSVGVIDKDYYNNPDNEGHMFMQMR
FT                   NFTDEEVVIEKGERVVQGVFMPFLVADGDENQEKEERTGGFGSTGA"
FT   gene            181873..183216
FT                   /gene="ybiB"
FT                   /locus_tag="L181858"
FT   CDS             181873..183216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiB"
FT                   /locus_tag="L181858"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   similar to several 5'-nucleotidases"
FT                   /db_xref="EnsemblGenomes-Gn:L181858"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04275"
FT                   /db_xref="GOA:Q9CJ29"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR011240"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ29"
FT                   /protein_id="AAK04275.1"
FT                   /translation="MNKLRILHLNDLHSHLERFPVIERFFAEKSHEEVESLSFDLGDNV
FT                   DRVHPLTEATEGQFNVELMNRLDLTAATIGNNEGLGLTHEMLSHLYDEANFPVLLSNLA
FT                   TNFAQSEPLIVTTSFGLRIGLIGLTAPYVLAYPQAGWELSDPFVVLDELLPKLDCDFTI
FT                   LLSHLGKNVDEQIAKDYDEIDLIIGAHTHHLFEHGAQVNQTLLAAAGRYGEYVGQIDLT
FT                   FNENNQLVDAQIEAIATNTLPQRKSDLVETNGWELRGHKLLEGTVVADLPKALPNVLPD
FT                   FKGSHYLAKIFADYGNTKLCLMNSGLLVTDELPNHLTLDDLHEFLPHSIRLVRFTFTGE
FT                   ELRQVLLEIMDVSDFLATQKIQGMGFRGKTFGSLIFHGIEPREGDFYIKNSENQSLEKI
FT                   SDEESYQIVLPDQYLFAWYFPLLKKLGKSEILFPYFLREIVAEHFKNK"
FT   gene            183231..183986
FT                   /gene="ybiC"
FT                   /locus_tag="L183216"
FT   CDS             183231..183986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiC"
FT                   /locus_tag="L183216"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   53% identical to YutD protein of B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L183216"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04276"
FT                   /db_xref="InterPro:IPR009370"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ28"
FT                   /protein_id="AAK04276.1"
FT                   /translation="MAKVIDESKLNYNKYPGEHVMAVGEVVQVGQRTFHIVHNYREAFD
FT                   AEKLEQRFSDVLDKYDYIVGDWGFEQLRLKGFFSTSRRKMLADNKIDHLEDYVNEYCNY
FT                   GCAYFVLRRIRTKDEAFVSEKLFTEKELKQGFDKPRRKRNRNRNWARDEQKVTKEDKRS
FT                   ENSSEARKDFKIREKSTDRKPKVTDKNKKVSVSKKSQERKTDNKKQNPAKDSDKKFTMK
FT                   KRNPRKKVEQTETKKQENQGFVIRNRKKD"
FT   gene            184180..185277
FT                   /gene="ybiD"
FT                   /locus_tag="L184159"
FT   CDS             184180..185277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiD"
FT                   /locus_tag="L184159"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:L184159"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04277"
FT                   /db_xref="GOA:Q9CJ27"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ27"
FT                   /protein_id="AAK04277.1"
FT                   /translation="MTENIITETRPSIYGLTRDQLIEWAIENGEKKFRATQVWDWLYRK
FT                   RVQSFEEMSNLSAAFIDKLNEHFILNPLEQVVVQESADGTVKYLFMLPDQMMIETVLMR
FT                   QSYGLSVCVTTQVGCNMGCTFCASGILKKERDVTAGEIVSQIMLVQKYFDERGLDERVS
FT                   HVVVMGIGEPFDNYEHLMNFLRVINDDNGLAIGARHITVSTCGFMPAKIKEFAHENLQI
FT                   NLAISLHAPNNELRTSLMRITRNAPLEKLFEAIDYYTETTNRRVTYEYIMLSGENDSPE
FT                   IAQQLADLIKPRNKLSYVNLIPYNPVAEHIKYERSTKDNTAKFYDVLKKNGINCVVRQE
FT                   HGTDIDAACGQLRSKQIKKNKAKLA"
FT   gene            185523..186134
FT                   /gene="ybiE"
FT                   /locus_tag="L185517"
FT   CDS             185523..186134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiE"
FT                   /locus_tag="L185517"
FT                   /product="oxidoreductase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.01 ENERGY METABOLISM.
FT                   Aerobic. similar to different oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:L185517"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04278"
FT                   /db_xref="GOA:Q9CJ26"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ26"
FT                   /protein_id="AAK04278.1"
FT                   /translation="MDYVKLNKSRHKVKNFDGKKIPTVDVKQIISAASLAPSAHNIQSW
FT                   HFVIVESEEKREALLSEVDPGNHEQIKQAGAVIVLFSDTDLVERSRDIARLGAGELDDE
FT                   QLLRFNSRYPQMYEGFEELHESNYLSINIGLVTMNLVLAIKNYGYESNIIMGFNRTQKV
FT                   NEILEVEKRYRPELIIPLGNSEDKGKPSYRLPQSQIMEIR"
FT   gene            186285..187265
FT                   /gene="preA"
FT                   /locus_tag="L186258"
FT   CDS             186285..187265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="preA"
FT                   /locus_tag="L186258"
FT                   /product="prenyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:L186258"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04279"
FT                   /db_xref="GOA:Q9CJ25"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ25"
FT                   /protein_id="AAK04279.1"
FT                   /translation="MLTFWQDYPEIQNKLKDVQALMIERLKINNQEIEAALEKFASRGG
FT                   KMVRPALFLLFAGIVPNGSKDEEKIIKIAASLEMLHSATLIHDDIIDDSPLRRGLPSIE
FT                   SQFGKDVAVYAGDFVYTVYFELLIETMNGTSFVAKNAQSMKKILQGELTQMQSAFDKNN
FT                   TARRYMKAISGKTAELLSLSCLEGVYFAGGDKKLQHSARKIGRAIGLAFQVYDDILNFT
FT                   VGLDEADKPILTDFRQGIYTLPLLLAREVNDEAIAPYLEAPENLSRQECLDLAELVTES
FT                   GGIAGALLVAGRLTELALNEIRKLPESTNRQILEEATQILLERNY"
FT   gene            187459..188364
FT                   /gene="ybiG"
FT                   /locus_tag="L187450"
FT   CDS             187459..188364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiG"
FT                   /locus_tag="L187450"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   there are three paralogs in L.lactis. 21% identical to to
FT                   putative 1,4-dihydroxy-2-naphthoate octaprenyltransferase
FT                   of B.subtilis."
FT                   /db_xref="EnsemblGenomes-Gn:L187450"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04280"
FT                   /db_xref="GOA:Q9CJ24"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ24"
FT                   /protein_id="AAK04280.1"
FT                   /translation="MNFKIFAELIELKAKTASIFPFLLGLAYSLYHYQSVNLSALAIYF
FT                   VAMFMFNCFVDIWDNYNDYHKAVDTDDYQKNTNIIGRENLSMGLIKSLLAFFFFGSLIL
FT                   GIIVALMTGWAVFWLGLLCYVVGVFYAGGPKPLSSLPLGELLSGLTMGYVIFLICLYIN
FT                   SSQNFVWSFANLATTFLIALPNTLLIANLMLANNTCDLEEDEANHRYTIVHYIGKKAAL
FT                   IWWTTALILAFVAIVVAVILGLLSPIMLLILLIAPLMIKFARPYLQKQVKKETFISSVK
FT                   ILMFFQLVQVLLFFVSLIKF"
FT   gene            complement(188386..189072)
FT                   /gene="ybiH"
FT                   /locus_tag="L188392"
FT   CDS             complement(188386..189072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiH"
FT                   /locus_tag="L188392"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   similarity to PlnI and PlnP of Lactobacillus plantarum"
FT                   /db_xref="EnsemblGenomes-Gn:L188392"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04281"
FT                   /db_xref="GOA:Q9CJ23"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ23"
FT                   /protein_id="AAK04281.1"
FT                   /translation="MHLVNIRNQPLGNTIIQVLGVMAFGLFAAVVYMKTSNLIFAIVVH
FT                   AMNDFMAIMASSGSLSSQQTNPLTILYEWFIFGTLAFALFYTGWTQREKFIAAIQERSP
FT                   QLTARKLPTLAQSSTFRRIFALVSMIYGILILPTMLLFSKLSTSAGSRAEIANKALPIY
FT                   LLFLLGIALYIFLIVFFDFHLGNLCWLLLPYIGGPVFALIALVNGARPLTEKTNQSKTI
FT                   NNKTPN"
FT   gene            complement(189091..189270)
FT                   /gene="ybiI"
FT                   /locus_tag="L189097"
FT   CDS             complement(189091..189270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiI"
FT                   /locus_tag="L189097"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci"
FT                   /db_xref="EnsemblGenomes-Gn:L189097"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04282"
FT                   /db_xref="GOA:Q9CJ22"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ22"
FT                   /protein_id="AAK04282.1"
FT                   /translation="MFLAGLVLAIGKHAPASYIFLAIGATLLIGFAEELSFRGLIFGIL
FT                   VKNSKDKIIVPLFI"
FT   gene            complement(189320..189535)
FT                   /gene="ybiJ"
FT                   /locus_tag="L189326"
FT   CDS             complement(189320..189535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiJ"
FT                   /locus_tag="L189326"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci"
FT                   /db_xref="EnsemblGenomes-Gn:L189326"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04283"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ21"
FT                   /protein_id="AAK04283.1"
FT                   /translation="MKKYISVFSVFLVWLAYLLALNPILKALGLINWLRSLGHFASLTS
FT                   IIIQEIPIIIILLLLNHFFWHQKLLF"
FT   gene            complement(189816..190016)
FT                   /gene="ybiK"
FT                   /locus_tag="L189822"
FT   CDS             complement(189816..190016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiK"
FT                   /locus_tag="L189822"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci"
FT                   /db_xref="EnsemblGenomes-Gn:L189822"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04284"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ20"
FT                   /protein_id="AAK04284.1"
FT                   /translation="MNLASIVILAVILIITGFAIFKTVRSKGACEDCNVNTCPVKGAAA
FT                   LPVSAESHSTKKTDVKHDCCN"
FT   gene            complement(190003..192132)
FT                   /gene="feoB"
FT                   /locus_tag="L190009"
FT   CDS             complement(190003..192132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="L190009"
FT                   /product="ferrous ion transport protein B"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.05 TRANSPORT AND BINDING
FT                   proteinS. Cations. GTP-DRIVEN TRANSPORTER OF FERROUS ION"
FT                   /db_xref="EnsemblGenomes-Gn:L190009"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04285"
FT                   /db_xref="GOA:Q9CJ19"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ19"
FT                   /protein_id="AAK04285.1"
FT                   /translation="MKIIALLGNPNSGKTSIFNQLTGSNQQVGNWPGVTVEKKSGFYRK
FT                   DKSICIQDLPGLYSLSPYSLDEQVAREFLTKTPPDALINIVDSTNLERSLYLTLQLMEL
FT                   GIPMVLALNMSDLLAGQGKKIDIEKLSYSLGIPVVTTSAIKNKGLDEVVKVALKSHESQ
FT                   TLDYDHRLEGALSEIGKVTGFTNRFEQIKVFEGDKLLLAGETDKALSQQVHTDNSQAGL
FT                   SAKQLAEIEEIVSITEKLMADDRESIIVNERYDLIGHIVQLCVTQTETGKINLTDRIDQ
FT                   IITHKWLGLPIFVFIMWLVYFISIQTVGTAATDWLNDVFFGQWLPDLIANGMNALAVTP
FT                   WVQDLVLNGVVAGIGAILGFVPQIFVLFLLLGILEDSGYMARVAFVMDRIFRRFGLSGK
FT                   SFIPMLIASGCGVPGIMATRTIEQERDRKITIMVTTFMPCSAKLPIIALVSGAFFPHAS
FT                   WVAPSAYFLGMSMIILSGIILKKTRMFSGDTSAFIMELPAYHLPYAMTVLKYALDRAFS
FT                   FVKRAGTIIFAMNVLIWFTSNYNWTLAHVDASQSILADVGKVVAVIFAPLGFGEWRATV
FT                   ATITGLIAKETIVGTMGVLFAHNSSDSHQLWSAVQATYTPLSAYSLLVFNLLCAPCVAA
FT                   ISTIYKEMGDVRWTLRAVGFQTLVAYSMSFIIYQLGSLFSSQNFDVFSLLALIVLSVGL
FT                   YFIFRKGKGLTYELS"
FT   gene            complement(192234..192692)
FT                   /gene="feoA"
FT                   /locus_tag="L192240"
FT   CDS             complement(192234..192692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoA"
FT                   /locus_tag="L192240"
FT                   /product="ferrous ion transport protein A"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.05 TRANSPORT AND BINDING
FT                   proteinS. Cations. INVOLVED IN FERROUS ION UPTAKE"
FT                   /db_xref="EnsemblGenomes-Gn:L192240"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04286"
FT                   /db_xref="GOA:Q9CJ18"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ18"
FT                   /protein_id="AAK04286.1"
FT                   /translation="MKTLNNTHIGQIYYIHKIIGKNQAKLRDLGMISDKKITLISTDGE
FT                   NAIVKIDETRLALSSEFLEQIFVKEERSSEDIIGLAHLQVGQTGVVRMIDATSDIRRRL
FT                   MDMGITRGTSVHLQKLAPLGDPLELRLRGYSLSLRKTDAEKIKVVLER"
FT   gene            193029..193457
FT                   /gene="ybjA"
FT                   /locus_tag="L192996"
FT   CDS             193029..193457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybjA"
FT                   /locus_tag="L192996"
FT                   /product="reductase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.01 Adaptations and
FT                   atypical conditions. 65% identical to CSR14 protein of
FT                   Enterococcus faecalis encoded by eavy metals responsive
FT                   gene, also high similarity to peptide methionine sulfoxide
FT                   reductases"
FT                   /db_xref="EnsemblGenomes-Gn:L192996"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04287"
FT                   /db_xref="GOA:Q9CJ17"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ17"
FT                   /protein_id="AAK04287.1"
FT                   /translation="MEKEKLKKKLSLLAYRVTQENGTEAPFANEFDDFFEQGLYVDVVS
FT                   GEALFTSLDKYQSGCGWPAFTQPIDKGVVKEKRDKSLFMERTEVRSSNADSHLGHVFTD
FT                   GPLDKGDLRYCINSAALRFVPFDQLEAEGYGEYVKYFS"
FT   gene            complement(193587..195194)
FT                   /gene="ybjJ"
FT                   /locus_tag="L193593"
FT   CDS             complement(193587..195194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybjJ"
FT                   /locus_tag="L193593"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   43% identical to hypothetical protein YloV from B.subtilis.
FT                   Probably kinase related to hydroxyacetone kinase, evidenced
FT                   by COGnitor."
FT                   /db_xref="EnsemblGenomes-Gn:L193593"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04288"
FT                   /db_xref="GOA:Q9CJ16"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ16"
FT                   /protein_id="AAK04288.1"
FT                   /translation="MNEQAEYVNSLNVFPVPDGDTGTNMGMTITNGAKDVASKPADTVG
FT                   QVAQILSKGLLMGARGNSGVILSQLFRGFAQYVKDYEEIDGIHLAAALQNGVEVAYKAV
FT                   MKPVEGTILTVSRGAAELAKRKTDETDDAVKIMEAALEGAKKALAMTPDMLPVLKEVGV
FT                   VDSGGQGLVYIYEGFLMALNGEFVPETPVAELGAMDRMVNVEHESVANASTADIKFGYC
FT                   TEIMVELGKGPTSRESYDHDNFQAYLAGIGNSLLVVDDEEVVKVHVHTEDPGLVMQEGL
FT                   KYGRLVKVKVDNMRLQNEGVAEKEAKSTNVSTSTSKKDWGLIAISAGEGLADIFREMGV
FT                   NHVVSGGQTMNPSTEDILTAIEAVNAEKVIILPNNKNIFMAAKSAAEVAEIPVEVIESA
FT                   TVPQGFTALLSFDPTRSIEENKAAMTDALLDVKSGSVTTAIRDTNVDGIEIHKKDTLGM
FT                   LNNKIVVSTRKMNDAIFAVFDQMIDEDSEIVAIYIGEEGKKANADKIAKELEKKYPEIE
FT                   VEIHEGKQPVYPYLFSVE"
FT   gene            complement(195251..195619)
FT                   /gene="ybjK"
FT                   /locus_tag="L195257"
FT   CDS             complement(195251..195619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybjK"
FT                   /locus_tag="L195257"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   41% identical to putative Asp23 protein of B.subtilis
FT                   encoded by yloU gene. Conserved hypothetical akaline shock
FT                   protein."
FT                   /db_xref="EnsemblGenomes-Gn:L195257"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04289"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ15"
FT                   /protein_id="AAK04289.1"
FT                   /translation="MKMSVTINNQHGNVDIATEVIATVVGASTTEIFGVVGMTSKSAVK
FT                   DNVRSVLRQENYSKGVVVTTADNETSIDVYVVISYGVKISEVAKNIQERVRFNLENQLG
FT                   ITASSVNVYVQNVKVVED"
FT   gene            complement(195892..196086)
FT                   /gene="rpmB"
FT                   /locus_tag="L0422"
FT   CDS             complement(195892..196086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="L0422"
FT                   /product="50S ribosomal protein L28"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.05 Ribosomal proteins:
FT                   synthesis and modification. BELONGS TO THE L28P FAMILY OF
FT                   RIBOSOMAL proteinS."
FT                   /db_xref="EnsemblGenomes-Gn:L0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04290"
FT                   /db_xref="GOA:Q9CJ14"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CJ14"
FT                   /protein_id="AAK04290.1"
FT                   /translation="MSKECYFTGRKTVSSNNRSHAMNQTKRVVKPNLQKVTILENGELK
FT                   TVWASAKALKKLPAGVERV"
FT   gene            196222..196881
FT                   /gene="ybjB"
FT                   /locus_tag="L196216"
FT   CDS             196222..196881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybjB"
FT                   /locus_tag="L196216"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 39%
FT                   identical to a protein from Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L196216"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04291"
FT                   /db_xref="InterPro:IPR009214"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ13"
FT                   /protein_id="AAK04291.1"
FT                   /translation="MENLIEELTAKNKEYIHSVTKQLILVGKSDEEVKEILNDILPQII
FT                   EGQKSGIIARKLLGAPTEFVTQYQPKVADRPVSEKNENPVLMWLDSSLLFLGFISLLNG
FT                   VTALITSKAPVYGLITTILSAAVAGLVMYMMYRYFYRPKADNSRRTWNWKGFAATTLSV
FT                   LLWIAVTIFSGLLPTSVNLQLPAIALVIVGLVAFGVRWLLKRQFNIQSALVAQPRR"
FT   gene            197074..197943
FT                   /gene="rmlA"
FT                   /locus_tag="L197041"
FT   CDS             197074..197943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlA"
FT                   /locus_tag="L197041"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="EVIDENCE BY HOMOLOGY BIO08.06 Sugar-nucleotide
FT                   biosynthesis and interconversions. DTDP-L-RHAMNOSE
FT                   BIOSYNTHESIS IN LIPOPOLYSACCHARIDE BIOSYNTHESIS PATHWAY"
FT                   /db_xref="EnsemblGenomes-Gn:L197041"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04292"
FT                   /db_xref="GOA:Q9CJ12"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ12"
FT                   /protein_id="AAK04292.1"
FT                   /translation="MKGIILAGGSGTRLYPLTRAASKQLMPIYDKPMIYYPLSTLMLAG
FT                   IKDILIISTPTDTPRFKELLQDGSEFGINLQYAVQPSPDGLAQAFIIGEEFIGDDSVAL
FT                   ILGDNIYHGPGMSKMLQNAAAKEKGATVFGYHVPDPERFGVVEFDENMNAVSIEEKPEE
FT                   PKSNYAVTGLYFYDNDVIEIAKNIEPSPRGELEITDVNKAYLERGDLSVELMGRGFAWL
FT                   DTGTHESLLEAAQYIETVQRMQNMQVANLEEIAYRMGYITADDVLKLAQPLKKNEYGQY
FT                   LLRLIGKD"
FT   gene            197991..198281
FT                   /gene="ybjD"
FT                   /locus_tag="L197961"
FT   CDS             197991..198281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybjD"
FT                   /locus_tag="L197961"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L197961"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04293"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ11"
FT                   /protein_id="AAK04293.1"
FT                   /translation="MLKNIWEWFLWFTGVTDAGWSAWWGGFFSCLPLFGVFAVVWRRLK
FT                   CHAPGCHQIGLHRTADGLYVLCRKHHPDVPNNLTLKHIQKSHVNAKAKKDK"
FT   gene            198350..198943
FT                   /gene="cpsM"
FT                   /locus_tag="L198323"
FT   CDS             198350..198943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpsM"
FT                   /locus_tag="L198323"
FT                   /product="dTDP-4-keto-6-deoxyglucose-3,5-epimerase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO08.06 Sugar-nucleotide
FT                   biosynthesis and interconversions. DTDP-L-RHAMNOSE
FT                   BIOSYNTHESIS IN LIPOPOLYSACCHARIDE BIOSYNTHESIS PATHWAY"
FT                   /db_xref="EnsemblGenomes-Gn:L198323"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04294"
FT                   /db_xref="GOA:Q9CJ10"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ10"
FT                   /protein_id="AAK04294.1"
FT                   /translation="MTDNFFEKTLAAREISQIPGMLEFDIPVHGDNRGWFKENFQKEKM
FT                   MPLGFPESFFAEEKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGSVLGAWVDLREGEN
FT                   FGHVYQTVIDASKGIFVPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPT
FT                   LGIKWEDVENAEVSEADKNHPLLKDVKALKADEL"
FT   gene            198943..199197
FT                   /gene="ybjF"
FT                   /locus_tag="L198940"
FT   CDS             198943..199197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybjF"
FT                   /locus_tag="L198940"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L198940"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04295"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ09"
FT                   /protein_id="AAK04295.1"
FT                   /translation="MFALHLRTKKRLEFWQVEKNTDRPCWANQAFTDGGFSWNDKSLSV
FT                   KNVGGLLKMTVPIGDYLVFNGKYLKAVPKAKFVREYRVD"
FT   gene            199239..200288
FT                   /gene="rmlB"
FT                   /locus_tag="L199221"
FT   CDS             199239..200288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlB"
FT                   /locus_tag="L199221"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO08.06 Sugar-nucleotide
FT                   biosynthesis and interconversions. DTDP-L-RHAMNOSE
FT                   BIOSYNTHESIS IN LIPOPOLYSACCHARIDE BIOSYNTHESIS PATHWAY"
FT                   /db_xref="EnsemblGenomes-Gn:L199221"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04296"
FT                   /db_xref="GOA:Q9CJ08"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ08"
FT                   /protein_id="AAK04296.1"
FT                   /translation="MTEFKNIVVTGGAGFIGSNFVHYVYNNHPDVHITVLDKLTYAGNV
FT                   NNINMLFDSGRVELVVGDIADPEIVDQVASKADAIVHYAAESHNDNSLKSQDEFIQTNF
FT                   IGTYTLIQAARKYDLRFHHVSTDEVYGDLPYREDLPGHGEGEGEKFTDKTPYNPSSPYS
FT                   STKAASDLIVRAWVRSFGLKATISNCSNNYGPFQHIEKFIPRQITNILSGIKPKLYGDG
FT                   KNVRDWIHTEDHSSGVWTILTKGRMGETYLIGADGEKNNKEVLEDILTRMGKDKDDYDR
FT                   VTDRAGHDLRYAIDNSKLRTELGWAPKHTDFESGLQATIDWYRENENWWKAEKEAVEAK
FT                   YAETQKVLD"
FT   gene            200377..201276
FT                   /gene="rmlC"
FT                   /locus_tag="L320"
FT   CDS             200377..201276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlC"
FT                   /locus_tag="L320"
FT                   /product="dTDP-L-rhamnose synthase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO08.06 Sugar-nucleotide
FT                   biosynthesis and interconversions. DTDP-L-RHAMNOSE
FT                   BIOSYNTHESIS IN LIPOPOLYSACCHARIDE BIOSYNTHESIS PATHWAY"
FT                   /db_xref="EnsemblGenomes-Gn:L320"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04297"
FT                   /db_xref="GOA:Q9CJ07"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ07"
FT                   /protein_id="AAK04297.1"
FT                   /translation="MILITGGNGQLGTELRHLLDERGMAYTATDAKELDITDGVAVDKF
FT                   FDENKPELVYHCAAYTAVDKAEDEGRELDEKINVDGTKNVAEAAARVGATLVYISTDYV
FT                   FGGTLPIGQEWPVDAPKAPESEYGRTKHLGEEAVVASGVKHYIIRTAWVFGSYGPNFVF
FT                   TMQNLATRFPELTVVNDQHGRPTWTRTLAEFMVYLVSEKADFGFYHLTNDAAPGEDVTW
FT                   FDFAKEILKDTDVLVKPVDSSKFPAKAKRPFNSTMSLEKAKATGFVIPTWQEALASMLE
FT                   KGDLRENKDGVKGEINKK"
FT   gene            201410..202618
FT                   /gene="rgpA"
FT                   /locus_tag="L1389"
FT   CDS             201410..202618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpA"
FT                   /locus_tag="L1389"
FT                   /product="rhamnosyltransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.03 Surface
FT                   polysaccharides, lipopolysaccharides and antigens.
FT                   formation of rhamnose-glucose polysaccharide"
FT                   /db_xref="EnsemblGenomes-Gn:L1389"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04298"
FT                   /db_xref="GOA:Q9CJ06"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR015393"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ06"
FT                   /protein_id="AAK04298.1"
FT                   /translation="MKKHVFIIGSRGLPAKYGGFETFVEELVKHQNNKNIKYHVACQSE
FT                   NSDMALPGEHFEYLGADCFVIKLPKIGSARVIAYDILAINVALKYCKKEEIKAPVFYIL
FT                   GNTAGGFIGHYANKIHKLGGKLFVNPDGLEWKRTKWAAPIRSYLKFAEKKMVRYADLII
FT                   SDNAGIKEYLTSEYGQVESEVIAYGTEKFKSDLTESETLVKYKVNDYYLIVGRFVPENN
FT                   YETLIRAFMKSSTKRDLVIITNHEGNAYFKELREKTQFDKDARIKFVGTVYNQNELRYI
FT                   REHAFAYLHGHEVGGTNPGLLEALWSTAVNVVLGVNFNRTTAGDSVIYFDKENLLTTLS
FT                   EVENLTPDEGQRLHEKAQAIIEEKYTWEHICAQYEELFDPKFTDESEPLRKMENLARGG
FT                   DES"
FT   gene            202608..203567
FT                   /gene="rgpB"
FT                   /locus_tag="L2599"
FT   CDS             202608..203567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpB"
FT                   /locus_tag="L2599"
FT                   /product="rhamnosyltransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.03 Surface
FT                   polysaccharides, lipopolysaccharides and antigens. side
FT                   chain formation of rhamnose-glucose polysaccharide"
FT                   /db_xref="EnsemblGenomes-Gn:L2599"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04299"
FT                   /db_xref="GOA:Q9CJ05"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ05"
FT                   /protein_id="AAK04299.1"
FT                   /translation="MRVNILMSTYNGEKFVADQIESIQKQTYTDWNLIIRDDGSSDRTC
FT                   EIVDDFVSKDNRIKLIRAENVGVIKSFHELVTDSNNADFYFFADQDDYWLPEKLSVMLE
FT                   ETKKHDNSKPVMYYTDLKVTDRNLNVTSESMIRGQSDHANTKLVQELTENTVTGGASMI
FT                   NHELAQLWQSTNDIIMHDWYLAIVAAALGELVYIDQPTHLYRQHDSNVLGARTLSKRIK
FT                   KWIHPNLWFEKYWWLITASQKQAQKLLTENLSLMSEDDKALVSDYVNILKQPKAERRQI
FT                   LDRYNLRKNKNYHTSIFRTLIITKFAYKGKKTNEFLQP"
FT   gene            203548..204357
FT                   /gene="rgpC"
FT                   /locus_tag="L3425"
FT   CDS             203548..204357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpC"
FT                   /locus_tag="L3425"
FT                   /product="polysaccharide ABC transporter permease protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.04 TRANSPORT AND BINDING
FT                   proteinS. Carbohydrates, organic alcohols and acids.
FT                   probably involved in side chain formation of
FT                   rhamnose-glucose polysaccharide"
FT                   /db_xref="EnsemblGenomes-Gn:L3425"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04300"
FT                   /db_xref="GOA:Q9CJ04"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ04"
FT                   /protein_id="AAK04300.1"
FT                   /translation="MNFFSRRNQILLKELVKTDFKLRYQGSLIGYLWSILKPVMLFVIM
FT                   YLVFVRFLRFGSAVPHFAVALLLALTLWNFFAETTNMGMLSVVSRGDLLRKISFSKPII
FT                   IFSVVANALINLLISLVVVVIFSFLNGIHMSWNVIFVLPLLVELVLFATGIAFILATIF
FT                   VKFRDLGPIWEVGMQAGLYGTPIIYPIIQVSQTHPTIAKILMLNPMAQIVQDMRYILTF
FT                   SNNTNPTLWQMTDKPYLIIIPYLIPFIIFGIGLWIFTKNSSKFAEII"
FT   gene            204357..205553
FT                   /gene="rgpD"
FT                   /locus_tag="L4342"
FT   CDS             204357..205553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpD"
FT                   /locus_tag="L4342"
FT                   /product="polysaccharide ABC transporter ATP-binding
FT                   protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.04 TRANSPORT AND BINDING
FT                   proteinS. Carbohydrates, organic alcohols and acids.
FT                   probably involved in side chain formation of
FT                   rhamnose-glucose polysaccharide. There are 60 paralogs in
FT                   L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L4342"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04301"
FT                   /db_xref="GOA:Q9CJ03"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ03"
FT                   /protein_id="AAK04301.1"
FT                   /translation="MNDNIAVKIDHVSKFFHLPTEATNSLRTTLVNRLRGIKGYKEQHV
FT                   LKDIDFTVEKGDFFGIVGRNGSGKSTLLKIISQIYTPEKGNVIVNGKLVSFIELGVGFN
FT                   PELTGKENVYLNGAMLGFSREEISDMYDEIVDFAELEEFMNQKLKNYSSGMQVRLAFSV
FT                   AIKARGDVLVLDEVLAVGDESFQRKCNDYFLERKKSGKTTILVTHDMGAAKKYCNKAIL
FT                   IENGLIKVSGDVNDVANQYSLDNLQTEVTARSDLEIDVKEEWIENLEVNFINQQKITPN
FT                   DEVKFEVSYDVKKDTETYIAFSLTDVDRNIWIYNDNSLDYLTKGKGHNRAIYTCKLDQV
FT                   NNLKLKLQVSIRNKRDEMIAFADEKVILINRNDISDDDKSAQDSATGLIQRNGSWEFE"
FT   gene            205546..205866
FT                   /gene="ycaF"
FT                   /locus_tag="L5525"
FT   CDS             205546..205866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycaF"
FT                   /locus_tag="L5525"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L5525"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04302"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ02"
FT                   /protein_id="AAK04302.1"
FT                   /translation="MNKIQNRANKQSKYSRPENIFLFLILLIGFFTISITPPMTMGDEG
FT                   YHLSQSYNLFSTKAPESMSNLQVRAKEFKAIGIGTQSKVSPTFYKKLITEKINLQDDGV
FT                   KF"
FT   gene            205908..206900
FT                   /gene="ycaG"
FT                   /locus_tag="L5881"
FT   CDS             205908..206900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycaG"
FT                   /locus_tag="L5881"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 21%
FT                   identical to a protein from Clostridium acetobutylicum.
FT                   Homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L5881"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04303"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ01"
FT                   /protein_id="AAK04303.1"
FT                   /translation="MHLPGAIGVLIARLIYPSLGIMDYGGRIANLICFSLIFYFLIKKN
FT                   EHAKWSMILIFMVGGIQKIFSPSYDVVSFLVFSAFVVNLSDLVRIEKIRDVGLKKAIYT
FT                   IFLICSFYFIKSNYIFAFFALLGLPMLYRPVIDKVRKLSSLGKTFLSMLIIGIISVAYL
FT                   FLNKKMSIFTIIKKFIENYMNVELMGNNAKQLWQVVPTTLPIFVNILFILILFIVMMGE
FT                   LKATWATGTVIIFSLTYLVNWFGIFAGFFIDSASLASTNLQGRYLSPFLFFFVPFVQNL
FT                   GKKFNFTMSEKSVRRLSVWTIIIISVLYLVVTFYRSYVLKITPTWTNNA"
FT   gene            206916..207890
FT                   /gene="rgpE"
FT                   /locus_tag="L6907"
FT   CDS             206916..207890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpE"
FT                   /locus_tag="L6907"
FT                   /product="glycosyltransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.03 Surface
FT                   polysaccharides, lipopolysaccharides and antigens. probably
FT                   involved in side chain formation of rhamnose-glucose
FT                   polysaccharide"
FT                   /db_xref="EnsemblGenomes-Gn:L6907"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04304"
FT                   /db_xref="GOA:Q9CJ00"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CJ00"
FT                   /protein_id="AAK04304.1"
FT                   /translation="MLDKISVVVTCHNHEAYIEQCLRSVFAQTYRNIELLVFNDGSTDQ
FT                   SGQVIEKILKESPFSETFYFSEENRGIVSIRNDALTKIKGDFLLFVDSDNYLDDQYIEI
FT                   LHQSLQEQNVDIAYCQLWDFVNSRQVLRDDLEFSLDKELEGNLIDMSSLVRVSKILNVR
FT                   FDEQLNHKALEDYDFWLSLILINHAKPIFVKGIKLNYRVLNTSRTERGNWDKYYDSYFY
FT                   LLEKHQTLLPKEVLKASQANVKIWLKSYLESDQQLTENILKIKEKDKHISNLQREIDLL
FT                   KSLLAAKEDEIDKTKAELEEKKQEIDIIKNSKSYKFLQKLKGN"
FT   gene            207900..209669
FT                   /gene="rgpF"
FT                   /locus_tag="L7894"
FT   CDS             207900..209669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpF"
FT                   /locus_tag="L7894"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:L7894"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04305"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIZ9"
FT                   /protein_id="AAK04305.1"
FT                   /translation="MKRLLLYVHFNKNNKVSDHVIYQLKHMRSLFEKVIFISNSELSEQ
FT                   YQQQLVDFVDEFIQRENKGFDFAAWRDGMEQVGFDQLKMYDSVTLMNDTCFGPLYEMAP
FT                   IYEKYEIQNIDFWGITNHRAYHESKNHYFDEHIQSYYKVFNNNVINSQIFEDFWKNIVD
FT                   YTNVQDVIDHYEIQSTKIFMDAGFKYESVLDTRALDAKNLLHPDFSYYAPDVILKEKVP
FT                   FIKVKAFQSIQSNGIAYYMLDYIDRNTDYPKSLVVDHLSTVGYPDLNFLLPSKMITPLS
FT                   KTVLHQTVAVHLHVYYPELLEEFLDAFKNFSFDYDLYLTTNTDEKEEIIKEMLKCKDAK
FT                   AKLVRTPNHGRDIVPFLALKEELKKYDIVGHFHTKRSLEAAFFAGESWRTELISMLIEP
FT                   ADNIMAHFEQKQKLGIVIADIPSFFRFNKIVNADNENKQIAPIMNDIWKRMKMNKKVNF
FT                   HDFNTFTMSYGTFFWAKIEVLEPLFNLEIMDREIPNEPLPQNTILHAIERVLIYLAWDK
FT                   EMDFNISPNKLNLTPFIDSRTLNQRFYISPENSDDIRLRYVLALSIKKLKRLIVYRFYK
FT                   LFKLDTTKLFLKE"
FT   gene            209672..211216
FT                   /gene="ycbA"
FT                   /locus_tag="L9639"
FT   CDS             209672..211216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbA"
FT                   /locus_tag="L9639"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL"
FT                   /db_xref="EnsemblGenomes-Gn:L9639"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04306"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIZ8"
FT                   /protein_id="AAK04306.1"
FT                   /translation="MKRNQKLFILVISVILLFITQLAVSIIPNQMPNTSKLFISLVVIV
FT                   GVVFCLKLGNSEKLVKNTFFIILFLGIGISFIKPVQFGVDEETHLRWTIRLADGQLFTR
FT                   EQEKQPDWDTVEKYDTLRNPAAEHAKNGFPNKFFSDEHEASTYSGKKIGINNISLIPNA
FT                   LGWKIGMVTTSRVAVAYYLGRIFNVIAYALMVCLAMKIGKKYREVLLLFAAFPTTLWIV
FT                   SSFQYDWLFYSLSLMILAFITRFISEKESIRKKDLIFYLVTTTLMMFPKFPFILMGVVP
FT                   LFISKRYYINVKDKIWYGISLIGSVLIAVGWYLQSTIVKKISNGTSPEVSTNITNKAGI
FT                   SYFIKHPLPIVRTFIRDVLGSFSGFSGSNTSNPPAPLQYVQHTSSFITGILPVIFTFLF
FT                   ILVTIRIKIKLDKTTKIFIYIGYLVISLAIIYALSGDNRVGYNIGELSISGVQFRYFYP
FT                   ILLSLPLLWRDWMKKIIPINEVKELEDESRITDFLQISMIYINVLILSLGMYTLVS"
FT   gene            211306..212031
FT                   /gene="ycbB"
FT                   /locus_tag="L11285"
FT   CDS             211306..212031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbB"
FT                   /locus_tag="L11285"
FT                   /product="glycosyltransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.03 Surface
FT                   polysaccharides, lipopolysaccharides and antigens"
FT                   /db_xref="EnsemblGenomes-Gn:L11285"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04307"
FT                   /db_xref="GOA:Q9CIZ7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIZ7"
FT                   /protein_id="AAK04307.1"
FT                   /translation="MNKQRILLIIPAYNESEGIIKVVEVVKQYISKIELEIDYVVINDG
FT                   STDNEEEVLREYNITHIELIQNLGIGGAVQTGYMYALENSYDIAVQFDGDGQHDIHSLP
FT                   NLIEPILNDEADFTVGSRFLDESNSEFKSSKSRQLGIKILSSLIYMSSKIKIKDVTSGY
FT                   RAGNRKAIEQFVKRYPRQYPEPESYMHLFSKNIRVKEVGVRMFERTTGVSSINLIKGVN
FT                   YMVSVSLAILASSILGKEK"
FT   gene            212028..212399
FT                   /gene="ycbC"
FT                   /locus_tag="L11986"
FT   CDS             212028..212399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbC"
FT                   /locus_tag="L11986"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L11986"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04308"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIZ6"
FT                   /protein_id="AAK04308.1"
FT                   /translation="MIMPIQLRLLAIILAVLFFVYMVRLVRKDKAEIRHMLKWLVLALI
FT                   ILIGAIFPEMGSRIAHFFGIQTLTSLALFILVGILLIISLKYQMSLISAEKQIKNLIQE
FT                   VSLANKKIKDLERKNDNKE"
FT   gene            212383..213324
FT                   /gene="ycbD"
FT                   /locus_tag="L12335"
FT   CDS             212383..213324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbD"
FT                   /locus_tag="L12335"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.03 Surface
FT                   polysaccharides, lipopolysaccharides and antigens"
FT                   /db_xref="EnsemblGenomes-Gn:L12335"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04309"
FT                   /db_xref="GOA:Q9CIZ5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIZ5"
FT                   /protein_id="AAK04309.1"
FT                   /translation="MITKSNILITGGAGFIGSSLANELLPQNKITVIDNLSMGDFNNLH
FT                   ETSNLTKILGDVTDKNLLVKVLEENDFDYIFHLAAIASVADSVARPYETHQVNFDSTMT
FT                   LLEILRQNKKSLKRFVFSSSAAVYGDEPTLPKQEEGTIRPLTPYAIDKFASEKMTMIYN
FT                   NLYDVPTSATRFFNVYGPNQNPNSPYSGFISILVDRLRENTELTIFGDGEQSRDFVYIE
FT                   DVIQALLLIATSEQSFGEVYNVGTGVKNSINDLTKFAQKFTNKELSIKFDDVRQGDIKD
FT                   SVSDISKLKDIGYSPKFDLSNGMKKYLNYEFK"
FT   gene            213324..214751
FT                   /gene="ycbK"
FT                   /locus_tag="L13324"
FT   CDS             213324..214751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbK"
FT                   /locus_tag="L13324"
FT                   /product="polysaccharide biosynthesis export protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.03 Surface
FT                   polysaccharides, lipopolysaccharides and antigens"
FT                   /db_xref="EnsemblGenomes-Gn:L13324"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04310"
FT                   /db_xref="GOA:Q9CIZ4"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIZ4"
FT                   /protein_id="AAK04310.1"
FT                   /translation="MKNEFKTGIFFTAIAQYSTVIVQLIINMILSRLLTPGEIGMVTIV
FT                   QVIIFFFQLLAGSAIGPAIIQNKNLNEKDYGIIFNYSVIFGIFLVLAFGFGGGIILSTI
FT                   YSNPIYIPLCWAMTPIIMMSSMVQVPNGILGKEKRFKEISIRLLLSGILGAIFGITAAF
FT                   LHAGVYAMVLVYVVTDLTSFLLTFKIVKIDYTRSLNFKPVREILPFVKHQTGFSVINYF
FT                   YRNLDNLLVGKFLGTTLLGNYSKGYQLLSFPITIFLNVINPVMQPILAEHEKNVVLIRD
FT                   TYLKVCRLLAIVAIPVSIFFSLNAGPIIYLLFGKQWSMAILPLSILSLSICPQMLSQSM
FT                   SAIWQSRNLTKIQSVSGFISLGIISLCIFIGILGGNLTSVSIAVSGSYFLNFIVSGSLL
FT                   MRRALDSNFFQLFKVIIKPLFLGIILSVIVILTNPYISFSNLFITLLLRGIVWLIIVAL
FT                   FLVVTGEFKKIKEMVKK"
FT   gene            214748..215887
FT                   /gene="ycbF"
FT                   /locus_tag="L14736"
FT   CDS             214748..215887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbF"
FT                   /locus_tag="L14736"
FT                   /product="LPS biosynthesis protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.03 Surface
FT                   polysaccharides, lipopolysaccharides and antigens"
FT                   /db_xref="EnsemblGenomes-Gn:L14736"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04311"
FT                   /db_xref="GOA:Q9CIZ3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIZ3"
FT                   /protein_id="AAK04311.1"
FT                   /translation="MKEKTVAIFNGYYIPHLGGVERYTYNIAKKLTEKGYRVIIITTQH
FT                   DENLTNEEIQEGIKIYRLPIKNLWKNRYPFLKKNRIYHSLIEKIEAESIDYYVANTRFH
FT                   LPAMLGVKMAKAKGKEAIVIEHGSSYLTLNNPVLDFMLRKIEQLLIGRVKKDTSLFYGV
FT                   SNEASEWLKTFDIKAKGVLPNAVAVDEYFNQKIEKDEKKLTISYAGRLIPQMKGVEILL
FT                   STFSKLSKERKNLELIIAGDGPLLNEVKRKYSQKNIKFLGYVPYEKVLEIDAKSDVFVL
FT                   MSRSEGFATAMLEAAMLENVIITTPTVGGARDIMPDETYGYIIENNETKLFETLTKVLD
FT                   NKEHMRLMQKKISKNVLENFTWEQSAKQFIKVFNELDEK"
FT   gene            215887..216723
FT                   /gene="ycbG"
FT                   /locus_tag="L15884"
FT   CDS             215887..216723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbG"
FT                   /locus_tag="L15884"
FT                   /product="LPS biosynthesis protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.03 Surface
FT                   polysaccharides, lipopolysaccharides and antigens. 30%
FT                   identical to Cps19aG protein in LPS gene claster of
FT                   S.pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:L15884"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04312"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIZ2"
FT                   /protein_id="AAK04312.1"
FT                   /translation="MKELTNEELRGIQLEQLKYIDRICRENGIEYTLAGGSLIGAIRHG
FT                   GYIPWDDDIDIELTRPHYDHLISVLMDQLPNEKYALLHYKVRETYLPFAKLYDTRTSFT
FT                   SKIDNLNRGTGVFLDIFPMDILPDNEEERQVFKKEFLKKAIQLTASNPHGLDFASSSKK
FT                   IYFWGKLVLWMPQHIRFYGKYRILAEKLDEFMQKYRNSDNQLISYLYTGYKKAIFPKEI
FT                   WEEYEDVKFEGLTARKLKNHEEYLTRQYGDYMKLPPENERVNHDYYKWYWKEKNEI"
FT   gene            216713..217714
FT                   /gene="ycbH"
FT                   /locus_tag="L16653"
FT   CDS             216713..217714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbH"
FT                   /locus_tag="L16653"
FT                   /product="sugar transferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.03 Surface
FT                   polysaccharides, lipopolysaccharides and antigens. similar
FT                   to many glucosyl or galactosyl transferases involved in
FT                   polysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:L16653"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04313"
FT                   /db_xref="GOA:Q9CIZ1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIZ1"
FT                   /protein_id="AAK04313.1"
FT                   /translation="MKFSVIIPVYNASKFIDYCVESVLSQSYSDIEVILINDGSTDKSG
FT                   EICEGFARKDNRVKVYHQENQGAAVARNHGIRKATGDYLLFPDSDDYYASSLGFEEINN
FT                   QLEETKADVLIHDSFVERGNGTPDDLHSSLLREEVLKLEKIEFIEYLIKKDKLTRSAWT
FT                   KVISRSFLSKNNILFPTVRQTEDTGFTAELVRLGNSFDWYEKQFYAYVKHDESVTAKRL
FT                   PESIIHDSFSVIKTAVINGELIKDSRYREAYYSYLAYPYVVLIGQTKEAINRGVIKENT
FT                   ILNDLKQYSFLMKYNLNPKLKVIKHLYKLFGYLMIVFLLSVMMELTYRKQGV"
FT   gene            217716..218573
FT                   /gene="ycbI"
FT                   /locus_tag="L17695"
FT   CDS             217716..218573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbI"
FT                   /locus_tag="L17695"
FT                   /product="sugar transferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.03 Surface
FT                   polysaccharides, lipopolysaccharides and antigens. 25%
FT                   identical to putative glycosyl transferases of different
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:L17695"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04314"
FT                   /db_xref="GOA:Q9CIZ0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIZ0"
FT                   /protein_id="AAK04314.1"
FT                   /translation="MTTTLTILTPTYNRAYILPKLYASLVEQTNKHFDWMVVDDGSTDN
FT                   TEQLISEFIADGKINIVYIKQKNGGKHRALNTGAQSINSDYIFIVDSDDYLTNDAIDII
FT                   LENSHYLKEKNLMGMTLLRGYAPDKVIGEKYPEDFMIKNFNQVRYNMGIKGDKAEVVST
FT                   KIFRETPFPEIPGERFMSEGVAWKQLAHKGDSLFINKIVYITEYLEDGLTHSGRLLLIK
FT                   NPLGAMLNAKLAMTKEFSFKIREKNSLLYIAYGFFAKKKVREIITESGQRKLVRVNLLF
FT                   GWMI"
FT   gene            218600..219826
FT                   /gene="ycbJ"
FT                   /locus_tag="L18600"
FT   CDS             218600..219826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbJ"
FT                   /locus_tag="L18600"
FT                   /product="LPS biosynthesis protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.03 Surface
FT                   polysaccharides, lipopolysaccharides and antigens . 30%
FT                   identical to several glycerol diester phosphodiesterases"
FT                   /db_xref="EnsemblGenomes-Gn:L18600"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04315"
FT                   /db_xref="GOA:Q9CIY9"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIY9"
FT                   /protein_id="AAK04315.1"
FT                   /translation="MIETTLVKMKKIDLKIIFVFVLVIFGMSYELRGFADDTSSPTPVY
FT                   RVYNPRNLEHLYTSSLNEKNTLVRIGWGRFEGVTFYGKNNGDTPIYRLYNFSIRQHLYT
FT                   ADLNEARVLSRSGWKNEGIVFRATVAGSVPVYRLYSSKIKQHLFTTDANEKRVLSAGNF
FT                   WRYEGIAWYGVSATNSDSDDILLVNHRGNHTEFPENSVESVLSAKYSAVETDIQTTSDG
FT                   QWVNMHDATVDRTTNGHGAVADLTLAQIQNLYLKNNSGQITQYKVPTLDQYLAACKQKG
FT                   VIPLIEIKQATATPEQYSDIAMKFEQYGFSSTGYIISGYEEPLSKIESLIPTVNVMYIV
FT                   EGYSTENVTFAVSLGIKSGLDMGYTNINQQVVEAVHASGIKVGAWTVGDINTLKYLQSI
FT                   GVDVLTTNY"
FT   gene            219837..220265
FT                   /gene="tagD1"
FT                   /locus_tag="L19816"
FT   CDS             219837..220265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagD1"
FT                   /locus_tag="L19816"
FT                   /product="glycerol-3-phosphate cytidiltransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.03 Surface
FT                   polysaccharides, lipopolysaccharides and antigens"
FT                   /db_xref="EnsemblGenomes-Gn:L19816"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04316"
FT                   /db_xref="GOA:Q9CIY8"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006409"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIY8"
FT                   /protein_id="AAK04316.1"
FT                   /translation="MKDNEKQRIVLVAGTFDILHESHINMLRNARNLGDKLIVMLSTDE
FT                   FNATKGKKSYQEYDTRKYVLESVRYVDLVIPEQSWDDKALYIDMFDVDIFAMGDDWRGK
FT                   FDFLKDEFPHLKIMYFPRGKISSSKVKEELGKLYQKRK"
FT   gene            complement(220391..220903)
FT                   /gene="yccB"
FT                   /locus_tag="L20397"
FT   CDS             complement(220391..220903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccB"
FT                   /locus_tag="L20397"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L20397"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04317"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIY7"
FT                   /protein_id="AAK04317.1"
FT                   /translation="MKLKKSHIIPLILFSGLLIAKPVFAEEVISSDNTPMGHYIEQEQS
FT                   QEASTESTSDSSTTPNIRARSFAAVPASNAPSDLKSDDNTLPRKGLKIHIYTTDTNEKN
FT                   VLSKSGWNYEGIVFYASTSSIENIPVYRLYNSGIKQHLFTTDSNEKNVLSTLGWSYEGI
FT                   AWYGLKS"
FT   gene            221285..222766
FT                   /gene="guaB"
FT                   /locus_tag="L21264"
FT   CDS             221285..222766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="L21264"
FT                   /product="IMP dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="EVIDENCE BY HOMOLOGY BIO08.03 Purine ribonucleotide
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:L21264"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04318"
FT                   /db_xref="GOA:Q9CIY6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIY6"
FT                   /protein_id="AAK04318.1"
FT                   /translation="MSNWETKFLKKGFTFDDVLLIPAESHVLPNEVSMKTKLAKNLTLN
FT                   IPIISAAMDTVTDSKMAISMARQGGLGVVHKNMSVEEQAEEIHKVKRSESGVITDPFFL
FT                   TPNHKIEEAENLMATYRISGVPIVDTLENRKLVGIITNRDLRFITDYNQQIKNMMTSEN
FT                   LITAPVGTTLDTAARILQEHKIEKLPLVDEAGKLAGLITIKDIERVIEFPNAAKDEQGR
FT                   LLVAGAVGVSSDTFERAEALFAAGADAIVIDTAHGHSAGVLRKIREIRNHFPDRTLIAG
FT                   NIATGEGARALFEAGVDVVKVGIGPGSICTTRVVAGVGVPQITAIYDAANVAREFGKTI
FT                   IADGGIKYSGDIVKALAAGGDAVMLGSMLAGTDESPGEFEIFQGRKFKTYRGMGSLAAM
FT                   KKGSKDRYFQGAVNEANKLVPEGIEGRVAYKGTATDIVFQMLGGLKAGMGYTGAADITA
FT                   LHDSAQFIEMSGAGLKESHPHDVQITKEAPNYSVQ"
FT   gene            222972..224117
FT                   /gene="yqeL"
FT                   /locus_tag="L22900"
FT   CDS             222972..224117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqeL"
FT                   /locus_tag="L22900"
FT                   /product="GTP-binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.10 GTP-binding proteins.
FT                   putative counterpart of YqeH of B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L22900"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04319"
FT                   /db_xref="GOA:Q9CIY5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIY5"
FT                   /protein_id="AAK04319.1"
FT                   /translation="MYCIGCGAKIQTEAKNALGFLPAGALKKKIAERDQMEAVQAGDEG
FT                   SEASIKTEDLYCQRCFRLRHYNEIAPTSLTDADFLRLLKEIGQHDALIVNVVDIFDFNG
FT                   SLIPNLHKLTGGNDLLMVANKRDVLPKSLKVGKLTAWLREQAASRSLKPKDILVTSAQN
FT                   KDDVAELMEAIEYYRRGRDVYVVGVTNVGKSTLINAIIKSASGSEDVITTSRFPGTTLD
FT                   KIEIPLDEDSALIDTPGIIHRGQIAHYLEPEDLKYVSPRKEIKPKTYQLDPEQTLFFGG
FT                   LARFDFISGERQGMTAYFDNEINVHRTKLEGATEFYEKHKGELLAPALVGAKLVRREFK
FT                   ITDKSDIVFSGLGWVRVPQKAVVAAWVPEGVDVVVRKALIG"
FT   gene            224321..224680
FT                   /gene="yccE"
FT                   /locus_tag="L24277"
FT   CDS             224321..224680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccE"
FT                   /locus_tag="L24277"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 34%
FT                   identical to a protein from Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L24277"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04320"
FT                   /db_xref="GOA:Q9CIY4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIY4"
FT                   /protein_id="AAK04320.1"
FT                   /translation="MQLGETAEEACLRELYEETGLQLEIERLAFIHENFFTGQESDFLN
FT                   KVNCHELSFYFLMKPLTENLSVKSESFGTDGSKEFLKWIPIAEYKNYKAFPTFFADELK
FT                   NLSVNSQIKRIVTTE"
FT   gene            224848..226008
FT                   /gene="hflX"
FT                   /locus_tag="L0162"
FT   CDS             224848..226008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="L0162"
FT                   /product="GTP-binding protein HflX"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.10 GTP-binding proteins.
FT                   putative counterpart of YnbA of B.subtilis and HflX of
FT                   E.coli."
FT                   /db_xref="EnsemblGenomes-Gn:L0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04321"
FT                   /db_xref="GOA:Q9CIY3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIY3"
FT                   /protein_id="AAK04321.1"
FT                   /translation="MIELAELTKTAGGLVIDQFTQKRERPDSRTMIGSGKLEQMRWAIE
FT                   VGEIDTVIFNDRLSPRQNVNLEEALGVKVIDRMQLILDIFAMRARSHEGMLQVEEAQLN
FT                   YLLPRLVGQGIMLSRQGGGIGSKGPGETKLETDRRYIRTRIENIDKALKKVEKTRENIR
FT                   QKRSKSGIFRIGLIGYTNAGKSSIMNALVGLDKEQYEQNELFATLDATTKAVKLVEDFT
FT                   VSLTDTVGFIQNLPTELIKAFKSTLEESANVDLLIHVVDASNPHHEIHEQTVLKIMEDL
FT                   KLTNIPVLNVYNKMDIAPSDFLPTLSPSLQLSIKSESGVQWLKTAILEKLHELFDAFEL
FT                   ELPYEKAYQLPELRKSALVQSVVEGEKGYLIKGLIAPELSWKLPNN"
FT   gene            226060..226368
FT                   /gene="yccF"
FT                   /locus_tag="L26054"
FT   CDS             226060..226368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccF"
FT                   /locus_tag="L26054"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:L26054"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04322"
FT                   /db_xref="GOA:Q9CIY2"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIY2"
FT                   /protein_id="AAK04322.1"
FT                   /translation="MNGKQKRYLRSLAVNIKPIVQIGKSGLSNEILTSIRNAADARELI
FT                   KVNILQNSDEVATDVAEAIEEMGLDVVQIIGRNLIVFKVSDRKENRKISVEVKNIVK"
FT   gene            226415..227014
FT                   /gene="yccG"
FT                   /locus_tag="L26400"
FT   CDS             226415..227014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccG"
FT                   /locus_tag="L26400"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:L26400"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04323"
FT                   /db_xref="GOA:Q9CIY1"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIY1"
FT                   /protein_id="AAK04323.1"
FT                   /translation="MVIDLLTPFTKVELKAKEDEKRRAIGLFWGNFNPVHVGHLTIADQ
FT                   VRQELNLEKVVFLPEHNTDGHVAAMLTAAIEDCPGLEVDACRLKAKDGADIYQTVLELH
FT                   EENPDCDFYFIIGGDMIYGLAHWAHIDELLELVQFVGIRRPRYRAGTSYPIMWVDVPMM
FT                   DISGNLIREQLHRGIKPHFLLAPKVLDYILKEGLYV"
FT   gene            227007..227597
FT                   /gene="yccH"
FT                   /locus_tag="L26998"
FT   CDS             227007..227597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccH"
FT                   /locus_tag="L26998"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:L26998"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04324"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIY0"
FT                   /protein_id="AAK04324.1"
FT                   /translation="MFDFYPEVNLSREDLLAKIASMVKKSRFEHMLGVEKAAIALAQKY
FT                   EVDPHKASLAGLLHDYCKEVDDETFLALIDKYGLDSDLKNWDNNIWHGKVGIYKMREDF
FT                   GLEDEEVLRAIEIHTVGDKEMSGLAKVLYVADYIEEGRTFPGVIEARAVANQDLNQAVA
FT                   FETMRLVEYLAERRLTIYPQTFEAYNAFIGYLS"
FT   gene            227643..228068
FT                   /gene="yccI"
FT                   /locus_tag="L27646"
FT   CDS             227643..228068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccI"
FT                   /locus_tag="L27646"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL"
FT                   /db_xref="EnsemblGenomes-Gn:L27646"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04325"
FT                   /db_xref="GOA:Q9CIX9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIX9"
FT                   /protein_id="AAK04325.1"
FT                   /translation="MIRKAEMKDYLDIARLSGVLGYPISEVAVKKNLARILKDADHEFL
FT                   VFELGERVTAFIEAEIYAPVYAEQVMLNVLGLVVDEKNQGQGIGAQLLNALEEKAKARE
FT                   IKVIRLNSGVKRHEAHQFYEHQGYTSNHSQKRFLKFL"
FT   gene            228234..228593
FT                   /gene="yccJ"
FT                   /locus_tag="L28204"
FT   CDS             228234..228593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccJ"
FT                   /locus_tag="L28204"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:L28204"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04326"
FT                   /db_xref="GOA:Q9CIX8"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="InterPro:IPR025656"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIX8"
FT                   /protein_id="AAK04326.1"
FT                   /translation="MDSKKLLEVVVKAADDKKALDIVALDMSEVTFVADYFVIMEAMNS
FT                   RQLDAIADNIAEAAELAGAKAAGHIEGDAKTGWVLIDLGDIVVSVFGHDERGHFNLEKL
FT                   WSDAPMVDISGFMAE"
FT   gene            228693..229427
FT                   /gene="yccK"
FT                   /locus_tag="L28696"
FT   CDS             228693..229427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccK"
FT                   /locus_tag="L28696"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:L28696"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04327"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIX7"
FT                   /protein_id="AAK04327.1"
FT                   /translation="MVFYEDFSRVYDQVMDQELYEQWLDFTKRHLPKETKSVFELACGS
FT                   GALSVRLAQEGYKVTGLDISEEMLTLASKKARQAGYQLDFTAGDMRELSGLGKFDAVTC
FT                   YSDSLCYLENLDELQATFDGVFEILNEGGTFIFDVHSTYQVDEVFPNYSYHENAEDFAF
FT                   LWDSFAGEVPHSIVHELSFFIQGSDGKFTRKDEVHEERTYPIDDYLARLATAGFKEAMV
FT                   CADFTDEAPSEESARWFFVCKK"
FT   gene            229477..230646
FT                   /gene="yccL"
FT                   /locus_tag="L29477"
FT   CDS             229477..230646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccL"
FT                   /locus_tag="L29477"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. 28%
FT                   identical to YlbM protein of B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L29477"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04328"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIX6"
FT                   /protein_id="AAK04328.1"
FT                   /translation="MNKITGIIAEFNPFHKGHEYLLNQIEGIKIVAMSGNWMQRGEPAI
FT                   FDKWTRAQMALACGADLVVELPVTVSAQAADFFASGAVDILKNLGITDLAFGSESAIDY
FT                   NEIADIYEKRGEEMESYIQSLADQLSYPEKTQKMWQHFTGIEFDGNTPNHVLALAYAKA
FT                   AAGKQINLQAIKRVGKFHSLELTEGFASATALRQELFSLTERQNLLTEQTNQSVSNKLV
FT                   LTDLSAIKNHVPSAILAAYASPKTNWAAYFPLLQYKIRVDEHLENIFQVNQELSVRLKK
FT                   AVKSAKNFDELVEQVYTKRYTKARVRRLLTYILLNIPKQFDLPEQIHVLGFSKTGQEIL
FT                   AQNRGKIISKIGQNPWDNLTQKADEIYQLGNVQFEEQNFGRKPIRSSIR"
FT   gene            230717..231142
FT                   /gene="ycdA"
FT                   /locus_tag="L30663"
FT   CDS             230717..231142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdA"
FT                   /locus_tag="L30663"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   32% identical to BacF protein from Enterococcus faecalis
FT                   pheromone-responsive conjugative plasmid pPD1"
FT                   /db_xref="EnsemblGenomes-Gn:L30663"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04329"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIX5"
FT                   /protein_id="AAK04329.1"
FT                   /translation="MTEKSMKNLVKVTGILNIIGAALVVLSTIVSMASLSQALNSTGSN
FT                   SFEAGFNAANSGPAMFIKIIIGFVGIATFILAIILLRQNRRFNLSNAAAILTLIAVIFA
FT                   WVIIFVSLVLWIIAAVFLLRMKIKEGEENSNEISSQE"
FT   gene            231298..232014
FT                   /gene="ycdB"
FT                   /locus_tag="L31280"
FT   CDS             231298..232014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdB"
FT                   /locus_tag="L31280"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved. 96% identical to YeeN from E.coli."
FT                   /db_xref="EnsemblGenomes-Gn:L31280"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04330"
FT                   /db_xref="GOA:Q9CIX4"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026563"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIX4"
FT                   /protein_id="AAK04330.1"
FT                   /translation="MGRKWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQGEPDPESNS
FT                   SLKFVIERAKQAQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMVIAETLTSNVN
FT                   RTIANVRTTFHKNGGNIGAAGAVSYMFDNTGVIVFEGTDPDHIFEILLDAEVDVRDVTE
FT                   EEGNIVVYTEPTDLHKGIAALKEAGITEFSTTELEMIPQSEVELSPEDLEIFEGLIDAL
FT                   EDDDDVQKVYHNVANL"
FT   gene            232081..232722
FT                   /gene="ycdC"
FT                   /locus_tag="L32072"
FT   CDS             232081..232722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdC"
FT                   /locus_tag="L32072"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 40%
FT                   identical to a protein from Streptococci and Clostridia"
FT                   /db_xref="EnsemblGenomes-Gn:L32072"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04331"
FT                   /db_xref="InterPro:IPR008319"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIX3"
FT                   /protein_id="AAK04331.1"
FT                   /translation="MSSPKIDYKKSDKNYYLPKGISLIELPALNYLMIDGKGAPTSPAF
FT                   QEAIQYLYATAYMISMSYRNPDFIIENFQPFVVPPLEGLWTSKNEPRAGKLDKNDFIWR
FT                   LMIRMPDFVDSEIVEKAKKLVESKKGFDLSKVKFEAIQDGLCLQTIHLGSFDDEGESFE
FT                   KLFEYAKEHDLKAVHKEFHHREIYISDFRKTATEKLKTTLRIFVERGQEK"
FT   gene            232719..233378
FT                   /gene="ung"
FT                   /locus_tag="L32653"
FT   CDS             232719..233378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="L32653"
FT                   /product="uracil-DNA glycosilase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:L32653"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04332"
FT                   /db_xref="GOA:Q9CIX2"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIX2"
FT                   /protein_id="AAK04332.1"
FT                   /translation="MKKTDWSQPLRNRLAEDYFPKMIEFINQTYQEGKVYPPENQIFRA
FT                   IELTPLAQTKVIIVGQDPYPQPGKAQGLAFSYPATFKVNRPDSIVNIQKELREEGFSKD
FT                   DSDLTAWAEQGVLLLNAVLTVPEFASNAHAGKIWEPLTDEIIKIASDDERPKVFILWGG
FT                   FARKKAKLIDGSKHLILEAAHPSPLSASRGFFGSHPFSKTNEFLVESGQSPIDWSK"
FT   gene            complement(233411..233719)
FT                   /gene="ycdE"
FT                   /locus_tag="L33417"
FT   CDS             complement(233411..233719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdE"
FT                   /locus_tag="L33417"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   31% identical to HI0107 of Haemophilus influenzae"
FT                   /db_xref="EnsemblGenomes-Gn:L33417"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04333"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIX1"
FT                   /protein_id="AAK04333.1"
FT                   /translation="MKNKEITAAIDLFSHETLKAALELGVKADKMSTVIMYPEPPAGIP
FT                   TATGGEALPSDMEMILNAISNHQLTVPIAAKYSIDDYLEAINLQMNRHAHGKIVLYF"
FT   gene            complement(234086..234322)
FT                   /gene="ycdG"
FT                   /locus_tag="L34092"
FT   CDS             complement(234086..234322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdG"
FT                   /locus_tag="L34092"
FT                   /product="oxidoreductase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.01 ENERGY METABOLISM.
FT                   Aerobic. similar to several alcohol dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:L34092"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04334"
FT                   /db_xref="GOA:Q9CIX0"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIX0"
FT                   /protein_id="AAK04334.1"
FT                   /translation="MVKALQYKTFGKPDVLQLVDLPLVHPKADEVSIKVSHVGLNPMDW
FT                   AIMGNPEVAPNFGVKLPQTFAYDFAGIIDEIGP"
FT   gene            234472..235017
FT                   /gene="ycdF"
FT                   /locus_tag="L34460"
FT   CDS             234472..235017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdF"
FT                   /locus_tag="L34460"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General. similar to tetR-family transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:L34460"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04335"
FT                   /db_xref="GOA:Q9CIW9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIW9"
FT                   /protein_id="AAK04335.1"
FT                   /translation="MKKTSQEKLYEAALELITAQGYENTTVLQIATKAGLTERTFFRKF
FT                   KNKADIFFAGGEQYSQMLLTKMKESKANNPLAIVLESYFYAADFFDEHRERTVKRQKII
FT                   ASHPDLEERELLKQSKIEELLVEYLLTAYGERSARLAVRLARAVYSVAWEEWLENDADS
FT                   LHHLLEKAIADFNELKNY"
FT   gene            complement(235128..236588)
FT                   /gene="ycdH"
FT                   /locus_tag="L35134"
FT   CDS             complement(235128..236588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdH"
FT                   /locus_tag="L35134"
FT                   /product="transporter"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.08 TRANSPORT AND BINDING
FT                   proteinS. Multidrug resistance. similar to several
FT                   multidrug resistance proteins"
FT                   /db_xref="EnsemblGenomes-Gn:L35134"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04336"
FT                   /db_xref="GOA:Q9CIW8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIW8"
FT                   /protein_id="AAK04336.1"
FT                   /translation="MNKIQEKRSIRAFMLSNVMAGLEGSIVATALPAMMAELHGIKLMS
FT                   WVVTIYMLLMAVSSPIWTKLAERFEYKQMFVLGTLLFTIGSLGEGLAINMLMVIVARAL
FT                   MGLGAGVMIQLPFVIYGMMYQADERRRVIGNTVAAYSFSTIAGPIVGGLIVTLLDWRWV
FT                   FFINIPIGIYMAFIVWKNFDLKTDHTKKSIDFAGSASLSIAVIAIMLHFQMMGNAVINL
FT                   PLLLILLVVSFLFFIGFYFAEKRAVDPIVPLELFKNPSFIAKNIMFFMQYGFFGFYTNY
FT                   LPTWGQGVMGATALVGGMVLIPSAIMLVIGTRNVNHLIQKVGEKKTIYIGFSIMVLGAI
FT                   FLFSLPEHASIMMLFVATAILGTAFGIVNITLQVAVQESVAKHLIGAATAVNALLRTMG
FT                   TTLVLSGLSIALNRTFTEATAHNPKLTTTLLNQISDAKALKNIPVNLIAPLRHTLFNGM
FT                   HLLALISGLLLFIALFVNWLDPWKKGLE"
FT   gene            236778..237140
FT                   /gene="rmeC"
FT                   /locus_tag="L36748"
FT   CDS             236778..237140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmeC"
FT                   /locus_tag="L36748"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General. BELONGS TO THE MERR FAMILY OF TRANSCRIPTIONAL
FT                   REGULATORS."
FT                   /db_xref="EnsemblGenomes-Gn:L36748"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04337"
FT                   /db_xref="GOA:Q9CIW7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIW7"
FT                   /protein_id="AAK04337.1"
FT                   /translation="MVTIATVAGRTGISAYNLRFYEKEGLISVPRTKAGIRDFDEATES
FT                   RINAIRHYRCAGLSLAQIKEVFANTDKHEMIIGVLKARKKEMEKELAELEKSMAYLDKK
FT                   INIHQERLNEEATKLV"
FT   gene            237226..237402
FT                   /gene="rpsU"
FT                   /locus_tag="L0398"
FT   CDS             237226..237402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="L0398"
FT                   /product="30S ribosomal protein S21"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.05 Ribosomal proteins:
FT                   synthesis and modification. BELONGS TO THE S21P FAMILY OF
FT                   RIBOSOMAL proteinS."
FT                   /db_xref="EnsemblGenomes-Gn:L0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04338"
FT                   /db_xref="GOA:Q9CIW6"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIW6"
FT                   /protein_id="AAK04338.1"
FT                   /translation="MSKTLVRKNESLDDALRRFKRSVTKAGTLQELRKREHYEKPSVKR
FT                   KRKSEAARKRKKY"
FT   gene            237609..240020
FT                   /gene="ycdJ"
FT                   /locus_tag="L37573"
FT   CDS             237609..240020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdJ"
FT                   /locus_tag="L37573"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   homologs not detected in Streptococci. There are four
FT                   paralogs in L.lactis. 76% identical to YpiL and 86%
FT                   identical to YigE."
FT                   /db_xref="EnsemblGenomes-Gn:L37573"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04339"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIW5"
FT                   /protein_id="AAK04339.1"
FT                   /translation="MENQKKHFQMKSSSKFWLLSTGILLSLLVTSLPLAVKADENLAVT
FT                   PPSQTEAVTDPTVNSSLAVSDSTTEGNAGSSQAEVPTSQVSSSALEASSPTSQASLAPS
FT                   TEGSASSSGVSASMSSSSAPTSSSTSKAPSFPMDSSKAIVGVDSSLSASGTIISPALTN
FT                   GSIASQANGQDPAISSISATGSVANDITGPSTLDDVNITIKANNLVPNNFLTPDGLHWS
FT                   ANTEVIPITGQTTGQISTENFGQTDGPPIPATTYTMNAGDSGRITNVGRTLAGTNLDLI
FT                   YKVISTDESSWQAPKESTSDCPIGLAFTGEQNIANSDGNSIVALYYGANNVNLNYQIVV
FT                   HNTNFQIPVLASFITTDIDMAQGVKTNLANLLTVIPKTTNLATDSSGVIYDTTSPDTDL
FT                   NGQASLPYGGYLGVGFLSNFDYDFYSPAPVRSGDSYQYSQGIRYDLFGSALQAHLATQV
FT                   RDIVYLNYYDADENNQLIVPQHQFIWFPNVSWNVPASKFPHYAYGQESQYRNGNTIIVG
FT                   DYYHIQSTVTYDYYGTDGTYLGQQSTTGLYGHSYSVNVPYNFGNYYIEGSATQSGTYPK
FT                   HDEVLDVYYKYVPPIVYYNTSNPYATTYYANGYEYVPNYIPPVVYYVPTYDSYGYGGGY
FT                   SYSGGYGYSSGGGYSNSNGTYYPNYVPQSAYYSKEAQLVSEDNYNGGGSRNGENWWSDE
FT                   GRDQVFGLGAEKFAQWGLMIGEESPVSPIVGPAITFGTELAKGKGIDDATAKSSAELGI
FT                   NLVVGGMATLAIAGTTALAPAIAIGVAAFIVMRGISIGYDYLYDHRRKRK"
FT   gene            240032..240631
FT                   /gene="yceA"
FT                   /locus_tag="L40035"
FT   CDS             240032..240631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceA"
FT                   /locus_tag="L40035"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved. 24% identical to Y39C12A.3 protein of
FT                   Caenorhabditis elegans. 20% identical to YceC, YihA and
FT                   YpiF."
FT                   /db_xref="EnsemblGenomes-Gn:L40035"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04340"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIW4"
FT                   /protein_id="AAK04340.1"
FT                   /translation="MIINFYTNEESCYGFENKTQMVFVRKNEVTSEGNQKMLWSIIGSG
FT                   SLLSPFLTDFSLYLNHFSNEMNILLWLLLSSLGLCIIAFLISCVFILITDRKNEKLFKA
FT                   SGQNRALSQNEWRDIEKYESSNRLRLAMIWGAIVLFMSILFPLGNFYLTHNDGFIFALI
FT                   QTLIFGITVCFLLFYINHRATKNRRKILNLHNSMIT"
FT   gene            240760..241252
FT                   /gene="yceC"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci. The position of
FT                   start codon is not clear. There are three paralogs in
FT                   L.lactis, also ypiF and yihA. More than 55% identical.
FT                   Probably two frameshifts in this gene."
FT   gene            241256..241705
FT                   /gene="yceD"
FT                   /locus_tag="L41256"
FT   CDS             241256..241705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceD"
FT                   /locus_tag="L41256"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci. There are three
FT                   paralogs in L.lactis, also ypiE and yihB. More than 72%
FT                   identical."
FT                   /db_xref="EnsemblGenomes-Gn:L41256"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04341"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIW3"
FT                   /protein_id="AAK04341.1"
FT                   /translation="MKNDIDENKEKEVIQKAYHYNKFLVIWFIAVFIILVLRITKIITD
FT                   SYLAWGFGLLIVIYAISLHVQNHKLKIKSIASILVYIFNILSGLSAFLIILANQAHNLL
FT                   ELEIGALLALLNFILQVLAAIFALLSARKLRKLYPDIIDNRRKKI"
FT   gene            241794..242606
FT                   /gene="yceE"
FT                   /locus_tag="L41779"
FT   CDS             241794..242606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceE"
FT                   /locus_tag="L41779"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved. there are nine paralogs in L.lactis"
FT                   /db_xref="EnsemblGenomes-Gn:L41779"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04342"
FT                   /db_xref="GOA:Q9CIW2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIW2"
FT                   /protein_id="AAK04342.1"
FT                   /translation="MTKIKHIFSDLDGTLLDDQGKISKKTQEVIENSNLPFSLVSARAP
FT                   QAMESLINQLNLKSSQVAFNGGLIFAKNEVIKANPMVHASAQELIKTIKKDYPEINLSL
FT                   YSLSDWYVEKIDKDIEQEMQFTPQVPKLVDLETLITERPRLEIFKILLITPNESKLEEI
FT                   KKHLEKLNFPDIIIQKTWETYLEITHLEAQKAKAVQFIAQREQLEQSELAAFGDNENDL
FT                   SMLKAVGLPIVMANASDDLKKIGKVITKSNTEDGVAYGIQKYITDSLF"
FT   gene            242796..243992
FT                   /gene="pgk"
FT                   /locus_tag="L0010"
FT   CDS             242796..243992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="L0010"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.09 Glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:L0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04343"
FT                   /db_xref="GOA:Q9CIW1"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIW1"
FT                   /protein_id="AAK04343.1"
FT                   /translation="MAKLTVKDVELKGKKVLVRVDFNVPIKDGVITNDNRITAALPTIK
FT                   YILEQGGRAVLFSHLGRVKEEADKAGKSLAPVAKALSEKLGQDVVFPGTTRGAELEAAI
FT                   NELKDGEILLVENTRFEDIDGKKESKNDPELGKYWASLGDGIFVNDAFGTAHRAHASNV
FT                   GISANVDKAVAGFLLENEIAYIQEAVEAPERPFVAILGGSKVSDKIGVIENLLSKADKV
FT                   IIGGGMAYTFLKAQGYEIGTSLVEDDKLDLAKELLEKAAGKLILPLDHKVANAFAGYTE
FT                   VKETADQNIPAGFMGLDVASKTIADYNTQLEGAKTVVWNGPVGVFENTDFQAGTVGLME
FT                   AIVKQPGVKSIIGGGDSAAAAINLGYADKFSWISTGGGASMELLEGKVLPGLAALTEK"
FT   gene            244108..245055
FT                   /gene="dhaK"
FT                   /locus_tag="L44063"
FT   CDS             244108..245055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaK"
FT                   /locus_tag="L44063"
FT                   /product="dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.03 ENERGY METABOLISM.
FT                   Anaerobic. there is a paralogous gene dhaL in L.lactis"
FT                   /db_xref="EnsemblGenomes-Gn:L44063"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04344"
FT                   /db_xref="GOA:Q9CIW0"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012735"
FT                   /db_xref="PDB:2IU4"
FT                   /db_xref="PDB:2IU6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIW0"
FT                   /protein_id="AAK04344.1"
FT                   /translation="MLKGIDLTYPQLTYLPETGILYDNTYNEKTVPIISGGGSGHEPAH
FT                   VGYVGSGMLAAAVTGPLFIPPKSKNILKAIRQVNSGKGVFVIIKNFEADLKEFNEAIKE
FT                   ARTEGIDVRYIVSHDDISVNAYNFHKRHRGVAGTILLHKILGAFAKEGGSIDEIEQLAL
FT                   SLSPEIYTLGVALAPVHFPHQKTSFVLAEDEVSFGIGIHGEPGYRVEKFEGSERIAIEL
FT                   VNKLKAEINWQKKANKNYILLVNGLGSTTLMELYSFQYDVMRLLELEGLSVKFCKVGNL
FT                   MTSCDMSGISLTLCSVKDPKWLDYLNVPTGAFAW"
FT   gene            complement(245056..245619)
FT                   /gene="yceG"
FT                   /locus_tag="L45062"
FT   CDS             complement(245056..245619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceG"
FT                   /locus_tag="L45062"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. best
FT                   score with Y07639 that shows signature of helix-turn-helix
FT                   from TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:L45062"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04345"
FT                   /db_xref="GOA:Q9CIV9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR012738"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="PDB:2IU5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIV9"
FT                   /protein_id="AAK04345.1"
FT                   /translation="MSAFFLNMKKSIITQKIIAKAFKDLMQSNAYHQISVSDIMQTAKI
FT                   RRQTFYNYFQNQEELLSWIFENDFAELINDNSDYYGWQNELLLLLRYLDENQIFYQKIF
FT                   VIDKNFEHFFLIQWENLLDKVIFDQEKKSDYHWSDLEKSFICRYNAAAICAITRESIIR
FT                   GNSLEKLYSQIVNLLLAQIKIFES"
FT   gene            245740..246690
FT                   /gene="dhaL"
FT                   /locus_tag="L45677"
FT   CDS             245740..246690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaL"
FT                   /locus_tag="L45677"
FT                   /product="dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.03 ENERGY METABOLISM.
FT                   Anaerobic. there is a paralogous gene dhaK in L.lactis"
FT                   /db_xref="EnsemblGenomes-Gn:L45677"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04346"
FT                   /db_xref="GOA:Q9CIV8"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="PDB:3CT4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIV8"
FT                   /protein_id="AAK04346.1"
FT                   /translation="MLDGLTYAYGDLIEKVPDFEIIQRKSPKSGKVALVSGGGSGHKPA
FT                   HAGFVGEGMLSAAVCGAIFTSPTPDQIYEAIKSADEGAGVLLIIKNYLGDVMNFEMARE
FT                   MAEMEEIKVEQIIVDDDIAVENSLYTQGRRGVAGTVLVHKILGAAAHQEASLDEIKDLA
FT                   DKVVKNIKTIGLALSAATVPEVGKPGFVLDDNEIEYGVGIHSEPGYRREKMKTSYELAT
FT                   ELVGKLKEEFKFEAGQKYGILVNGMGATPLMEQFIFMNDVAKLLTEENIEILFKKVGNY
FT                   MTSIDMAGLSLTMIKLEDDQWLKNLNEDVKTISWG"
FT   gene            246700..247278
FT                   /gene="dhaM"
FT                   /locus_tag="L46694"
FT   CDS             246700..247278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaM"
FT                   /locus_tag="L46694"
FT                   /product="dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.03 ENERGY METABOLISM.
FT                   Anaerobic. 28% identical to the C-terminal part of
FT                   dihydroxyacetone kinase from Citrobacter freundii. Maybe a
FT                   subunit of the enzyme."
FT                   /db_xref="EnsemblGenomes-Gn:L46694"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04347"
FT                   /db_xref="GOA:Q9CIV7"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="PDB:3CR3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIV7"
FT                   /protein_id="AAK04347.1"
FT                   /translation="MLTIDTTIEWLGKFNEKIQENKAYLSELDGPIGDGDHGANMARGM
FT                   SETMKALEVSNFGNVSEIFKKVAMTLMSKVGGASGPLYGSAFLAMSKTAIETLDTSELI
FT                   YAGLEAIQKRGKAQVGEKTMVDIWSAFLNDLQTDSASKDNLEKVVKASAGLLATKGRAS
FT                   YLGERSIGHIDPGTQSSAYLFETLLEVVA"
FT   gene            247275..247646
FT                   /gene="yceJ"
FT                   /locus_tag="L47257"
FT   CDS             247275..247646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceJ"
FT                   /locus_tag="L47257"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL"
FT                   /db_xref="EnsemblGenomes-Gn:L47257"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04348"
FT                   /db_xref="GOA:Q9CIV6"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="PDB:3CR3"
FT                   /db_xref="PDB:3CT6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIV6"
FT                   /protein_id="AAK04348.1"
FT                   /translation="MTYGIVIVSHSPEIASGLKKLIREVAKNISLTAIGGLENGEIGTS
FT                   FDRVMNAIEENEADNLLTFFDLGSARMNLDLVSEMTDKELTIFNVPLIEGAYTASALLE
FT                   AGATFEAIKEQLEKMLIEK"
FT   gene            247656..248372
FT                   /gene="glpF1"
FT                   /locus_tag="L47650"
FT   CDS             247656..248372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF1"
FT                   /locus_tag="L47650"
FT                   /product="glycerol uptake facilitator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.04 TRANSPORT AND BINDING
FT                   proteinS Carbohydrates, organic alcohols and acids"
FT                   /db_xref="EnsemblGenomes-Gn:L47650"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04349"
FT                   /db_xref="GOA:Q9CIV5"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIV5"
FT                   /protein_id="AAK04349.1"
FT                   /translation="MTLQILGEFLGTFILVLLGNGVVAANVLGKTKSENAGWVTIAIGW
FT                   GLAVAVAVWVVGFFSPAYLNPALVIGFLVLGKIKIGLAFAFIVAEFLGAMLGAVAVWLH
FT                   YYPHWEETKDSSLILASFATAPAIRYSWSNFLGEAFDGALLMILIMAMGHYRLEGGFGP
FT                   IIVGFLIMAVGFSLGPTTGYAMNPARDLGPRIMHALLPIKNKGTSGWGYAWIPATGSIV
FT                   GAVIAGLLYQWMLTLH"
FT   gene            complement(248411..249790)
FT                   /gene="pepDA"
FT                   /locus_tag="L48417"
FT   CDS             complement(248411..249790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepDA"
FT                   /locus_tag="L48417"
FT                   /product="dipeptidase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.02 Degradation of
FT                   proteins, peptides, and glycopeptides. 55% identical to
FT                   dipeptidase PepD of Lactobacillus helveticus"
FT                   /db_xref="EnsemblGenomes-Gn:L48417"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04350"
FT                   /db_xref="GOA:Q9CIV4"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIV4"
FT                   /protein_id="AAK04350.1"
FT                   /translation="MTCTTFLVGKKASLDGTTLIARNEDGGDKPNPQRFVVINPENQPK
FT                   HYRSITTACEFDLPENPLSYTSTPDADSSYGIWAAAGINSENVAMTATETSTTNSRILG
FT                   LDPYVETGLGEEDFTTITLPYIQSAREGVERMGQLLEEYGTYESNGMAFSDKDEIWWLE
FT                   TLGGHQWAAIRIPDDAYVIAPNRLNIDWYDFESSDTIYSTGLKEFIDKNKLNPDFDGYN
FT                   LRHIFGSSTIKDTRYNNPRAWYVQNYFSPETTGNDDPFNQDLPFICHANRKISIEEIKF
FT                   VMSSHYENTAYDPYSTTSSAAEQKLIRPIGLNRNLELHVLQIRDNIDKKLAGIHWLAFG
FT                   PNSFNSLVPFYARVSDTPTCYRDTKADFDPTKMYWLTTMTAVLGDSNFQGYVDKRDNFD
FT                   LNTMAKLRALQNETDKVSDQSLEAVNEKLAQIALTAQTELLGKMVISGSNHMKLRFDFN
FT                   D"
FT   gene            249968..250615
FT                   /gene="ycfA"
FT                   /locus_tag="L49937"
FT   CDS             249968..250615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfA"
FT                   /locus_tag="L49937"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General. BELONGS TO THE TETR/ACRR FAMILY OF TRANSCRIPTIONAL
FT                   REGULATORS"
FT                   /db_xref="EnsemblGenomes-Gn:L49937"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04351"
FT                   /db_xref="GOA:Q9CIV3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIV3"
FT                   /protein_id="AAK04351.1"
FT                   /translation="MSEEQTLNEVYADTLKKMENLTEKQKRVLQASLELFASQGFEATT
FT                   SQQIAKRAGVSVGSVYHTFPTKQAILVAVLAPIFEGTMDTVANQFNDNTFGKGFESVEE
FT                   LVKVTIADRFYFADKNINVIRLMLGQMLVNSVFVEDLKKFFEQQAKQLVLPTIVRLQAE
FT                   QKIKNLPIEKILQILFYPLATYIGKRVLGINNMSLEEEIEFATEITIKTLKV"
FT   gene            250701..251447
FT                   /gene="ycfB"
FT                   /locus_tag="L50637"
FT   CDS             250701..251447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfB"
FT                   /locus_tag="L50637"
FT                   /product="ABC transporter ATP binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS General. There are 60 paralogs in L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L50637"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04352"
FT                   /db_xref="GOA:Q9CIV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIV2"
FT                   /protein_id="AAK04352.1"
FT                   /translation="MKSPIAINDISVKFGDKAILDHLSYEFESGKIICLIGPSGAGKST
FT                   FIKAIVGMQKLDSGNVKILERKIPDREVLGKLGYMAQEDALFKELTGKQNLEFFGSLQG
FT                   IKKKDLQGKLDKAAATVNLTKQLNQSISNYSGGMQRRLSLAIALQTDAPILLLDEPTVG
FT                   IDPELRQEIWEELRNQANQGKTILITTHVMDEAERCDVVLMLRNGKFIAEGSPKEIKEK
FT                   YQVASVEEAFIVAGKNLELQNKGAAK"
FT   gene            251444..252586
FT                   /gene="ycfC"
FT                   /locus_tag="L51437"
FT   CDS             251444..252586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfC"
FT                   /locus_tag="L51437"
FT                   /product="ABC transporter permease protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS General"
FT                   /db_xref="EnsemblGenomes-Gn:L51437"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04353"
FT                   /db_xref="GOA:Q9CIV1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIV1"
FT                   /protein_id="AAK04353.1"
FT                   /translation="MRTLAIFKRIMLQRRGDPRTLAMMFLAPIFILTLMYFLFQVPSNN
FT                   AYRVGLKSDNTELTRALKDMPNDKAHLKVISVSENNRSTMNEKDLSAIVSISGKNIDVS
FT                   YANQSNGTSSAIKLLLTQVIQESQVKATKEETKQALQNLISKLPQTSGQSFSTNFRVDT
FT                   EQYKVTSHYLYGDPSSTNATFDDLAPILVGAFAFFLVLLISGISLVNERTSGMLGRMLV
FT                   TPVKRTEIVTGYTLSYGILAMIQTALMVVFTYWILGVHHNGNIGWVFVINFFIAIIALL
FT                   FGLLLSTLAKTEFQFVQMIPLAIVPQFLFSGLIPVDTMPVILQAIAHCIPVYYGISAMQ
FT                   EVVKRGVGFSGIWFDLLIMLLFAALLYLANVLALKNVRRT"
FT   gene            252684..253853
FT                   /gene="ycfD"
FT                   /locus_tag="L52686"
FT   CDS             252684..253853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfD"
FT                   /locus_tag="L52686"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. BELONGS
FT                   TO THE UPF0064 FAMILY. 47% identical to YwbD of B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L52686"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04354"
FT                   /db_xref="GOA:Q9CIV0"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIV0"
FT                   /protein_id="AAK04354.1"
FT                   /translation="MKKITVRTKAAKKLRAGYPLLVAEDLNSPFLEDDFAQFFDEKGQA
FT                   LGTGYLSKQNKGVGWLLDSSSVKIDHHFYVEKFVNARALRANFYQDELTNAFRLFNGEG
FT                   DGLGGLTIDFYNGFAVFSWYNQFIYSQKKAIVKAFQVVFPDIKGAYEKLRFSEAALESQ
FT                   HIFGQEAAEPLLVMENGVTYATYLNEGLMTGIFLDQKNVRGALAGGLSTGKTLLNMFSY
FT                   TGAFSVAAAFGGSSQTTSVDLAKRSLDKTREQFLVNGIEPESQKIYVMDVFGYFNYAKK
FT                   KELTYDMIVLDPPSFARNGKKTFSVAKNYGDLVKEAVEILENNGTLIASTNAANVSDKK
FT                   FRQMIEEALKNKGVKFTVFQEEKLPADFHIADSFPEGNYLKVLFIKIKK"
FT   gene            254043..255965
FT                   /gene="fbp"
FT                   /locus_tag="L54021"
FT   CDS             254043..255965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="L54021"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.08 Gluconeogenesis. 52%
FT                   idetical to fructose-1,6-bisphosphatase of B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L54021"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04355"
FT                   /db_xref="GOA:Q9CIU9"
FT                   /db_xref="InterPro:IPR009164"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIU9"
FT                   /protein_id="AAK04355.1"
FT                   /translation="MDKKYYQLLKNQFSSKEAVLTEIINLSAICELPKATEHFMSDVHG
FT                   EYDAFNHVLRNGSGSIKEKLRDCFPEFSATEISSLATLIYYPQEKLDSECQLKETEEFE
FT                   NYCRINLVYLLKTVKFVGQKYTRSKVRKAFPEKFRYILEELINEVDSTTDKRDYFDSIL
FT                   SQLQNLGEFTRLIVALADTIRRLTVDHLHVVGDIYDRGPYPDKIIDRLIKMPSVDVQWG
FT                   NHDIVWMAAFSGSPLAMMNVIRICARYGNLDILEESYGINLRMILEYAERYYEPSEAFQ
FT                   PRLVEGVRLSDDEKALLNKLQEATAILQFKLESQLIKRRPDFQLEHRDVLHFIDFSEKT
FT                   IKLGTEVYELTDFQAPTVNPEQPESLTAEEEKIISHLLNNFRSSDKLKRHVEFLQEKGA
FT                   MYLSYNGNLLIHGCLPLHENGDFKSFTVNKEAHAGRDLLDFFDQEVRKCLAHPENSTDL
FT                   ATDLMWYLWVGECSSLFGKTAMTTFERYYIKDKKTHVEKKNPYYQLREEAEIIRKILEN
FT                   FGLDEGGHLVNGHTPIKEKNGENPIKADGKLIVIDGGFAKAYQKETGIAGYTILYNSFG
FT                   IQLVAHQPFSTVKEAVEKGTDIISLKCLVAEVDQRKRVKDTNVGQTLLSEIADLEVLFE
FT                   HYEEF"
FT   gene            complement(256200..257471)
FT                   /gene="ycfF"
FT                   /locus_tag="L56208"
FT   CDS             complement(256200..257471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfF"
FT                   /locus_tag="L56208"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. 47%
FT                   identical to YtfP of Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L56208"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04356"
FT                   /db_xref="GOA:Q9CIU8"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIU8"
FT                   /protein_id="AAK04356.1"
FT                   /translation="MTKSAKTFDVIVVGAGPSGMMAAISAAQNGAKVALIDKNKKVGKK
FT                   LLMTGGGRCNVTNARSVDEILTNVPGNGRFLHSAFSQFSNLDIIEFFESNGVKLKEEDH
FT                   GRMFPITDKSKTIVDALFNKILSLHVSYFPSQAVDKLLIENGAVIGLETDSESFLSPTI
FT                   ILSTGGRAYPSTGSTGDGYRLARSAGHSISQLYATESALISDEPFILDKSLQGISLREI
FT                   KLSVLNSKGKAIISHQHDLLFTHFGISGPAAMRCSSFINQLLAKGEKMVTVSLDQFPEK
FT                   KLGSLKNELTSLSKTDKSIKNAFSGLTQERMLLFILEKAGIDPSLSAKTLSEQQIDKIA
FT                   SLFKNWQITISKTLPIEKSFVTGGGVSLKEINPKSMESKQTQGLFMTGELLDINGYTGG
FT                   YNITCAFVTGFVAGKHAAQIASYF"
FT   gene            257612..258439
FT                   /gene="ycfG"
FT                   /locus_tag="L57608"
FT   CDS             257612..258439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfG"
FT                   /locus_tag="L57608"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. BELONGS
FT                   TO THE UPF0031 FAMILY"
FT                   /db_xref="EnsemblGenomes-Gn:L57608"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04357"
FT                   /db_xref="GOA:Q9CIU7"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIU7"
FT                   /protein_id="AAK04357.1"
FT                   /translation="MIELTDEILAKVIKKRKKASYKGTYGRLLVIGGNRQYGGAAILVT
FT                   TSAVYSGAGLVSVALAKENHSALQARLPEAMTLDFDDLIKLREVAKAADVIVIGPGLGL
FT                   ERLDLLTEVLNLLTENQKLVIDGSALTLFAREHLDLPFPENTVFTPHEMELERLSGLKI
FT                   GQQTKEEVQDFVNQLGAIVVAKSSETRIFAPNRESFILKIGSPAQATGGMGDTLAGMVG
FT                   GFLAQFHGETEEVVAAATYLHSLIASVLARKTYVVLPSRLIEEIPLFMKKYEC"
FT   gene            258588..259001
FT                   /gene="ycfH"
FT                   /locus_tag="L58584"
FT   CDS             258588..259001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfH"
FT                   /locus_tag="L58584"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL"
FT                   /db_xref="EnsemblGenomes-Gn:L58584"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04358"
FT                   /db_xref="InterPro:IPR009833"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIU6"
FT                   /protein_id="AAK04358.1"
FT                   /translation="MNAIELVQGAMKKAEKIRPKVGGFPYLAECMREAGVLKNVWTLPV
FT                   GQSTFWTSAGVISVTNSPMVSGFHEVPVFDQEALIKALRADQAGQTTFPEFLSATWEAG
FT                   VISYEADFSERKVTYLGSQGESYVEAYPAVEIH"
FT   gene            259172..261007
FT                   /gene="ycfI"
FT                   /locus_tag="L59135"
FT   CDS             259172..261007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfI"
FT                   /locus_tag="L59135"
FT                   /product="ABC transporter ATP binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS. General. contains two ATP binding domains. There
FT                   are 60 paralogs in L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L59135"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04359"
FT                   /db_xref="GOA:Q9CIU5"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIU5"
FT                   /protein_id="AAK04359.1"
FT                   /translation="MLTIGRRYLNFWPVFWALFLLVIQVVTNLWLPTITADIINKGIGQ
FT                   SDMKYIWFMGLIMLFVSLASWLSAIGNVYFASKQSQGLGLKLRHDLFKKVLFMDERNFQ
FT                   EFGDATLITRTTNDVTQLQNVFQTMLRMMLMAPMMLIGSIFMAWKLSHDLLLVFLIALP
FT                   ILTLAVVINIAISMPRFRSMQTKVDKINLIFQQGLTGVRVIRAFRRDQYEIDKFDEANR
FT                   DLTHTSQVVLTTIAMLMPIMTVILSFTNIGIVWFGAHLISKNMMEMGSLVAFLTYATQI
FT                   LMSFMQLSAVAVMVPRAQVSAVRVREILESKDKITDENSSISVEALKRQRLSSDGNDKL
FT                   SESNSVRNSLALNHVSFKFDEAKRQALSDLSVNVAAGQTLAIIGGTGSGKSTILNLIAR
FT                   LIDPTNGSVTIDGTDIRQISQYDLHEKVSFTQQKAQLFSGTVRSNLQFGKSDATDEEMW
FT                   QALEIAQAADFVREQGGLELAVEQNGANFSGGQKQRISIARTLIKEAEIYLFDDSFSAL
FT                   DFATDRQLRTAINHSEKHKNKIKVIVAQRIATVMSADQILVLENGIAVGLGTHESLAKS
FT                   CPQYQETMQSQLSDDDLVKMGVSIAHLTARGGDDQ"
FT   gene            261004..261699
FT                   /gene="ycgA"
FT                   /locus_tag="L61006"
FT   CDS             261004..261699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgA"
FT                   /locus_tag="L61006"
FT                   /product="ABC transporter ATP binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS General"
FT                   /db_xref="EnsemblGenomes-Gn:L61006"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04360"
FT                   /db_xref="GOA:Q9CIU4"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIU4"
FT                   /protein_id="AAK04360.1"
FT                   /translation="MMRGNYLNRGGKGADRFQKGRRAQNFFPTIIRLFKYMRRDLWGLL
FT                   FSILIASLSVILSVQAPKILGNATTVIFDGVTKSLKNHTAIQIDMTKVESILLYVMVIY
FT                   LISFISGILQQSIMTRISQRTVYTLRREFKNKMKKLPVSYYDSHSNGDIMSRMINDMDN
FT                   ISGTLNQTLIQLITSLLQFVGTIYFMLTISWQLALVAFITVPLAMITVRIVAPLSQKFF
FT                   AEQQKIWDY"
FT   gene            261696..262880
FT                   /gene="ycgB"
FT                   /locus_tag="L61680"
FT   CDS             261696..262880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgB"
FT                   /locus_tag="L61680"
FT                   /product="ABC transporter ATP binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS. General. There are 60 paralogs in L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L61680"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04361"
FT                   /db_xref="GOA:Q9CIU3"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIU3"
FT                   /protein_id="AAK04361.1"
FT                   /translation="MNDQIEENYAGHAVIKTFNHEASAEKEFAKRNDNFYKSAWKAQFV
FT                   STLIYPTMRFVNNLDYLAMAVIGGLKVISGTVNLGDVQAMLQYTNQFAQPITNISNMLN
FT                   TIQATVASAERIFEVLDEKEMTDGIPVSEKVADESSKKAVSNLGATDKTDFINFDQVAF
FT                   SYNENQSLMTDVNFSVEVGQMIAIVGPTGAGKTTMINLLERFYDVTSGKILLEGKDIRE
FT                   IDREQLRGRMAMVLQETWLFSGTIMDNLQYGRLEATQEEVIQAAKMAHADEFITTLPQG
FT                   YQTLLNEAASNISQGQRQLLTIARAFLANPEILILDEATSSVDTRTERLIQSAMNRLLK
FT                   GRTSFVVAHRLSTIRDANQILVMENGNIVEMGNHESLLKENGLYASLYNSQFAK"
FT   gene            262977..263630
FT                   /gene="ycgC"
FT                   /locus_tag="L62955"
FT   CDS             262977..263630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgC"
FT                   /locus_tag="L62955"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:L62955"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04362"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIU2"
FT                   /protein_id="AAK04362.1"
FT                   /translation="MFKKSDKKIKENDQESNAAFEEFFNQVLKKMPARSAKIISSSLTV
FT                   SKAKAEQFLASNSQKFDHLFDEFLVGVDSQTRRKCHETIHFATLTAAIVGFSPIPFSDA
FT                   VLLVPIQLTMMMRLYKIFGASWSEALAKGITKELVVVGLGRSLVGNVLKFVPAVGTIAG
FT                   GAINATVATTITEALGWVTVKMLNDGEDIFNNVLTFEGQFKGLVSKLQKANKKK"
FT   gene            complement(263676..264749)
FT                   /gene="ycgD"
FT                   /locus_tag="L63684"
FT   CDS             complement(263676..264749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgD"
FT                   /locus_tag="L63684"
FT                   /product="oxidoreductase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.01 ENERGY METABOLISM.
FT                   Aerobic. there are four paralogs in L.lactis"
FT                   /db_xref="EnsemblGenomes-Gn:L63684"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04363"
FT                   /db_xref="GOA:Q9CIU1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIU1"
FT                   /protein_id="AAK04363.1"
FT                   /translation="MPLKLKLKPSVPKWRIKRMIKKLNIAYVGFGKSTNRYHIPYVKER
FT                   ENIVIKRIVNRTLGKRPEQAELEANGTLFSTDIADIINDDSIDLVVIVTPAFAHYDYAK
FT                   ELLSAGKNVLCDKPLVETLEQAKELVALAKEKNLFFMPFQNRRFDSDFLTVKKVIEQGY
FT                   LGDLVDITVNMDHFRPNDASQGGNFDGAWYGHGVHLVDQMVSLFGAPKEVQYDIRATRD
FT                   YDSVDDYFSVNLLYPNLRATVAATEVAALPHPKWLVYGTRGTFIKMDVDQQENDLKVGM
FT                   FPGDEGFGQDSPADFGQLTYFNQNGDRIVKHIPTVAGDYGRVYDSAYESIINGADKLVS
FT                   DEQILAVIKTLENGFSK"
FT   gene            complement(265021..265497)
FT                   /gene="ycgE"
FT                   /locus_tag="L65029"
FT   CDS             complement(265021..265497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgE"
FT                   /locus_tag="L65029"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.General"
FT                   /db_xref="EnsemblGenomes-Gn:L65029"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04364"
FT                   /db_xref="GOA:Q9CIU0"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIU0"
FT                   /protein_id="AAK04364.1"
FT                   /translation="MAEVESFQLDHTKVLAPYVRLIGSETGPKGDVITNFDVRFVQPNA
FT                   NAIGMAALHTIEHSMASLIRDRIDGMIDFSPFGCQTGFHMIMWGEHSSEEIAKVIKSSL
FT                   EELASDEFGWDNVPGVAEKECGNYRNHSLFGAKEWSKKILSEGISTDPYERKVI"
FT   gene            265711..266175
FT                   /gene="ycgF"
FT                   /locus_tag="L65707"
FT   CDS             265711..266175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgF"
FT                   /locus_tag="L65707"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L65707"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04365"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIT9"
FT                   /protein_id="AAK04365.1"
FT                   /translation="MNIREVEKSSFSIIGKEGLGKAQEADIWIPPLWQEATNAFEEIIH
FT                   LIKQPLTIWGAMSDESGQFKPWNNGGLYLAGVEVENSAQKPENWTKWTLPGFRYFVVET
FT                   TTYEMNKTYSDMWNYLTQNDLKIVGAVQEHQSISAENPEELELWFPIERI"
FT   gene            266240..267085
FT                   /gene="ycgG"
FT                   /locus_tag="L66233"
FT   CDS             266240..267085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgG"
FT                   /locus_tag="L66233"
FT                   /product="oxidoreductase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.01 ENERGY METABOLISM.
FT                   Aerobic. There are six paralogs in L.lactis. BELONGS TO THE
FT                   ALDO/KETO REDUCTASE FAMILY"
FT                   /db_xref="EnsemblGenomes-Gn:L66233"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04366"
FT                   /db_xref="GOA:Q9CIT8"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIT8"
FT                   /protein_id="AAK04366.1"
FT                   /translation="MTLTDTYTLNNGIKIPKVGFGTWQSASGEEAYNAVKAALEAGYRH
FT                   IDTAAVYKNEESVGQAIADSGIPREELFVTTKLWGVGTTEDAAKALDESLKKLGLDYVD
FT                   LYLIHWPNPKAFRPDFETRNLAVWKAMEAGVKAGKIRAIGVSNFHPRHLKPLLKFAEIK
FT                   PAVNQIMVNPSDQQEEIVSFNVDNNILTEAYSPLGTGKIFEVPELADLASKYNKSIAQV
FT                   VLRWSLHKGYLPLPKSVTPARIKENAEIFDFDLSIEDIAFIDSLHGKAGLAKNPDEVDF
FT                   "
FT   gene            267248..267763
FT                   /gene="ycgH"
FT                   /locus_tag="L67226"
FT   CDS             267248..267763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgH"
FT                   /locus_tag="L67226"
FT                   /product="amidase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   similarity with nicotinamidase or pyrazinamidase from
FT                   Mycobacterium smegmatis"
FT                   /db_xref="EnsemblGenomes-Gn:L67226"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04367"
FT                   /db_xref="GOA:Q9CIT7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIT7"
FT                   /protein_id="AAK04367.1"
FT                   /translation="MMKKALVLVDFQNDFIDGSLGTKEAQAIIPNVIEKLSQYSKENRL
FT                   ATQDTHFEDYLTTQEGKNLPVTHCQNGTFGWEIRKEAQVGFAKIFEKTTFGSRTLAEFI
FT                   RDENYDEVELVGICTDICVVSNALLIKAYAPEVKISVDASCCAGVSPEKHLAALETMRS
FT                   CQIEITNA"
FT   gene            267882..268430
FT                   /gene="ycgI"
FT                   /locus_tag="L67872"
FT   CDS             267882..268430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgI"
FT                   /locus_tag="L67872"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 57%
FT                   identical to a protein from Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L67872"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04368"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIT6"
FT                   /protein_id="AAK04368.1"
FT                   /translation="MDYHQLFSRLNEKLSEENLQLHLHCVGGFVLEYYGMKATEDIDAF
FT                   YESTEKVEKIIQEIGGEFHVGTSNEPWLSQAVGEVMSHSKTDETIIFVESHLTVGLSSL
FT                   ESILIDKIQAGRTKDVPDIAKIMKKLKIESPDPLLERFKHTDGSADPAVILEAFSLAYG
FT                   EEALKNYLRKNPKILRLLQ"
FT   gene            268427..268711
FT                   /gene="ycgJ"
FT                   /locus_tag="L68363"
FT   CDS             268427..268711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgJ"
FT                   /locus_tag="L68363"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. best
FT                   score with unknown protein of Lactococcus lactis gi1098510"
FT                   /db_xref="EnsemblGenomes-Gn:L68363"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04369"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIT5"
FT                   /protein_id="AAK04369.1"
FT                   /translation="MTWIEYLLNAAQKSKWNLELWVRYLNKVIQRDKILLSKTDIDYLM
FT                   SSEELTSFQRVFLELALEKETTPWEMTVGMSEPTQSIHLQSVLKELKKE"
FT   gene            complement(268750..270069)
FT                   /gene="acmA"
FT                   /locus_tag="L68758"
FT   CDS             complement(268750..270069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acmA"
FT                   /locus_tag="L68758"
FT                   /product="N-acetylmuramidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:7883712 BIO03.02 CELL
FT                   ENVELOPE Murein sacculus and peptidoglycan. muramidase
FT                   needed for cell separation and responsible for autolysis"
FT                   /db_xref="EnsemblGenomes-Gn:L68758"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04370"
FT                   /db_xref="GOA:Q9CIT4"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR013338"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIT4"
FT                   /protein_id="AAK04370.1"
FT                   /translation="MPVSRIKVKNRHLKKKAKKPLAFYKPATKFAGAVLIAGTLTTTHE
FT                   LLLQQTSPMVQAATNSTEAFIESIAASAKPVADSNGLYPSVMIAQAILESNWGSSQLSR
FT                   APYYNLFGIQGTYQGKSVVFKTQEYLNGKWVTKDMPFRVYPSFNQSFQDNAYVLKTTNF
FT                   GNGPYYAKAWRANAATYQAATAALTGKYATDPNYGASLNRIISQYNLTRFDGASSAGTS
FT                   NSGGSTATNTNNNSNTSSTTYTVKSGDTLWGISQKYGISVAQIQSANNLKSTVIYIGQK
FT                   LVLTTSSSSSNTNSSTSSGNSAGTTTPTTSVTPAKPASQTTIKVKSGDTLWGLSVKYKT
FT                   TIAQLKSWNHLNSDTIFIGQNLIVSQSAGSSSSSTGSSSASTSSTSNSSAASNTSIHKV
FT                   VKGDTLWGLSQKSGSPIASIKAWNHLSSDTILIGQYLRIK"
FT   gene            270413..272656
FT                   /gene="nrdD"
FT                   /locus_tag="L70400"
FT   CDS             270413..272656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="L70400"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO08.05 Salvage of nucleosides
FT                   and nucleotides"
FT                   /db_xref="EnsemblGenomes-Gn:L70400"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04371"
FT                   /db_xref="GOA:Q9CIT3"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIT3"
FT                   /protein_id="AAK04371.1"
FT                   /translation="MKSEVKYQDVTLEEINVIKRDGRSVKFNSEKIFDALTKAAKKVEL
FT                   TDMSVLSELTDRVVSEIFTRFSENVKIYEIQSIVEQELLESGETQLAEEYISYRANRDL
FT                   ARTKATDINFTIEKLINRDQTVVNENANKDSNVFNTQRDLTAGAVSKAIGLKLLPPHVA
FT                   NAHQKGDIHYHDLDYSPFTTMANCCLIDFKNMFENGFKLGNAQVDSPKSIQTATAQASQ
FT                   IIANVASSQYGGCSFDRADEVLAPYAKLNYKKHLKDAQKWIDGAEKQEAYAREKTAKDI
FT                   YDAMQSLEYEINTLFTSNGQTPFVTVGFGLGDDWYAREIQKAILNVRIGGLGSEHRTAI
FT                   FPKLIFTLKRGLNLEVGTPNYDIKELALECSTKRMYPDILSYDKIVELTGSFKASMGCR
FT                   SFLQGWKDENGNDVTAGRNNLGVVTVNLPRIALEAAGNKEKFWEIFNERIEIAHDALAF
FT                   RVERAKEAQPKNAPILFMNGALGRLDAEGSVDELYNKERATVSLGYIGLYEVATTFYGP
FT                   TWENNPEAKAFTIEIVKRMHEDCEDWSKASGYHYSVYSTPSESLTDRFCRMDKEKFGSV
FT                   ADITDKDYYTNSFHYDVRKNPTPFEKLEFEKDYPVYANGGFIHYCEYPVLQQNPKALEA
FT                   VWDFAYDRIGYLGTNAPIDHCYACGFEGDFAATERGFKCPQCGNDDPKTCDVVKRTCGY
FT                   LGNPQARPMVHGRHKEISSRVKHMNGSVGALNDGNLIDSVEVDEAKSKYFAEK"
FT   gene            272670..273269
FT                   /gene="nrdG"
FT                   /locus_tag="L72609"
FT   CDS             272670..273269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="L72609"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO08.05 Salvage of nucleosides
FT                   and nucleotides"
FT                   /db_xref="EnsemblGenomes-Gn:L72609"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04372"
FT                   /db_xref="GOA:Q9CIT2"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIT2"
FT                   /protein_id="AAK04372.1"
FT                   /translation="MNNPKPGEWRADELSQNYIADYKPFNFVDGEGVRCSLYVSGCMFH
FT                   CEGCYNQATWSFRYGTPYTKELEDKIMADLAQPYVQGLTLLGGEPFLNTTFLIPLLKRI
FT                   RRELPDKDIWSWTGYTWEEMLLETDDKLEILDLLDILVDGRFELSKKNLMLQFRGSSNQ
FT                   RIIDVPKSRKQGQVVIWEKLNDGEKTFEQIHKEKLI"
FT   gene            complement(273378..273884)
FT                   /gene="ychC"
FT                   /locus_tag="L73386"
FT   CDS             complement(273378..273884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychC"
FT                   /locus_tag="L73386"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   weak homology to unknown Lactococcus lactis protein
FT                   gi4098083"
FT                   /db_xref="EnsemblGenomes-Gn:L73386"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04373"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIT1"
FT                   /protein_id="AAK04373.1"
FT                   /translation="MKTLLVLCEVKYWHDFREGLAKVGVSFLGFDKKKPNRFEIDQLVA
FT                   KADFVVMRNRNVAHHSVQFAKEACKATDTPFWISSNFGLETIIKQLSQTFPDESFESTD
FT                   ENKKSKRKIENRVIQKQNYLAESAQSKESQNYLKGKKKHLPLKSALKDFKITDDEPDFT
FT                   KLFKK"
FT   gene            274176..275444
FT                   /gene="enoB"
FT                   /locus_tag="L0008"
FT   CDS             274176..275444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="enoB"
FT                   /locus_tag="L0008"
FT                   /product="2-phosphoglycerate dehydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.09 Glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:L0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04374"
FT                   /db_xref="GOA:Q9CIT0"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIT0"
FT                   /protein_id="AAK04374.1"
FT                   /translation="MTVTIENIHAREIFDSRGNPTVEVDVRLTDGTLGRAAVPSGASTG
FT                   DREAVELRDGGDRLQGKGVSKAVANVNGEIYEALKGQSPFNQAKLDHLMIELDGTKNKS
FT                   RLGANAILGVSMAISRAAANSEKIPLYRYLGGVDLELPQPFFNVINGGVHADSGIDVQE
FT                   FLITPVKRESFRDGLEKIANIYHTLKKILADKGLETAVGDEGGFAPKLGSTENAIATLY
FT                   QAIESAGYVPGEEIAIAIDPASSEFYDDKEKVYRFEGQKLTSKELLTYYENLVEKYPAL
FT                   ISIEDGFSEHDWEGFAAQTKAQGQKIQLVGDDIFVTNPEIFKEGIKKGVANAILIKLNQ
FT                   IGTVTEAIEAISLARKAGYKTMISHRSGETVDSYIADFAVAMHAGQIKTGSMARSERVE
FT                   KYNQFLRIEEELGKDVALASFPG"
FT   gene            275743..276576
FT                   /gene="ychD"
FT                   /locus_tag="L75718"
FT   CDS             275743..276576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychD"
FT                   /locus_tag="L75718"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS General. There are 60 paralogs in L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L75718"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04375"
FT                   /db_xref="GOA:Q9CIS9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIS9"
FT                   /protein_id="AAK04375.1"
FT                   /translation="MNKILEVENLVFKYEKESDVNQLNGVSFSITKGEWVSIIGQNGSG
FT                   KSTTARLIDGLFEEFEGKVKIDGELLTAENVWNLRRKIGMVFQNPDNQFVGATVEDDVA
FT                   FGMENQGIPREEMIKRVDEALLAVNMLDFKTREPARLSGGQKQRVAVAGIIALRPEIII
FT                   LDESTSMLDPTGRQEIMRVIHEIKEKYQLTVLSITHDLDEAASSDRILVMKAGEIIKEA
FT                   APSELFATSEDMVEIGLDVPFSSNLMKDLRKNGFDLPEKYLSEDELVELLADKLR"
FT   gene            276762..277628
FT                   /gene="ychE"
FT                   /locus_tag="L76755"
FT   CDS             276762..277628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychE"
FT                   /locus_tag="L76755"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS General. There are 60 paralogs in L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L76755"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04376"
FT                   /db_xref="GOA:Q9CIS8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIS8"
FT                   /protein_id="AAK04376.1"
FT                   /translation="MIKFEKVNYTYQPNSPFASRALFDIDLEVKKGSYTALIGHTGSGK
FT                   STLLQHLNGLLQPTQGTVRVGDIVVTSTSKQKEIKPVRKKVGVVFQFPESQLFEETVLK
FT                   DVAFGPQNFGISKEEAEKIAAEKLEMVGLSKEFWEKSPFELSGGQMRRVAIAGILAMEP
FT                   EVLVLDEPTAGLDPKARIEMMKLFESIHQTGQTVVLVTHLMDDVADYADYVYLLEKGHI
FT                   ISCGTPSDVFQEVDFLKAHELGVPKATHFADQLQKTGVYTFEKLPITRAELVNLLTSLS
FT                   VKSGGEN"
FT   gene            277628..278428
FT                   /gene="ychF"
FT                   /locus_tag="L77627"
FT   CDS             277628..278428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="L77627"
FT                   /product="ABC transporter permease protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS General"
FT                   /db_xref="EnsemblGenomes-Gn:L77627"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04377"
FT                   /db_xref="GOA:Q9CIS7"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIS7"
FT                   /protein_id="AAK04377.1"
FT                   /translation="MQNMLMGRYIPGDSIIHRMDPRSKLLVMIAFVVIIFLAHDWLGYL
FT                   LLVLYTLAGVLLSKISVSYFLKGLRPMIGLILFTVIFQMLFTNGQHVIFSLWFIKISTE
FT                   SLINAVYIFFRFVLIIFMSTILTLTTPPLTLADGIEKGLGPLKKIKVPVHELGLMLSIS
FT                   LRFIPTLMDDTTMIMNAQKARGMDFGEGNLLKKIKSVIPILIPLFVSSFRRADDLAVAM
FT                   ESRGYQGGDGRTKYRQLKWKMRDSLLVVSIIIMTILLILWSKVS"
FT   gene            278452..279063
FT                   /gene="ychG"
FT                   /locus_tag="L78434"
FT   CDS             278452..279063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychG"
FT                   /locus_tag="L78434"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   a part of this protein is 30% identical to bacterocin
FT                   transport accessory protein Bta of Streptococcus
FT                   pneumoniae. Maybe a part of trasport system ychDEF"
FT                   /db_xref="EnsemblGenomes-Gn:L78434"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04378"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIS6"
FT                   /protein_id="AAK04378.1"
FT                   /translation="MITLNVNSLENAEIFWKELGLEDEVALNETYDPNPETLAISVETI
FT                   DEIHDKIIELGLPVSPITPAVDGRFMFSFIAPEDNTFIVIGEWVERPYTGEMRTEFFEN
FT                   VKGLIPLAPERLSELTEGQFVLFGRVTCPWTRRFVKALPDYADKMIYYVDTENTDLNPE
FT                   LQAIRKAHEVETVPTFMKRSADGTFIKFDKKKESLSEFIK"
FT   gene            279273..280043
FT                   /gene="ychH"
FT                   /locus_tag="L79267"
FT   CDS             279273..280043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychH"
FT                   /locus_tag="L79267"
FT                   /product="acetyltransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   similar to acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:L79267"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04379"
FT                   /db_xref="GOA:Q9CIS5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR013710"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR019873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIS5"
FT                   /protein_id="AAK04379.1"
FT                   /translation="MEAQKLSAQEIIQFIGNAEKKTRVKVTLSGMPSFKAAGFLAENGR
FT                   PNFKALANKGIQVLGDFHTHYSLKIIIGDWQAVRPLLSGLTENKDYTLELEGRNSAVPL
FT                   LDTREINARIEPGAIIRDQVTIGDSAVIMMGAIINIGAEIGEGTMIDMGAILGGRATVG
FT                   KNSHIGAGAVLAGVIEPASAEPVRVGDNVLVGANAVVIEGVQVGSGSVVAAGAIVTQDV
FT                   PENVVVAGVPARIIKEIDEKTQQKTALEDALRNL"
FT   gene            280180..281334
FT                   /gene="yciA"
FT                   /locus_tag="L80177"
FT   CDS             280180..281334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciA"
FT                   /locus_tag="L80177"
FT                   /product="amino acid amidohydrolase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.02 ENERGY METABOLISM
FT                   Amino acids and amines COMMENTS=35% identical to several
FT                   hippurate hydrolases and amino acid amidohydrolases. Can be
FT                   a peptidase."
FT                   /db_xref="EnsemblGenomes-Gn:L80177"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04380"
FT                   /db_xref="GOA:Q9CIS4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR023905"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIS4"
FT                   /protein_id="AAK04380.1"
FT                   /translation="MINLIEIRRQLHQIPEIGLEEYETQKYLLAIIQELTQNKPFIQVR
FT                   TWQTGILVYLAGSQSQKTIGWRTDIDGLPIEELTDLPYASKNGRMHACGHDIHMTVALG
FT                   LLEKMSESQPRDNLLFLFQPAEENEAGGKLMYDARAFENWLPDEFYGLHVRPDLKVGDI
FT                   ATNQHTLFAGTCEVELSFIGTGGHAAFPHTANDALVAAAYFITQVQTIVSRNVDPLASA
FT                   VVTFGKMEAGTTNNIIAERAFLHGTIRSLTQEVNELTQKRLRELANGIAQSFNMEIELK
FT                   LKQGGYLPVENHPKLAKELMEFFKKETKANLIDIAPAMTGEDFGYLLSKIPGVMFWLGI
FT                   DSDAPLHSQKMNPDEHVLNFSVDTISQFLQFKVNRLSEGEKTIN"
FT   gene            281456..282574
FT                   /gene="xynD"
FT                   /locus_tag="L81453"
FT   CDS             281456..282574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xynD"
FT                   /locus_tag="L81453"
FT                   /product="endo-1,4-beta-xylanase D"
FT                   /db_xref="EnsemblGenomes-Gn:L81453"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04381"
FT                   /db_xref="GOA:Q9CIS3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIS3"
FT                   /protein_id="AAK04381.1"
FT                   /translation="MKQRRLKSKGAKKAFWKLTLLIGALLIVVAGVGTYYYDQGVQKQK
FT                   IAYEKQVDEARNAKDKAYDSRKANDIEQAHKLIDKLHVKDKTSLDKSMSQLTNYLSEID
FT                   KVNQIVAKAHENISEEGIKSSEEALELLKAPYEKSDKEALAKQVNADKQILIERQKEAE
FT                   LIANVQNQYANKKLIALTFDDGPNPNTTPQLLKIFSDAQVPATFFALGKQAQACPQIIK
FT                   EEADRGNEVASHTWDHKDLVTLSPDQQKQEIESANQLINKITGKNVTLFRPPYGSYNKS
FT                   VLSQTNLSAVNWTVDTNDWRYRTSAPVVQNVSTYAHDGAIILMHDIHQWSVDAVPQIIK
FT                   NLKAQGYTFVTVSTLLTVQDGGAKAQQVYFGR"
FT   gene            283758..284369
FT                   /gene="rpsD"
FT                   /locus_tag="L0381"
FT   CDS             283758..284369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="L0381"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:L0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04382"
FT                   /db_xref="GOA:Q9CIS2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIS2"
FT                   /protein_id="AAK04382.1"
FT                   /translation="MSRYTGPSWKQSRRYGISLSGSGKEIARRNYVPGQHGPNNRSKLS
FT                   EYGLQLAEKQKLRFSYGLSERQFRNLYIAATKVKEGTVGFNFMTLLEQRLDNVVFRLGL
FT                   ATTRRQARQFVNHGHILVDGKRVDIPSFRVQPGQVISVREKSMKVPAILEAVEATKGRA
FT                   NFVSFDADKLEGTLVRLPERDEINPEINEALIVEFYNKMM"
FT   gene            284496..286634
FT                   /gene="yciC"
FT                   /locus_tag="L84502"
FT   CDS             284496..286634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciC"
FT                   /locus_tag="L84502"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL
FT                   COMMENTS=best score with ydcI of B.subtilis, has S1 motif,
FT                   has homology with tex (toxin expression regulator) genes"
FT                   /db_xref="EnsemblGenomes-Gn:L84502"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04383"
FT                   /db_xref="GOA:Q9CIS1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023097"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIS1"
FT                   /protein_id="AAK04383.1"
FT                   /translation="MENVKKIAELLNIKNSQVEKVLELTAEGNTVPFIARYRKEATGSL
FT                   DEVEIKKIIDEDNLLTKLSERKTAVLSKIEELGKLTDSLKAQILAAEKLTEVEDLYLPY
FT                   KEKRRTKATIAKENGLFPLAQLIVKNSANLEEEAEKFVNENFTSPQKALEGAVDILSEA
FT                   ISEDARLRSWLTGEIKNNSLLTSSLKKDAVDEKQVFQMYYEFSEKVSELPNYRVLALNR
FT                   GEKLGILSVKFENNEDKILRYFAARFAAQNNPMMQVAIKDAVKKKLIPAMERSIRTELT
FT                   EKAEASAIEVFGENLKNLLLVAPLKGRVVMGFDPAYRTGAKLAIVDETGKLLMTTVIYP
FT                   VKPANAGQIAQAKKDLAKFIREYGVNMIAIGNGTASRESESFVAEVLKENNFSDVYYVI
FT                   VSESGASVYSASELAREEFPELTVEKRSAISIARRLQDPLAELVKIEPKAIGVGQYQHD
FT                   VSEKKLTENLDFVVETVVNQVGVNVNTASPSLLSHVAGLNKSLAQNVVKYREENGALKT
FT                   RAELKKVPRLGAKAFEQAAGFLRIPEGKNFLDNTGVHPESYKVTEQLLAEISADKPVSN
FT                   EELLTKLSSVNIPEMAEKLGLGQETLTDIINDLQKPGRDLRDSFDAPILRQDVLSAGDL
FT                   QIGQQLEGVVRNVVDFGAFIDIGIKNDGLAHVSDLSKSFVKNPSDVVAVGQIVTVWVKS
FT                   LDLQRGKINLTLVNPREK"
FT   gene            286731..287174
FT                   /gene="yciD"
FT                   /locus_tag="L86677"
FT   CDS             286731..287174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciD"
FT                   /locus_tag="L86677"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL
FT                   COMMENTS=probably adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:L86677"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04384"
FT                   /db_xref="GOA:Q9CIS0"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIS0"
FT                   /protein_id="AAK04384.1"
FT                   /translation="MLTNQELTAKVKEISLTYFKQSFDHEAKWNQRLRTTGGRFFPKDL
FT                   HLDFNPKMAELKDFEGVILHELTHYHLYRSKRGYKHRDADFKRLLSQVGGLRYAPSVID
FT                   KKIKYYYSCQNCGQLYPRQRKIDTKKYRCGKCRGKLILKTSGN"
FT   gene            287447..288505
FT                   /gene="add"
FT                   /locus_tag="L87453"
FT   CDS             287447..288505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="L87453"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="EVIDENCE BY HOMOLOGY BIO08.05 Salvage of nucleosides
FT                   and nucleotides"
FT                   /db_xref="EnsemblGenomes-Gn:L87453"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04385"
FT                   /db_xref="GOA:Q9CIR9"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIR9"
FT                   /protein_id="AAK04385.1"
FT                   /translation="MKKKREKLVLKSEIIAQMPKVELHCHLDGSLSLSVIKELAKNAGI
FT                   HMTMSDEEILEKAQAPENTKNLLEYLQRFDFVLPLLQTYKNLELAAYDVVRQAANDNIK
FT                   YIEIRFAPSQHLLENLTLEEAVEAVIAGLSRAENDFDIRANALVCGLKQEPIQKLQKLL
FT                   PLFDKIPDEHLVGFDMAGDELNYPQEKFVDLIHDIKIKGVNVTLHAGECPACEKNILDS
FT                   IAMGASRIGHGIMTKNLSEAEQKMMIEKQIVLEMAPTSNFQTKAVTELAQYPFKELYDK
FT                   GIHVTLNTDNRMVSATNLSKEYEKISAWYPDFSLSDFEKINHYAIDGAFIGQEEKEELH
FT                   QRFTKEYKKISE"
FT   gene            complement(288537..288755)
FT                   /gene="yciF"
FT                   /locus_tag="L88546"
FT   CDS             complement(288537..288755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciF"
FT                   /locus_tag="L88546"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L88546"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04386"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIR8"
FT                   /protein_id="AAK04386.1"
FT                   /translation="MAGTTIVTYSSNHNGSINFYKDPNHYQDERYLKDSAWVKEESRKL
FT                   LDSSQTLAIPTSFDEQAAQIISKIEIK"
FT   gene            complement(288792..289205)
FT                   /gene="yciG"
FT                   /locus_tag="L88801"
FT   CDS             complement(288792..289205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciG"
FT                   /locus_tag="L88801"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L88801"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIR7"
FT                   /protein_id="AAK04387.1"
FT                   /translation="MENKSYEKTILWSATFLSLFALAACSNSKSSENQTKKENTSSSKV
FT                   TSSSKTSNGKNSATHSTNTSPSSSQANTNNSEKVQKSSSPLSGYSAEQVEYARVTETLL
FT                   SYYKYDYQPVSISVTKNGANHQVFPFSGSVVVP"
FT   gene            complement(289409..291091)
FT                   /gene="yciH"
FT                   /locus_tag="L89418"
FT   CDS             complement(289409..291091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciH"
FT                   /locus_tag="L89418"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.General"
FT                   /db_xref="EnsemblGenomes-Gn:L89418"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04388"
FT                   /db_xref="GOA:Q9CIR6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIR6"
FT                   /protein_id="AAK04388.1"
FT                   /translation="MPKQLKIKADEVAVYAIGGLGEIGKNTYGVEYKDEIIIIDAGIKF
FT                   PEDDLLGVDYVIPDYTYIVENIDRIKGLFITHGHEDHIGGIPFLLKQANIPIYAGPLSL
FT                   ALIRGKLEEHGLLRDAKLYEIHADSVIKFNHLSLDFFRTTHSIPEPLGIVVNTPQGKIV
FT                   ATGDFKFDFTPVGEPADLHRMAELGSEGVLLLLSDSTNAEIPTFSHSEKVVGASIMKIF
FT                   ERIEGRIIFASFASNIFRLQQAVDGAVKTGRKIVVFGRSMEKAIVNGLELGYIKAPKGT
FT                   FIEPNEVNQYASHELLIMCTGSQGEPMAALSRIANGMHRHITLQMGDTVVFSSNAIPGN
FT                   THGVNQLINKIAEAGVEVIYGKMNNIHTSGHGGQQEQKLMLRLIKPKYFMPVHGEYRML
FT                   KIHAGLAQDTGVPKENCFIQENGDVLALTADSARYADHFPASDTYVDGSGIGDVGNAVL
FT                   HDRHELSEDGIVLAVATVDFEKKTVLAGPDMLSRGFIYMRESGDLIRSGQRVLFNAIRE
FT                   AMHEENANEASVARAMREALSPFLYKQTERSPLVVPMIMTPDE"
FT   gene            complement(291264..291494)
FT                   /gene="ycjA"
FT                   /locus_tag="L91273"
FT   CDS             complement(291264..291494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycjA"
FT                   /locus_tag="L91273"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTETICAL. homology
FT                   with ykzG Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L91273"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04389"
FT                   /db_xref="InterPro:IPR009907"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIR5"
FT                   /protein_id="AAK04389.1"
FT                   /translation="MIFKVFYQKDNTRSPRRETTEALYLDLDVATKEEGVILARELLAK
FT                   NTAYHVEFIDSLSDESVEYEKETGVFEITSF"
FT   gene            291804..292529
FT                   /gene="ycjB"
FT                   /locus_tag="L91807"
FT   CDS             291804..292529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycjB"
FT                   /locus_tag="L91807"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.General"
FT                   /db_xref="EnsemblGenomes-Gn:L91807"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04390"
FT                   /db_xref="GOA:Q9CIR4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIR4"
FT                   /protein_id="AAK04390.1"
FT                   /translation="MKILAFDSSSKALSVAVVADGILLGEVTLNLKKNHSTTLMTSIDF
FT                   LMAQVGLEAKELDRIAVAQGPGSYTGLRLSATVGKTLAFSLNKELVGLSSLLAIANRVQ
FT                   DKNAYVLPIIDARRGNAYAALYKNGQQIIADQHCNFSEFLADLSEKVSSFEQIIFTGET
FT                   DNFVEAIQNAGFSEEQIISDSLEKLPSAYEIAKIAEKLAPENVHAFVPNYLKKVEAEEK
FT                   WLESHEKAENTPDDYVQRV"
FT   gene            292483..293052
FT                   /gene="ycjC"
FT                   /locus_tag="L92414"
FT   CDS             292483..293052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycjC"
FT                   /locus_tag="L92414"
FT                   /product="acetyltransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.05 Ribosomal proteins:
FT                   synthesis and modification COMMENTS=35% identical to
FT                   several putative ribosomal-protein-alanine
FT                   N-acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:L92414"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04391"
FT                   /db_xref="GOA:Q9CIR3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIR3"
FT                   /protein_id="AAK04391.1"
FT                   /translation="MKKLKTLLTTTFKGFSGKKFNPRRYLEMADIELEHDREGVHYRLA
FT                   DRVDIVALLAIERDVYNGDIPWTFSHFEHEIVKNDEAFFIVAEISGSVIGFIGTRINHH
FT                   GQDAHITNLAVFKAFQGQQIASTLIEQLIVLMSALGKNEMTLEVRRDNTKAQGLYRRQG
FT                   FVTDKLLPEYYEDGADAIWMIKKLKK"
FT   gene            293057..293527
FT                   /gene="ycjD"
FT                   /locus_tag="L93051"
FT   CDS             293057..293527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycjD"
FT                   /locus_tag="L93051"
FT                   /product="acetyltransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.05 Ribosomal proteins:
FT                   synthesis and modification. 35% identical to different
FT                   ribosomal-protein-alanine acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:L93051"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04392"
FT                   /db_xref="GOA:Q9CIR2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIR2"
FT                   /protein_id="AAK04392.1"
FT                   /translation="MKLKHLSYFEEKLEDKKYFPTIENLSAQIYELLSLAYEESPWTRA
FT                   YILADINNENSDYFFLEEEGQIGGLLAISTIMDELEITNIAIHPDFQGQGLASFLLTEV
FT                   STFSGTLFLEVRKSNLAAQKCYEKFGFKIYHTRKNYYDKPLEDALLMRKEQF"
FT   gene            293530..294570
FT                   /gene="gcp"
FT                   /locus_tag="L93500"
FT   CDS             293530..294570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="L93500"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.02 Degradation of
FT                   proteins, peptides, and glycopeptides. 45% identical to
FT                   several sialoglycoprotein endopeptidases from different
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:L93500"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04393"
FT                   /db_xref="GOA:Q9CIR1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIR1"
FT                   /protein_id="AAK04393.1"
FT                   /translation="MKDNYILAFETSCDETSVAILKNGNELLCNIIASQINSHKRFGGV
FT                   VPEIASRHHVEQITVCIEAALEEAEISADQLTAVAVTEGPGLNGALLVGIMAAKTFAWA
FT                   NHLPLIPVNHMAGHLMAASLVDTIEYPAMALLVSGGHSELVYVEKEGSYKKVGETRDDA
FT                   AGEAYDKVGRVMGLTYPSGKVIDELAHKGADTYNFPRAMMNTHEVEFSFSGLKSAFINL
FT                   VHNENQKGNDVIADDLENLAASFQAAVVDVLMAKTKLAMEKYPVKTLIIGGGVSANQGL
FT                   RERLSAEITDEKLIIPPLRLCGDNAGMIAAAAYIEWKKGLENVQAGLDLNAKPSLVFED
FT                   IEEGEV"
FT   gene            294570..294770
FT                   /gene="ycjF"
FT                   /locus_tag="L94552"
FT   CDS             294570..294770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycjF"
FT                   /locus_tag="L94552"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci. There are two
FT                   paralogs in L.lactis, also yneC."
FT                   /db_xref="EnsemblGenomes-Gn:L94552"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04394"
FT                   /db_xref="InterPro:IPR027879"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIR0"
FT                   /protein_id="AAK04394.1"
FT                   /translation="MMKLIGKLQNGMTFTEEFDGVNDFLALQQSDYNAIADEIEVVEVK
FT                   IADEVLDFKGNMGQLYYELMK"
FT   gene            complement(294964..295101)
FT                   /gene="ycjG"
FT                   /locus_tag="L94973"
FT   CDS             complement(294964..295101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycjG"
FT                   /locus_tag="L94973"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L94973"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04395"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIQ9"
FT                   /protein_id="AAK04395.1"
FT                   /translation="MTTAYLLLGNDKSLETPAGLPIGKIFAYKEMEKLWLKKSSSDSWQ
FT                   "
FT   gene            complement(295201..295989)
FT                   /gene="ycjH"
FT                   /locus_tag="L95210"
FT   CDS             complement(295201..295989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycjH"
FT                   /locus_tag="L95210"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 38%
FT                   identical to a protein from Enterococcus faecalis."
FT                   /db_xref="EnsemblGenomes-Gn:L95210"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04396"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIQ8"
FT                   /protein_id="AAK04396.1"
FT                   /translation="MKNLTFTVSMSDLGLEIRLPSTAFLRIFDQNNARFDLQNDELFFL
FT                   LKKGQIKMIANDLKLIPKLEFDKVVILNMAAYDLELEYLTQYLVNLAEEAGIILRDKAE
FT                   PIKITSNIEKACATSADEFLTALTAFGIKLEKKKAFSPKAQHRWKKGLSEVEFFVNRSD
FT                   SKATIIWEKSNQLVIKAGAKISESGGMKSDGTPGLAYRFTQTLREEQKANWDAKTFTTT
FT                   EDIVLKSVNEVGHFLYFAGTNSWLQLVDKEGRTIHELSVV"
FT   gene            296289..297338
FT                   /gene="ycjI"
FT                   /locus_tag="L96217"
FT   CDS             296289..297338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycjI"
FT                   /locus_tag="L96217"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 31%
FT                   identical to a protein from Staphylococcus aureus. Homologs
FT                   not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L96217"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04397"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIQ7"
FT                   /protein_id="AAK04397.1"
FT                   /translation="MKKTSKKVIGLTASALIAVSLLAACGNSSSASKSDSKTISNLKIS
FT                   FIPSKNPDDITTATKPIANILKSELKKQGYTVKNIDTSVGTNYQAVGEGLDAGSVDVGY
FT                   GMSATTYAMYQDGSTPLLMATRKGLSNDGSDSAKYWNEHKPTTKTDKEVTSYSSLIIAG
FT                   NSPMGKKLAKEANDGTLTWKDLNDAKWGLESTSSAAGYMYPSQWLTENFKHSIRDLKNT
FT                   VTMDSYDSAMAQLASGQIDVMPEYADARMDDAAKWTTTFGAKESIWDDTNVIGVTPAIA
FT                   NDGIMVSEKSKIMTADFKKALSAAIKDMAKTDEGKKVIAIYSHDGYVDSTKADYKTAIK
FT                   VANSMSKAN"
FT   gene            297457..298197
FT                   /gene="phnC"
FT                   /locus_tag="L97415"
FT   CDS             297457..298197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnC"
FT                   /locus_tag="L97415"
FT                   /product="phosphonate ABC transporter ATP-binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.03 TRANSPORT AND BINDING
FT                   proteinS. Anions. There are 60 paralogs in L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L97415"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04398"
FT                   /db_xref="GOA:Q9CIQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIQ6"
FT                   /protein_id="AAK04398.1"
FT                   /translation="MIKFENVSKIYPNGTKGLTDVNLQINQGEFVAIIGTSGAGKSTLI
FT                   RCVNGLNDITSGSLIVNDTEVSKLKGKELRKFRRHVGMIFQSYNLVPRVTVLKNVMFAR
FT                   VPDMSLFKVIFGLFSKEDKLVALDSLNKVGILDKAYIRADQLSGGQQQRVSLARALSQE
FT                   SEILLADEPVSALDPVTAKEVMDDFKRINEEFNKTILLNIHHVELALEYASRIIAVKKG
FT                   KIVYDGPSQEVTKEILDEVYRKEA"
FT   gene            298198..299010
FT                   /gene="phnB"
FT                   /locus_tag="L98204"
FT   CDS             298198..299010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnB"
FT                   /locus_tag="L98204"
FT                   /product="phosphonate ABC transporter permease protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.03 TRANSPORT AND BINDING
FT                   proteinS. Anions"
FT                   /db_xref="EnsemblGenomes-Gn:L98204"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04399"
FT                   /db_xref="GOA:Q9CIQ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIQ5"
FT                   /protein_id="AAK04399.1"
FT                   /translation="MYDKIFKPKKIKLITGEVVEEKVSRTWLTWLIIILLIAFSVILTN
FT                   FDFSALSRSGLFFQKLASMIPPNWAYFHKVLPPLLDTIKMSFFASLLGAILSVPFAILA
FT                   ANNILKNRFGNGIIRLIFMLARTLPTLVLALIATYIFGLGTFAGVVAIFVFTFSFIGKQ
FT                   LFEVIETVDMGPFEAAEALGVSPLKAFFIAVFPQVLPTYLSTALYAFEGNVRYAAILGY
FT                   VGAGGIGNILNDRVNFRDFSSVGMILISILATVMIIDSISALIRKKIA"
FT   gene            299025..299834
FT                   /gene="phnE"
FT                   /locus_tag="L99004"
FT   CDS             299025..299834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE"
FT                   /locus_tag="L99004"
FT                   /product="phosphonate ABC transporter permease protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.03 TRANSPORT AND BINDING
FT                   proteinS. Anions"
FT                   /db_xref="EnsemblGenomes-Gn:L99004"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04400"
FT                   /db_xref="GOA:Q9CIQ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIQ4"
FT                   /protein_id="AAK04400.1"
FT                   /translation="MNSQIIEEYNHRPKNWFYYLLIFIVLLAVSIWSTSVVHYHGVSEH
FT                   GALIAKNIFTGIFHPDTSLMFNLTETGLPYLLLQTFAIGLLGTLVGAIVAIPLSFLAAT
FT                   NLVPNWLAYLIRFVLMAIRTIPSFVYALLFIPVVGLGSSAGVMALGFESIGMIAKLFIE
FT                   AIEDLDMGVIEAMDAAGATTFQKIRFGVLPQLLPDLYSILLYRLDMNLRDAAILGLVGA
FT                   GGIGAPLSFAMSGYKWSAVGAILLGLLVLIILVELISSRIRKKLAKG"
FT   gene            299840..301399
FT                   /gene="ycjM"
FT                   /locus_tag="L99798"
FT   CDS             299840..301399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycjM"
FT                   /locus_tag="L99798"
FT                   /product="phosphatase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO08.02 Nucleotide and
FT                   nucleoside interconversions. similar to nucleotide
FT                   phosphodiesterases and UDP-sugar hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:L99798"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04401"
FT                   /db_xref="GOA:Q9CIQ3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIQ3"
FT                   /protein_id="AAK04401.1"
FT                   /translation="MKIRILETSDLHGFVLPTNFTEREMNLPFSMAKAKSKIDELTAVA
FT                   QEQGEIIVKIENGDLLQGSPLAYYLAKKSSRGIKDLVNVTNSFGYDVGLLGNHEFNYGI
FT                   DYLKSYVNQVNYPILAANVLNNEGQPAFGPAYKIIEAQGVKIGIVGFLTQYIPHWEKPS
FT                   IIKDLTFQSILTTAKDILPDLRQSVDLLIVAYHGGFERDLQTGLPTESLTGENEAYQLV
FT                   EEYKDYIDALVTGHQHREIADHLFGVPVIQPGYRGAFVGEIELELDNHKKVVASNARLH
FT                   KTENCKVSSEVNQLISVVSEEAEDWLDQPMGEVHGEMIIRDPMTARLIEHPYIELINKI
FT                   QMEATGTEISGTALFNNEAKGFAKEISMRSILTNYIYPNTLAVLRVTGADLKAALERTA
FT                   EHLELDKSGEIVFSPRFIEPKPEYYNYDMYEGVEYAINLQKEIGQRIVRLNFKGHQVKD
FT                   DEILEIVVNQYRAVGGGNYPMFSADKIVREITVDMTELIADYLKKHPIIEASVNHNFTV
FT                   LK"
FT   gene            301726..302208
FT                   /gene="tpx"
FT                   /locus_tag="L101699"
FT   CDS             301726..302208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpx"
FT                   /locus_tag="L101699"
FT                   /product="thiol peroxidase"
FT                   /EC_number="1.11.1.-"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.01 Adaptations and
FT                   atypical conditions. HAS ANTIOXIDANT ACTIVITY. COULD REMOVE
FT                   PEROXIDES OR H(2)O(2). BELONGS TO THE TPX/TAGD FAMILY"
FT                   /db_xref="EnsemblGenomes-Gn:L101699"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04402"
FT                   /db_xref="GOA:Q9CIQ2"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIQ2"
FT                   /protein_id="AAK04402.1"
FT                   /translation="MPMNITSHGEKIATLNPPISGDAPDFELTDLKGNKIKLSKLEKPV
FT                   LISVFPDINTRVCSLQTKHFNLEAAKHSEIDFLSISNNTADEQKNWCATEGVDMTILAD
FT                   DGTFGKAYGLILNGGPLEGRLARSVFVVKNGQIVYSEVLSELSDEPNYEKALAATK"
FT   gene            302381..304921
FT                   /gene="pepN"
FT                   /locus_tag="L102360"
FT   CDS             302381..304921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="L102360"
FT                   /product="aminopeptidase N"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:1352755 BIO12.02
FT                   Degradation of proteins, peptides, and glycopeptides"
FT                   /db_xref="EnsemblGenomes-Gn:L102360"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04403"
FT                   /db_xref="GOA:Q9CIQ1"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIQ1"
FT                   /protein_id="AAK04403.1"
FT                   /translation="MAVKRLIETFVPENYKIFLDIDRKTKKIKGQVAITGEAKDSVIAF
FT                   HAKGLHFSKVRAFSVDTNFIENEEDEEIVVKIGETGRVTVSFEYEAELTDNMMGIYPSY
FT                   YEVNGEKKMLIGTQFESHFARQAFPSIDEPEAKATFDLSVKFDEEEGDIIVSNMPELLN
FT                   INGIHVFERTVKMSSYLLAFVFGELQFKKGKTKSGVEVGAFATKDHSEAALDFPLDIAI
FT                   RSIEFYEDYYKTPYPLPHSWHIALPDFSAGAMENWGCITYREVCMLVDPENATIQSKQY
FT                   VATVIAHELAHQWFGDLVTMQWWDDLWLNESFANNMEYVCMDALEPSWNVWESFSISEA
FT                   NMALNRDATDGVQSVHVEVTHPDEIGTLFDPAIVYAKGSRLMVMLRKWLGDEDFAAGLA
FT                   LYFKRHQYGNTVGDNLWDALAEVSGKDVAAFMHSWVNQPGYPVVTAEVIDDTLVLSQKQ
FT                   FFVGEGADKGRLWNVPLNTNWSGLPDLLSSEKVEIPGFAALKAKNDGKALFLNDANMAH
FT                   YIIDYKGQLLTDLLSEVETLENVTKFQILQDRKLLAKAGVISYADVVNILPAFTNEESY
FT                   LVNTGLSQLISELELFVDEDSETEKAFQSLVGKLFAKNYARLGWDKVAGESAGDESLRG
FT                   IVLSKTLYAENADAKAKASQIFAAHKENLAGIPADIRPIVLNNEIKTTNSAELVKTYRE
FT                   TYVKTSLQEFKRELEGAVALIKDEKVIAELLESFKNADIVKPQDIAFSWFYLLRNDFSQ
FT                   DAAWAWEKANWAFLEEKLGGDMSYDKFVIYPGNTFKTADKLAEYKAFFEPKLENQGLKR
FT                   SIEMAIKQITARVALIDSQKADVDKSIKEISEKL"
FT   gene            complement(304960..306153)
FT                   /gene="napC"
FT                   /locus_tag="L104969"
FT   CDS             complement(304960..306153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napC"
FT                   /locus_tag="L104969"
FT                   /product="multidrug-efflux transporter"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.08 Multidrug resistance.
FT                   49% identical to NapC protein from Enterococcus hirae.
FT                   Similar to many tetracycline resistance efflux proteins of
FT                   class H."
FT                   /db_xref="EnsemblGenomes-Gn:L104969"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04404"
FT                   /db_xref="GOA:Q9CIQ0"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIQ0"
FT                   /protein_id="AAK04404.1"
FT                   /translation="MKINKHALTFGLITTFLTGLGFTIISPVVPFMVAPFANAHDQALI
FT                   VTSLMAIYALCTFFAAPALGSLSDRFGRKPILLISLAGSALGYLIFGLAGSLWMLFLGR
FT                   IIDGLTGGNIVTLFAYFADITDEENRTKVFGWTAAAVGVGTISGPTVGGLLAHFGNSVP
FT                   FYFGALISIANLLYGAFVMNESLPETHRTRNFSLKQLNPFTQLFQLLRMKNLNRLLFAG
FT                   ILLWLPNGALQAIISQFSLDSFAWTPVLIGLAISIMGLMDILTQIFIMPRLLKLANEDK
FT                   LIRLALVCEIIAYLLFALSAFSKMWPFFILAMFIFAFGDSIFGTAFNGKLSKSATSSEQ
FT                   GKLQGGSQALQALTRVIGPLIGGQIYISLGHFAPALMGFIFLIIALLVLSKTKSDQE"
FT   gene            complement(306480..306959)
FT                   /gene="napB"
FT                   /locus_tag="L106489"
FT   CDS             complement(306480..306959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napB"
FT                   /locus_tag="L106489"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   39% identical to NapB protein of Enterococcus hirae"
FT                   /db_xref="EnsemblGenomes-Gn:L106489"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04405"
FT                   /db_xref="GOA:Q9CIP9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIP9"
FT                   /protein_id="AAK04405.1"
FT                   /translation="MIMTNLQQNQEQIMTSLTDLFNKIDAYYKPQMEAEFSNISLSEIE
FT                   TIEFIAKTPYPNVTKLAHHLYMTRGAASKIAKKLLKKNLVESYQIPQNKKEIYFRLTKE
FT                   GQEINDRHESLHQKFSEKDQVIFDELTDESVSNILKFLNKYNNHLDSAIRNNIEK"
FT   gene            complement(306956..308233)
FT                   /gene="ydaE"
FT                   /locus_tag="L106965"
FT   CDS             complement(306956..308233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaE"
FT                   /locus_tag="L106965"
FT                   /product="cation transporter"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.05 TRANSPORT AND BINDING
FT                   proteinS Cations. similar to several cation efflux system
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:L106965"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04406"
FT                   /db_xref="GOA:Q9CIP8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIP8"
FT                   /protein_id="AAK04406.1"
FT                   /translation="MAASSTNNLKLAEKGVWVSIIAYIVLSIGQIAFAAIVHSSALQAN
FT                   GFNNVTDIMGNIAILIGLRLARIPADSDHVYGHWKIESIASLISSFIMFFVGFEVLRET
FT                   VMTLLSGKEEAIDPLGALVGLFSAFVMLGVYLYNRALAKKTNSQALSAASKDNLSDAVT
FT                   SIGTVVAILASSVGWEWLDTAMAVVICGFILKTAYDIFHESVFSLSDGFDENLVEEYRE
FT                   AICLVPKVKGVKLVRGRSYGSNIFLDVVVEMSPDLSVFESHEATEFIEKMLIDNYGVYD
FT                   VDVHVEPAALPEEEHYASRSLELLAKEEQFLNLENLDKLTDSTFQEILADGKIISASDK
FT                   LIDFAKITDENSVSKNNNSKNSLTSLSVIPLAINHYSSSQVSKKTFILTYDYWKNEQNF
FT                   VVTSIWRRNDYWRCIYRQTTLKREEK"
FT   gene            308509..308859
FT                   /gene="ydaF"
FT                   /locus_tag="L108503"
FT   CDS             308509..308859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaF"
FT                   /locus_tag="L108503"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:L108503"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04407"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIP7"
FT                   /protein_id="AAK04407.1"
FT                   /translation="MAEIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMEL
FT                   NEATLYTIFKRLEKDGIISSYWGDESQGGRRKYYRLTEIGHENMRLAFESWSRVDEIIE
FT                   NLEANKKDESNK"
FT   gene            309171..310892
FT                   /gene="ydaG"
FT                   /locus_tag="L109162"
FT   CDS             309171..310892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaG"
FT                   /locus_tag="L109162"
FT                   /product="ABC transporter ATP binding and permease protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS. General. There are 60 paralogs in L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L109162"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04408"
FT                   /db_xref="GOA:Q9CIP6"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIP6"
FT                   /protein_id="AAK04408.1"
FT                   /translation="MKHKWVALFSIVSTFIYAGVQLYQPQIMKRIMTVMSSTTYSRHQM
FT                   ADKVSGYGVELLVVAGIGIIFAIFSTLSAARIAQEIGADVREATYKKINTFSYENIEKF
FT                   NAGNLVVRMTNDVTQVQNLMMMVFQILMRIPVLLIGAVVLSITTLPRLWWITVLLIVLI
FT                   VLVTAVLMGRMGPHFMAFQKLMDRINAIAKQNLRGSRVVKSFVQEKNQIKDFDETSDEL
FT                   YDHNWAVGKLFSAMIPLFTVIAQGVIWLAIYFVSTFVTESTTVAQDSIGGIATFMTYMG
FT                   MIMFAIIMGGMISMFASRGMVSIGRINEVLNTDPAMKFDENAKDEVLSGSVKFDHVSFS
FT                   YPNDEEPTLKDISFEVEPGQMVGIVGATGAGKSTLAQLIPRLFDPTEGTVSVGGKDLKT
FT                   VSRGTLKKNISIVLQKAILFSGTIAGNIKQGKADATDEEMTRAARIAQAAEFITTKDGQ
FT                   YDSEVEERGNNFSGGQKQRLSITRGVVKNPNVLILDDSTSALDAKSEKLVQEALNKDLK
FT                   DTTTIIIAQKISSVVHADNILVLDQGKLVGQGTHQELVAENKIYQEIYDTQKAQED"
FT   gene            310896..312890
FT                   /gene="ydbA"
FT                   /locus_tag="L110899"
FT   CDS             310896..312890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbA"
FT                   /locus_tag="L110899"
FT                   /product="ABC transporter ATP binding and permease protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS. General. There are 60 paralogs in L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L110899"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04409"
FT                   /db_xref="GOA:Q9CIP5"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIP5"
FT                   /protein_id="AAK04409.1"
FT                   /translation="MENTKSTRKMSDTTRAIRFFYLYLKRYKLQFAVIMIFIILATWLQ
FT                   VVSPSLLGDAITNLTKYVTDFFTHQHAGQSQDALQQIAQQLSQQMHQTVDWHNVPEVVK
FT                   SLPQAAQDQITANLPKGTTLETLKTVATSHAASTSTFMKGMWQLLAVYVATGVSMLIYT
FT                   LLFSRIVAHSTNRMRKGLFGKLERLTISYFDRHQDGDILARFTSDLDNIQNTLNQALVS
FT                   VISNAAVFVGVIIQIFNKDVTFAWLTVAASPVAILSAVIIIRQSKKATDKQQEEVSQLN
FT                   AYMDEKISGQKAIIVEGLQEDSINGFLEHNENVKKRTFAAQAWSGMIFPLMNGFQLLSI
FT                   AIVIFGGTAYVLNDDSMSIATGLGLLVAFVQYVQSYYNPIMQISSNFGQLQLAITGATR
FT                   LNVMFDEPEEVRPENGKKFDTIKDGIQIENLDFEYLPGKPVLKKVNIDVKKGQMVALVG
FT                   PTGSGKTTVMNLMNRFYDVNGGAIKFDGTDIREFDLDSLRSNVGIVLQESVLFDGTIAD
FT                   NIKFGKPNATQEEIETVAKTTHIHDFIDSLPDKYETHVSDDESVFSVGQKQQISIARTI
FT                   LTNPELLILDEATSNVDTVTEQQIQWAMEAAIAGRTSFVIAHRLKTILNADKIVVLKDG
FT                   EVIEEGNHHELVAQGGFYSELYHNQFVFE"
FT   gene            313067..314332
FT                   /gene="murA1"
FT                   /locus_tag="L113067"
FT   CDS             313067..314332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA1"
FT                   /locus_tag="L113067"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.02 Murein sacculus and
FT                   peptidoglycan. CELL WALL FORMATION. ADDS ENOLPYRUVYL TO
FT                   UDP-N-ACETYLGLUCOSAMINE. FIRST COMMITTED STEP IN
FT                   PEPTIDOGLYCAN BIOSYNTHESIS. There is another homologous
FT                   gene murA2"
FT                   /db_xref="EnsemblGenomes-Gn:L113067"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04410"
FT                   /db_xref="GOA:Q9CIP4"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIP4"
FT                   /protein_id="AAK04410.1"
FT                   /translation="MKKIVINGGKRISGTIPISGAKNSVVALIPATILANDVVTLEGVP
FT                   DISDVASLVEIMEIMGAKIERNLEEGRLVIDTRSVVSRPLPYGKINSLRASYYFNGALL
FT                   GRFGQATVGLPGGCDLGPRPTDLHDKAFKALGAKKIQEEEAEHLEVIGDSLVGTTIYMD
FT                   VVSVGATINTMLAASRAKGLTIIENAAREPEIIDVATLINNMGAQVRGAGTDIIRITGV
FT                   DEMHGAQHTVIPDRIEAGTYLALAAAMGDGVIIENVIYEHLESFIAKLEEMGVGLTIRE
FT                   DSIEVHKSENLKSVNITSVPYPGFATDLQQPITPLLLKAKGRGSIVDTIYQKRVNHVPE
FT                   LARMGANISVLDDRIIYDAPNELTGSCVQATDLRAGAALVTAGIIASGTTKISNIEFIL
FT                   RGYDHIIEKLTAVGVDIQLIEE"
FT   gene            314378..314596
FT                   /gene="ydbC"
FT                   /locus_tag="L114363"
FT   CDS             314378..314596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbC"
FT                   /locus_tag="L114363"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL"
FT                   /db_xref="EnsemblGenomes-Gn:L114363"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04411"
FT                   /db_xref="GOA:Q9CIP3"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="PDB:2LTD"
FT                   /db_xref="PDB:2LTT"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIP3"
FT                   /protein_id="AAK04411.1"
FT                   /translation="MADKLKFEIIEELIVLSENAKGWRKELNRVSWNDAEPKYDIRTWS
FT                   PDHEKMGKGITLSEEEFGVLLKELGNK"
FT   gene            complement(314623..314979)
FT                   /gene="ydbD"
FT                   /locus_tag="L114632"
FT   CDS             complement(314623..314979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbD"
FT                   /locus_tag="L114632"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. 28% identical
FT                   to a protein from Enterococcus faecalis."
FT                   /db_xref="EnsemblGenomes-Gn:L114632"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04412"
FT                   /db_xref="InterPro:IPR024515"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIP2"
FT                   /protein_id="AAK04412.1"
FT                   /translation="MFIKVLMALYPLIVFIALVFIFKFFRLRHLTNRKLKIPDVFTIFL
FT                   ILGMQIFSKNVTSISIIPYYLLIISGLALVLLLLDLLYYKQFTYRRFLKLWWRLTFFIT
FT                   LIIYLILIVITFTH"
FT   gene            complement(315003..315551)
FT                   /gene="ydbE"
FT                   /locus_tag="L1011"
FT   CDS             complement(315003..315551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbE"
FT                   /locus_tag="L1011"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.General.
FT                   27% identical to BioY protein precursor of Bacillus
FT                   sphaericus"
FT                   /db_xref="EnsemblGenomes-Gn:L1011"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04413"
FT                   /db_xref="GOA:Q9CIP1"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIP1"
FT                   /protein_id="AAK04413.1"
FT                   /translation="MQNTKLYSLTLIALGAAIIAVLSPLSIPIGIVPVTLQTLAVGLVA
FT                   TVLKARETFFAILLYLLLGFIGIPVFTGGTSGIAVLFGPTGGFLIAFLIMGTLISFGLH
FT                   QINYKTIPAFIINIVGHLLMLVIGTLWLKFFTNVDWSLALKLGFTPFVIVEIIKAVLVT
FT                   IFGLALIRALSHTNKYFTN"
FT   gene            complement(315662..316138)
FT                   /gene="ydbF"
FT                   /locus_tag="L115671"
FT   CDS             complement(315662..316138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbF"
FT                   /locus_tag="L115671"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY
FT                   FUNCTIONS.General COMMENTS=37% identical to EbsC regulator
FT                   of Enterococcus faecalis"
FT                   /db_xref="EnsemblGenomes-Gn:L115671"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04414"
FT                   /db_xref="GOA:Q9CIP0"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIP0"
FT                   /protein_id="AAK04414.1"
FT                   /translation="MSKKQKLKKTLVEQILDKAKIEHTGLAINALESNSLPVDISRSDI
FT                   YKTLALIGDKTGPVIGILPLTEHLSEKKLAKVSGNKKVSMIPQKDLQKTTGYIHGANNP
FT                   VGIWQNKKFPIFIDSIALEHDFIVCSAGEVGRSIKIAPKVLADFVHAQFVEIRE"
FT   gene            complement(316202..316777)
FT                   /gene="ydbH"
FT                   /locus_tag="L116212"
FT   CDS             complement(316202..316777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbH"
FT                   /locus_tag="L116212"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL"
FT                   /db_xref="EnsemblGenomes-Gn:L116212"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04415"
FT                   /db_xref="GOA:Q9CIN9"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIN9"
FT                   /protein_id="AAK04415.1"
FT                   /translation="MCASKRSFFMSNSKFNVRLLTEIAFMAALAFIISLIPNTVYGWII
FT                   VEIACIPILILSFRRGLTAGLVGGLIWGILSMITGHAYILTLSQAFLEYLIAPVSLGIA
FT                   GLFRQKTASLKLVPVLLGTFVAVLLKYFFHFIAGIIFWSQYAWKGWGAVAYSLAVNGIS
FT                   AILTAIAAFVILIIFVKKFPKLFIYSNY"
FT   gene            317479..318339
FT                   /gene="plpA"
FT                   /locus_tag="L117444"
FT   CDS             317479..318339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plpA"
FT                   /locus_tag="L117444"
FT                   /product="outer membrane lipoprotein precursor"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.01 Membranes,
FT                   lipoproteins, and porins. ATTACHED TO THE OUTER MEMBRANE BY
FT                   A LIPID ANCHOR. BELONGS TO THE NLPA FAMILY OF
FT                   LIPOproteinS."
FT                   /db_xref="EnsemblGenomes-Gn:L117444"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04416"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIN8"
FT                   /protein_id="AAK04416.1"
FT                   /translation="MNPRNRNILIVVIVVVIVAIAAFFGFNHKSGESKTANKTVNIGIM
FT                   TGTKEDDAIWSTVSKTAKDKYGITLKFTHFTDYTQPNTALKNGDIDLNAFQHYAFLNAW
FT                   NKANDGDLKAIGNTTISPIRLYSKKITSLSQIKSGDTIAVPNDASNESRALYVLKNAGL
FT                   IGLSVSGDTLATVKDINSNPKNLVIKELDAAQTPRALDSITAAVINDDFATTAKLTVEE
FT                   SIYTEPVNKDSEQWINIIVANKKDANNKIYKEVVKAYQTEATKKAIEKAYPDKRKIAAW
FT                   GLKLD"
FT   gene            318483..319343
FT                   /gene="plpB"
FT                   /locus_tag="L118475"
FT   CDS             318483..319343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plpB"
FT                   /locus_tag="L118475"
FT                   /product="outer membrane lipoprotein precursor"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.01 Membranes,
FT                   lipoproteins, and porins. ATTACHED TO THE OUTER MEMBRANE BY
FT                   A LIPID ANCHOR. BELONGS TO THE NLPA FAMILY OF
FT                   LIPOproteinS."
FT                   /db_xref="EnsemblGenomes-Gn:L118475"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04417"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIN7"
FT                   /protein_id="AAK04417.1"
FT                   /translation="MNPRNRNIIIGIIVVVIVAIAAFIGFGQKSQANKTVNKTVKIGIM
FT                   TGTKEDDSIWQTVSKTAKDKYGITLKFTHFTDYTQPNTALKNGDIDLNAFQHYAFLKAW
FT                   NKANNGNLVAIGDTVISPISVYSKQLKNISDIKEGGTIAVPNDASNESRALYVLKSAGL
FT                   IKLDVSGQTLATVKDITSNPKNLVIKELDASQTARALDSVDAAVINNNYAVTAGLKKSD
FT                   AIFTEPVNKDSQQWINIIVANKKDENNTVYKDVVKAYETEATKKTIAKAYPDKSTIPAW
FT                   GLKLK"
FT   gene            319460..320320
FT                   /gene="plpC"
FT                   /locus_tag="L119452"
FT   CDS             319460..320320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plpC"
FT                   /locus_tag="L119452"
FT                   /product="outer membrane lipoprotein precursor"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.01 Membranes,
FT                   lipoproteins, and porins. ATTACHED TO THE OUTER MEMBRANE BY
FT                   A LIPID ANCHOR. BELONGS TO THE NLPA FAMILY OF
FT                   LIPOproteinS."
FT                   /db_xref="EnsemblGenomes-Gn:L119452"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04418"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIN6"
FT                   /protein_id="AAK04418.1"
FT                   /translation="MNPKNRNIIVALAVIIVVALVAFFSLNHQASKKSTAQKTVKVGIM
FT                   SGDKQDQEVWKSVAKTAKEKYDLKLKFVYFSDYNQPNEALLSGDIDVNAFQSYNYVKTW
FT                   NKAHKSDIVAVGNTYITPMHIYSKEVSKLSDLKEGSTVAIPNDASNESRALFVLQSAGL
FT                   IKLTTSDSSKLVGLPDITENPHQLKFKEVDASQTPRALDSVALSVVNYNYATAASLPNS
FT                   ESVYMEPLNKTSAQYINFIAATSKEKNNKVYKEVAKAYASKATEKAIKEQYPDGGELPA
FT                   WNLKL"
FT   gene            320339..321199
FT                   /gene="plpD"
FT                   /locus_tag="L120334"
FT   CDS             320339..321199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plpD"
FT                   /locus_tag="L120334"
FT                   /product="outer membrane lipoprotein precursor"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.01 Membranes,
FT                   lipoproteins, and porins. ATTACHED TO THE OUTER MEMBRANE BY
FT                   A LIPID ANCHOR. BELONGS TO THE NLPA FAMILY OF
FT                   LIPOproteinS."
FT                   /db_xref="EnsemblGenomes-Gn:L120334"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04419"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIN5"
FT                   /protein_id="AAK04419.1"
FT                   /translation="MNPRNRKILFGSLLLLVIIVGLITFTLRQGKSKSTSVSKIVKIGL
FT                   MPGGKQEDAIWKQVQKIAKDQFGITLKFVNFTDGDQPNKALANHEVDLNAFQHYAYLKS
FT                   WNKANNGNIVSIGDTIITPIHLYSTKYKNVTEIPDKSTIAIPNDVTNESRALYVLKNAG
FT                   LIKLDTSRGALATVKDIRDNPKGLIIKEIDASQTPRALDSVAAAVINYNFAISAKISEK
FT                   ESIYQEPLNEDSAQWINFIAANQSDKNNKVYKEVVKAYEQKNIADSIKKEYPDGGELPA
FT                   WNLKL"
FT   gene            321303..322409
FT                   /gene="ydcB"
FT                   /locus_tag="L121289"
FT   CDS             321303..322409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcB"
FT                   /locus_tag="L121289"
FT                   /product="amino acid ABC transporter ATP binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.02 TRANSPORT AND BINDING
FT                   proteinS. Amino acids, peptides and amines. There are 60
FT                   paralogs in L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L121289"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04420"
FT                   /db_xref="GOA:Q9CIN4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIN4"
FT                   /protein_id="AAK04420.1"
FT                   /translation="MTAIIELNNLSVQFHQKGRLVTAVKDATLHIEKGDIYGVIGYSGA
FT                   GKSTLVRTINLLQKPTKGQIVINGEKIFDSENPVKFTGAKLREFRQKIGMIFQHFNLLS
FT                   EKTVFNNVAFALQHSQIEDKNGKKRYLTKKEKTDKVTELLKLVDLEELSDKYPAQLSGG
FT                   QKQRVAIARALANDPEILISDEGTSALDPKTTNQILDLLKSLHEKLGITVVLITHEMQV
FT                   VKEIANKVAVMQNGEIIEQNSLIDIFAQPKEALTKQFIETTSSVNRFIASLSRTELLAQ
FT                   LADDEELIHLDYSGSELEDPVVSDITKKFDVTTNIFYGNVELLQGQPFGSLVLTLKGSS
FT                   EHRAAAKAYFVERHLKFEVLGKIERTVD"
FT   gene            322409..323104
FT                   /gene="ydcC"
FT                   /locus_tag="L122401"
FT   CDS             322409..323104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcC"
FT                   /locus_tag="L122401"
FT                   /product="amino acid ABC trasporter permease protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.02 TRANSPORT AND BINDING
FT                   proteinS. Amino acids, peptides and amines"
FT                   /db_xref="EnsemblGenomes-Gn:L122401"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04421"
FT                   /db_xref="GOA:Q9CIN3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIN3"
FT                   /protein_id="AAK04421.1"
FT                   /translation="MAEWFAHTFPNVVYLGWSGETGWWTAIVQTLYMTFISALIGGLLG
FT                   LIFGIGVVVTAEDGITPNRPLFWILDKIVSIGRAFPFIILLAAIAPLTKILVGTQIGVT
FT                   AALVPLALGVAPFYARQVQASLESVDHGKVEAAQTVGADFLDIVFTVYLREELASLIRV
FT                   STVTLISLIGLTAMAGAIGAGGLGNTAISYGYNRFANDVTWFATILILIFVLLVQLVGD
FT                   FLARRVSHR"
FT   gene            323152..323700
FT                   /gene="ydcD"
FT                   /locus_tag="L123147"
FT   CDS             323152..323700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcD"
FT                   /locus_tag="L123147"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL"
FT                   /db_xref="EnsemblGenomes-Gn:L123147"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04422"
FT                   /db_xref="GOA:Q9CIN2"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR022914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIN2"
FT                   /protein_id="AAK04422.1"
FT                   /translation="MKNNSVKIVVATGIGAALFVIIGWLINIPTPIPNTSIQLQYAVLA
FT                   LFSALFGPLAGFLIGFIGHALKDSFLYGAPWWTWVLGSGLIGLFLAFGVKRETLTQGIF
FT                   GNKEIIRFNIVQFLANVVVWGIIAPIGDVLVYSEPANKVFTQGIVAGLVNALTIAVAGT
FT                   LLLKLYAATRTKSGSLDKE"
FT   gene            323809..325506
FT                   /gene="ydcE"
FT                   /locus_tag="L123777"
FT   CDS             323809..325506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcE"
FT                   /locus_tag="L123777"
FT                   /product="ABC transporter ATP binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS General. contains two ATP-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:L123777"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04423"
FT                   /db_xref="GOA:Q9CIN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIN1"
FT                   /protein_id="AAK04423.1"
FT                   /translation="MEALISFKDFTFKYDLQKNPTLKKINLEIFPGEKVLIVGPSGSGK
FT                   STIGSCLNGILPHLHKGEASGKLSIAGLPFGTSIAELSEKVSTILQDTDGQFIGLSVAE
FT                   DIAFALENDGLIHDELVSKVAYWSDKTETNKLLNHRPQDLSGGQKQRVSLAGVLIDESP
FT                   ILLFDEPLANLDPQTCLETMALIKDIHENNEVTTIIIEHRIEEVLPLGIDKIVVVNDGE
FT                   IVATGSPAELLKTEIFNENSLREPLYLSALKAANATKLLTDFSDLKSLEVLSAKKLLTD
FT                   FLDTYKFTDKAVSKNNILSVKNLSVNFAQHEVLKGINLEVQEGEKISIVGKNGVGKSTF
FT                   ANALCHFVEASGEILYREQSIIADSISERAKKIGYIMQNPNLMISQNIVSDEVAAGLRL
FT                   RHVDEKMIQDKVEEILKVCGLYPFRNWPISSLSYGQKKRVTIASILILEPEILVLDEPT
FT                   AAQDLQSYREIMDFLDELNRRLHLTMIMITHDMYLITEYSDRTLVFADGKIIADSSPYQ
FT                   ILENEDFVKMGNLSQPSLYQLARQTDTNPVLLTKAFINFQNQERLKHE"
FT   gene            325499..326320
FT                   /gene="ydcF"
FT                   /locus_tag="L125503"
FT   CDS             325499..326320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcF"
FT                   /locus_tag="L125503"
FT                   /product="ABC transporter permease protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS. General"
FT                   /db_xref="EnsemblGenomes-Gn:L125503"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04424"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIN0"
FT                   /protein_id="AAK04424.1"
FT                   /translation="MNNQLSVLGYQAGNSFIYQLNATAKLLFFLLISISSMVTYDTRYL
FT                   AFVALFSVVLFYFSKIPFSSVKRVAQFAAIFAILNLLFVFIFDPGYGARLYDSKTILWG
FT                   PLTLEELFYLFNLVLKYFSTIPLALLFILTTNPSQFASSLNKIGLPYRSSYSVSLALRY
FT                   IPDMQERFLAIRNAGQARGMDLSKKVGLFSRIKLNVQLLLPLIFSSLEQIDTISTAMEL
FT                   RRFGKKKKRSWYSYQPLNVKDYLVILLALLGVAIVVLLFFVNQGRFFNPFH"
FT   gene            326483..326776
FT                   /gene="ydcG"
FT                   /locus_tag="L126409"
FT   CDS             326483..326776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcG"
FT                   /locus_tag="L126409"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General. BELONGS TO THE PBSX(XRE) FAMILY OF TRANSCRIPTIONAL
FT                   REGULATORS"
FT                   /db_xref="EnsemblGenomes-Gn:L126409"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04425"
FT                   /db_xref="GOA:Q9CIM9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIM9"
FT                   /protein_id="AAK04425.1"
FT                   /translation="MENKIRELRRLSHLSQEDVAHIAHVSRQTINAIENDKYDPELTLA
FT                   FKLAETLGTTVDELFNYQPTVVKRKENDVFWCEKYQCVLWKRAGIEKRNAVD"
FT   gene            326700..327479
FT                   /gene="fhuC"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.05 TRANSPORT AND BINDING
FT                   proteinS. Cations. there is a frameshift at the end of the
FT                   gene. Probably a pseudogene. There are 60 paralogs in
FT                   L.lactis."
FT   gene            327472..328422
FT                   /gene="fhuB"
FT                   /locus_tag="L127476"
FT   CDS             327472..328422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="L127476"
FT                   /product="ferrichrome ABC transporter permease protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.05 TRANSPORT AND BINDING
FT                   proteinS. Cations"
FT                   /db_xref="EnsemblGenomes-Gn:L127476"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04426"
FT                   /db_xref="GOA:Q9CIM8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIM8"
FT                   /protein_id="AAK04426.1"
FT                   /translation="MPKKHFLTIFFALVFSLLFLSVIYLMLGNKNVPLTEILVNKMVLQ
FT                   LRFPRLISLYLTGFLLSVSGFIVQIMTRNPIAEMATLGISGGSSLALSLILTLGWSTND
FT                   GISVLVSSLGAFIALAVVMLLTARTHFQPLKVVLVGTSVGLFATSLASSLTFASHDTQA
FT                   YFRWIVGSFSGITNTKVLLMAVVSLIFLILLLLFSKQIYLLNFGDELAQSFGISVNFVR
FT                   LVIMFLVALASGVTVASVGVVSFVGLIAPHIAKKLVRANFWQNVILSVLTGMLLLVLAD
FT                   LIARNLFKPYEFPAGSLTMLLGAPFFLWVITKEAK"
FT   gene            328424..329362
FT                   /gene="fhuG"
FT                   /locus_tag="L128386"
FT   CDS             328424..329362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuG"
FT                   /locus_tag="L128386"
FT                   /product="ferrichrome ABC transporter permease protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.05 TRANSPORT AND BINDING
FT                   proteinS. Cations"
FT                   /db_xref="EnsemblGenomes-Gn:L128386"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04427"
FT                   /db_xref="GOA:Q9CIM7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIM7"
FT                   /protein_id="AAK04427.1"
FT                   /translation="MKRKFTLLFVLLLVLIVVDLTQFSTNPQILSILIPNFRLPRLITI
FT                   LSAGIALSLSGFIIQNITENPLADSGTIGITSGASAGSVAFLLIADHFKLTGLWNFSYP
FT                   IFALIGALLSFVLIYFFALRKQVSSVRVLLTGIAITAFFQALITIGQLSVNAFDFQKVA
FT                   VWLSGDIWQTGSTYLFICVLLLVIGLIILPFFLRKLEILSLGEEMATTLGLEVQKTKIY
FT                   LYLLALLFAAVGVLLVGGLAFVGLIAPHIAREIAGFKSRKSLIATALSGMIILSFADII
FT                   SQTIIAPSSLPLGFVVAFIGAPYYIYLIQKV"
FT   gene            329447..330388
FT                   /gene="fhuD"
FT                   /locus_tag="L129403"
FT   CDS             329447..330388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="L129403"
FT                   /product="ferrichrome ABC transporter substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:L129403"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04428"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIM6"
FT                   /protein_id="AAK04428.1"
FT                   /translation="MKKVLTTLIAAGALLTLAACSSNSSSKKATSSDDKVTFHALNGDV
FT                   KVPKNPKRIAVQNYPDEVASLGANVVGTDSWAFPNTFLSKDQKKNMVDLGAPKFNMEKL
FT                   IAQNPDLIITVDKDQVADYQKVAPTVLVNYKDLSGMNKSLDYFAKLLNREDEKASFLKN
FT                   FKKEADKQKEKLAKVDVKPAKNTISLLELQGDKVYAFGDNFARGGQALTTGLGFKESSK
FT                   MAELSKGVGYAEVNTESLGEFDADYIFIDFADKDKEQYAALKNNPAWQNLKAVKEGHVI
FT                   TMDYDKVYFFGGPTAAKEELSLYTDAIIKATK"
FT   gene            330450..331355
FT                   /gene="fhuR"
FT                   /locus_tag="L0219"
FT   CDS             330450..331355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuR"
FT                   /locus_tag="L0219"
FT                   /product="fhu operon transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.04 LysR-family
FT                   regulators. probably cotranscribed with other fhu genes"
FT                   /db_xref="EnsemblGenomes-Gn:L0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04429"
FT                   /db_xref="GOA:Q9CIM5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIM5"
FT                   /protein_id="AAK04429.1"
FT                   /translation="MNIKQLRYVVAIANSGTFREASEQLFVSQPSMSIAVKDLEQELGF
FT                   QIFERTNTGATLTIEGERFYEQAQTVLRNFETFESKYSKPKESDKTFSVASQHYDFLAP
FT                   VAVEFAKKNPEIKNFRIFESTTYNILQEVAQGHSELGVVYLNKQNRSGILRMLNKLELD
FT                   YEEIFLSQTHIYIRKGHPLAQRETISDDDLKPLDRVRFTQENEQFLYYSEDLIETFENT
FT                   LIYNVTDRASLNGILERTDAYATGLGFIDKESVHNVTVVPMEGDNGNSLILVKHRGHLL
FT                   SNAATSYKRSLEVYFENYEF"
FT   gene            complement(331413..332594)
FT                   /gene="yddA"
FT                   /locus_tag="L131423"
FT   CDS             complement(331413..332594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddA"
FT                   /locus_tag="L131423"
FT                   /product="transporter"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.05 TRANSPORT AND BINDING
FT                   proteinS. General"
FT                   /db_xref="EnsemblGenomes-Gn:L131423"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04430"
FT                   /db_xref="GOA:Q9CIM4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIM4"
FT                   /protein_id="AAK04430.1"
FT                   /translation="MKKISPSLTLLALAINAFAIGSTEFISVGLMPMIVNTFNISLSQA
FT                   GLTVSLYALGVTVGAPLLTILTGTWNRKTLMVSIMGLFILGNLLSAFAPTFLLLLVGRV
FT                   LASLAHGIFMSISTVIAADVVRPEKRASAIALMFTGLTVATVIGVPLGTFIGQHSNWHM
FT                   SFVFIVVIGLIGLIATSILVPKGLPIPGKINLSGLARIFTNKSILMSLFITAFGYGGTF
FT                   AAYTYLTPILEGTFRFSASTVVIILVAYGVMVAIGNSLGGHLANKNILPALQKMFAALA
FT                   LSLLFLFISASLASQALGLIATLLLGLFAFMNVPGLQLYVVQLAEKFTPKDITLVSAFN
FT                   IAAFNVGITLGSFVGGQISKGSSVVFTPLGGIIIILLAMFLIRLAQKDQASKL"
FT   gene            complement(332607..333425)
FT                   /gene="yddB"
FT                   /locus_tag="L132617"
FT   CDS             complement(332607..333425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddB"
FT                   /locus_tag="L132617"
FT                   /product="oxidoreductase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.01 ENERGY METABOLISM.
FT                   Aerobic. There are six paralogs in L.lactis"
FT                   /db_xref="EnsemblGenomes-Gn:L132617"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04431"
FT                   /db_xref="GOA:Q9CIM3"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIM3"
FT                   /protein_id="AAK04431.1"
FT                   /translation="MKLNNQIEIPELGLGVFQIPNDETADVVKNAIVNGYRLIDTAKIY
FT                   ENEEGTGQGIKEGLAMTGLSRDDLFITSKLWGDNHSYEETVQNFEKSLKKLDLDYLDLY
FT                   LIHWPGTHYAYKEAWNAMEDLYKAGKIKAIGVSNFQKSHLEELLSYAKITPVLNQIELH
FT                   PKLSQEELRNFLELHDIKVQAWSPLMQGQLLDNEVLKKIADKHGKSVAQIILRWDIQQD
FT                   ILVNVKSIKSERMIANRQIFDFSLDSEDMKAINSLNEELRVGPDPEHFNF"
FT   gene            333567..333914
FT                   /gene="yddC"
FT                   /locus_tag="L133547"
FT   CDS             333567..333914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddC"
FT                   /locus_tag="L133547"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:L133547"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04432"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIM2"
FT                   /protein_id="AAK04432.1"
FT                   /translation="MKKIYNIGVEATMDVIGGKWKPIILCNLRHNPSRPGELRRQIPGI
FT                   SQKMLTQQLRELEIDNIIVRKVYNQVPPKVEYSLSPYGETLNGLLDILCSWGEGHVQTL
FT                   KSMGEEVQVLE"
FT   gene            333940..334332
FT                   /gene="yddD"
FT                   /locus_tag="L133932"
FT   CDS             333940..334332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddD"
FT                   /locus_tag="L133932"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L133932"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04433"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIM1"
FT                   /protein_id="AAK04433.1"
FT                   /translation="MYQPAFNKIHHIAIIAADYEKSRQFYVDILGFSIIRENHRPEKGD
FT                   IKLDLKMNEEKEIELFIKSDAPERLTYPEAKGYRHLAIKTTNIEEDRNYLISQGVKVEE
FT                   IRQDEITDRKMLFFYDPDDLPIELHE"
FT   gene            334509..335210
FT                   /gene="pmg"
FT                   /locus_tag="L0011"
FT   CDS             334509..335210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmg"
FT                   /locus_tag="L0011"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.09 Glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:L0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04434"
FT                   /db_xref="GOA:Q9CIM0"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIM0"
FT                   /protein_id="AAK04434.1"
FT                   /translation="MPKLVFARHGESEWNLANLFTGWADVDLSENGTKQAIEAGKLIKE
FT                   AGIEFDIAYTSVLKRAIKTTNLALEYSDQLWVPVVKSWRLNERHYGGLTGLNKADAAAK
FT                   HGDEQVHIWRRSYDVLPPAMDHDDKYTAHGDRRYAGLEDSLIPDAENLKVTLERALPFW
FT                   EDQIAPALKEGKNVFVGAHGNSIRALVKQIKKLSDDEIMDVEIPNFPPLVFEFDDNLNV
FT                   QNEYYLAPKKA"
FT   gene            335384..335947
FT                   /gene="ahpC"
FT                   /locus_tag="L135351"
FT   CDS             335384..335947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="L135351"
FT                   /product="alkyl hydroperoxide reductase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO04.04 CELLULAR PROCESSES.
FT                   Detoxification. derectly reduces organic hydroperoxides.
FT                   Probably induced by heat shock, salt stress, oxidative
FT                   stress and glucose limitation. General stress protein."
FT                   /db_xref="EnsemblGenomes-Gn:L135351"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04435"
FT                   /db_xref="GOA:Q9CIL9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIL9"
FT                   /protein_id="AAK04435.1"
FT                   /translation="MSLVGKKIEEFSTDAYLGGKFIKVSDKDFYGKWSVLCFYPADFSF
FT                   VCPTELEDLEETYPTLKSLGVEVYSASTDTHFVHAAWHEHSDAISKITYPMLADPSQKI
FT                   SRAFDVLDEEAGLAQRGTFIIDPDGVIQALEITADGIGRDASQLVDKIKAAQYVRNHPG
FT                   EVCPAKWKEDGASLHVGIDLVGKI"
FT   gene            336014..337543
FT                   /gene="ahpF"
FT                   /locus_tag="L135954"
FT   CDS             336014..337543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="L135954"
FT                   /product="alkyl hydroperoxide reductase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO04.04 CELLULAR PROCESSES.
FT                   Detoxification. protects the cell against DNA damage by
FT                   alkyl hydroperoxides. Probably orthologous to NADH
FT                   peroxidase nox-1 of S.mutans."
FT                   /db_xref="EnsemblGenomes-Gn:L135954"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04436"
FT                   /db_xref="GOA:Q9CIL8"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIL8"
FT                   /protein_id="AAK04436.1"
FT                   /translation="MILDETLRAQLMPYMDLLENPIILKVDADLESENGKKIVEFTDEL
FT                   ASLSEMISKETAKLNRKTAFSIEREGVSGVLFSGLPLGHELNSLVLALVQVSGRPPRIE
FT                   QELVERIQAIQNPLHFETYVSLTCHNCPDVVQALNTMSILNPNISHTMIEGGMFQEEVE
FT                   AKGIMAVPTVFKNGEEFHNGRASLEELLEKITGPESSEAFFDKDPYDVLVVGGGPAGAS
FT                   AAIYAARKGIRTGLIAERFGGQPLETLGIENLIGTPYVEGVQLGRQLEEHVKKYPVDLM
FT                   NLQKAVKLEKKDLIEVSLENGALLKSKSVIISTGARWRDLGIPGEQEFKTKGVAYCPHC
FT                   DGPLFAGKDVAVIGGGNSGIEAAIDLAGLVRHVTVLEFLPELKADKILQEKLATLNNVT
FT                   VLTNVETKEILGDDKVRGLNYQVRGSKETVHLELAGVFVLIGLVPNTQWLEGTIDLSAR
FT                   GEILTDKVGATNLPGVFAAGDCTDSVYKQIIISMGTGATASLGAFDYLIRN"
FT   gene            337709..339874
FT                   /gene="pbp2B"
FT                   /locus_tag="L137682"
FT   CDS             337709..339874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp2B"
FT                   /locus_tag="L137682"
FT                   /product="penicillin-binding protein 2B"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.02 CELL ENVELOPE Murein
FT                   sacculus and peptidoglycan"
FT                   /db_xref="EnsemblGenomes-Gn:L137682"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04437"
FT                   /db_xref="GOA:Q9CIL7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIL7"
FT                   /protein_id="AAK04437.1"
FT                   /translation="MSDNKRKNDKRKQSDKSKKSHKEVKILKDPTKLIPKRVNLLFFVI
FT                   FVLFMILIGKLFNMQVLNSHFYAEKSISAGGDVQIIEGAPRGNIYDATGKALASTVAVQ
FT                   AVEFTRSQNATADEIYQVANKLATILSNNIDVADLTTRDKKDYFLANSKNLEKIANSLS
FT                   EKEKKDKHGNDLSGSQIYDVELSKVKDSDLNFTAEQTFAAKLFKEMNSTTTFNTTKIAT
FT                   GSITAEQQATIAEQEGDLPGITIGTSWDRSYAQNSLTPLMGTITSQKSGIPAEDLDAYL
FT                   KKGYQRNDRVGTGLLEKGYESELQGTHSISKVKFDKNGDVSGTKTIQKGKRGDDLKLTI
FT                   NLDFQNGVNNIVKTQLDQLIAQGYGQYNRGAYAVVLNVKTGAVLALSGYQRDPNTGTIT
FT                   ENTLGTFQSVFTPGSVVQMGTLTAAWNAGVISGNDTLTAQSIQFKDSNPINDWWGDASP
FT                   MALTAVEALQYSSNTYMMQLAMRMLGAPYTAANQFLDDTNRVKVYEQFRKAFASYGLGA
FT                   STGFDIPGESTGYLPSAKSEAASGVNVLYESFGQYDNYTPLQLAVYAATLGNNGTRLSP
FT                   HIVQGIYEGGTDGQPGTLIKNITPKIMDKVNITPDNMDVLHQGMYAVVHGAGGLTTGRS
FT                   MDSSKVSISGKTGTSESTKVLADGSQVIVTANNAVAFAPSDNPEIAIAVVLPDNTESNA
FT                   SSGTKANQSIVTGITDLYYSNEAFRKN"
FT   gene            340013..340609
FT                   /gene="recM"
FT                   /locus_tag="L0265"
FT   CDS             340013..340609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recM"
FT                   /locus_tag="L0265"
FT                   /product="RecM protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO10.02 DNA replication,
FT                   restriction, modification, recombination, and repair. SEEMS
FT                   TO BE INVOLVED IN AN RECBC-INDEPENDENT RECOMBINATIONAL
FT                   PROCESS OF DNA REPAIR. MAY ACT WITH RECF AND RECO"
FT                   /db_xref="EnsemblGenomes-Gn:L0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04438"
FT                   /db_xref="GOA:Q9CIL6"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIL6"
FT                   /protein_id="AAK04438.1"
FT                   /translation="MYYPEPIARLIESFSKLPGIGQKTATRLAFYTIGMEDQDVNEFAK
FT                   NLLSAKRDLSFCSICGNLTESDPCAICTDPTRDRTTILVVEESKDVLAMEKIREYRGLY
FT                   HVLHGTISPMNGISPDEINVKTLITRLMDSEVKEVIIATNATSDGEATAMYLARMIKPA
FT                   GIKVTRLARGLAVGSDIEYADEITLSKAVENRLEI"
FT   gene            340726..341775
FT                   /gene="ddl"
FT                   /locus_tag="L140690"
FT   CDS             340726..341775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="L140690"
FT                   /product="D-alanine-D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.02 CELL ENVELOPE Murein
FT                   sacculus and peptidoglycan. CELL WALL FORMATION. ALONG WITH
FT                   ALANINE RACEMASE, IT MAKES UP THE D-ALANINE BRANCH OF THE
FT                   PEPTIDOGLYCAN BIOSYNTHETIC ROUTE."
FT                   /db_xref="EnsemblGenomes-Gn:L140690"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04439"
FT                   /db_xref="GOA:Q9CIL5"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIL5"
FT                   /protein_id="AAK04439.1"
FT                   /translation="MSKETLILLYGGRSAEREVSVLSAESVMRAVNYSRFVVKTYFITK
FT                   GGEFIKTQEFTDKPAEEEKLLTNDLAESYPKISPAAIYEKAAVVFPVLHGPMGEDGSIQ
FT                   GFLEILRLAYVGPNILSASSTMDKLLAKHVFEAVGVPQVPYVAAFADENQGEIAQEVVE
FT                   KLEFPVFVKPANMGSSVGISKVDDLADLQPALSEAYKYDNRVVIEQGVDAREIECAVLG
FT                   NNSDVSATLPGEVVKDVEFYDYNSKYIDNKIQMDIPAKVPADLAQKMQEYAIKAYKAVN
FT                   GTGLSRCDFFVTKDGNVYLNEINAIPGFTQWSMYPLLWENMGLSYSDLIEKLVDLAKET
FT                   FETRENHLL"
FT   gene            341850..343172
FT                   /gene="murF"
FT                   /locus_tag="L141766"
FT   CDS             341850..343172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="L141766"
FT                   /product="D-Ala-D-Ala adding enzyme"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.02 CELL ENVELOPE Murein
FT                   sacculus and peptidoglycan. PEPTIDOGLYCAN BIOSYNTHESIS.
FT                   CATALYSES THE FINAL STEP IN THE SYNTHESIS OF
FT                   UDP-N-ACETYLMURAMOYL-PENTAPEPTIDE, THE PRECURSOR OF MUREIN.
FT                   BELONGS TO THE MURCDEF FAMILY."
FT                   /db_xref="EnsemblGenomes-Gn:L141766"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04440"
FT                   /db_xref="GOA:Q9CIL4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIL4"
FT                   /protein_id="AAK04440.1"
FT                   /translation="MKLTIHEIAQVVGAKNDWSQLADLSVNKIEFDSRLIEKGDIFLPL
FT                   KGARDGHDFIEIAFDNGAIISFSEKEVEQAHLLVDDNLLAFQKLAKYYLEKTKVPVIAV
FT                   TGSNGKTTTKDMIAAVLSKKFKTYKTQGNHNNEIGLPYTILHMPDDTEKLVLEMGMDHP
FT                   GDIDFLSELAKPELAVITLIGEAHLEHMGSRENIAKGKMGITAGLHGELIAPADPIINA
FT                   FIPDNQKIIRFGLPGEDLFITKLVEHKEKLTFETNFLDESITIPVPGKYNATNAMLAAF
FT                   VGLHYGLSEAEIKKALKEVELTRNRTEWKKAKNGADLLSDVYNANPTAMRLILETFQAI
FT                   PKNENGRKIAVLADMLELGPSAAQLHKDILKSIDFNKIDKVYLYGEMMKNLAEISTDKA
FT                   VSYFTDLDLLTESLSADLKPTDQVLFKGSNSMKLSEVVEKL"
FT   gene            343342..344994
FT                   /gene="optS"
FT                   /locus_tag="L143312"
FT   CDS             343342..344994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="optS"
FT                   /locus_tag="L143312"
FT                   /product="oligopeptide ABC transporter substrate binding
FT                   protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.02 TRANSPORT AND BINDING
FT                   proteinS. Amino acids, peptides and amines"
FT                   /db_xref="EnsemblGenomes-Gn:L143312"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04441"
FT                   /db_xref="GOA:Q9CIL3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIL3"
FT                   /protein_id="AAK04441.1"
FT                   /translation="MKQGKIIGLTSLIALSGIILVACGTKTSEQKNIKFSIPTDVASLD
FT                   TTILTDQYSYDVAGNVEEGLTRVDSKGNAALALAKSIDVSKDGLTYTVTLRDNLKWSNG
FT                   DRLTAKDFVYSWKRAVDPKTGSEYAYLMGAVSGANDIISGKSSLDSLGIKAESDTEFTV
FT                   TLAQPTPYFKFLLSEPVYYPLDQKVVDKYGKQYGTSSDKTVYNGPFMFKSDKGWTGTNK
FT                   TFSIYANPNYYDKSAVKSKQIDFQVISNANTGAQLYKQGKLDFTLLSTTDLINANKKTK
FT                   GYTVFKQARTDYIEYNQSGKNASSPDAQKALANQNIREALNLATNRAGVVKTALPGSTV
FT                   ATSFTPVGMSKTSTGEDFATYAKQDYRYDPTKAKDLWEKGLKELGLTKLTLSLEAAGDL
FT                   APSEATANFLQTAYQQNLPGLTVNLKLVPFKQRLNDAQNGNFDMVLSGWGGDYAEPSTF
FT                   LQLFTTGQSYNDGKFSSKTYDDAFKAATTTPDVLEPAKVDEHYKAAETALYQGSYINPV
FT                   DFQANPALMNPKITGLEFHSTGLAYDLKSAYVK"
FT   gene            345303..346940
FT                   /gene="optA"
FT                   /locus_tag="L145267"
FT   CDS             345303..346940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="optA"
FT                   /locus_tag="L145267"
FT                   /product="oligopeptide ABC transporter substrate binding
FT                   protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.02 TRANSPORT AND BINDING
FT                   proteinS. Amino acids, peptides and amines"
FT                   /db_xref="EnsemblGenomes-Gn:L145267"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04442"
FT                   /db_xref="GOA:Q9CIL2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIL2"
FT                   /protein_id="AAK04442.1"
FT                   /translation="MKTWKKVTLGTVALGSAALLAACGNSGSSSSSSSKDIQWNLTSPI
FT                   QTLDSSLATDTYSNIIIGNTNAGLTRVDKDGKAQPELAKSVDVSKDGLTYTFHLRDGLK
FT                   WSNGDALTAKDFVYSWQRAVDPATASEYGYLLGPVKNANEINGGKADKSTLGVKATDDK
FT                   TFVVTLAQPTPYFEFLTANSVYYPLNQKVVEKYGKQYGTSSEKMVYSGPYKFEKSKGWN
FT                   GSNQTFSIVKNDDYWDKSAVKTKEIDFQVVQDPKTSFNLYKQGKIVQASIGDPDLFKAN
FT                   KNNKDVVSLDEATTAYIQYNQSGKNKALANKNIREAFNLATDRQQYVDTVTPASNPATG
FT                   LTPAGMAKTNTGVDFAKYAAQPYKYDATAAKAAWAKGLSEIGETKLTLTLTTDDTSASK
FT                   DSATFLKQAWEKQLPGLTLNIKSVPFKQRLNDSTTGNFDMVISLWGGDYAEPSTFLDLF
FT                   VKDGPNNNGKINNVTYDKAIKAAEVTDALDPEKHYADYKAAEESLYTESNLNPLYFRTT
FT                   PVLRNPNLKDVRFGSTGLMYDFKTAYLK"
FT   gene            347018..347929
FT                   /gene="optB"
FT                   /locus_tag="L147009"
FT   CDS             347018..347929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="optB"
FT                   /locus_tag="L147009"
FT                   /product="oligopeptide ABC trasporter permease protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.02 TRANSPORT AND BINDING
FT                   proteinS Amino acids, peptides and amines"
FT                   /db_xref="EnsemblGenomes-Gn:L147009"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04443"
FT                   /db_xref="GOA:Q9CIL1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIL1"
FT                   /protein_id="AAK04443.1"
FT                   /translation="MIKYILKRLGLLLLTLFLIVTLTFFMMQVMPGTPFSNPKLTPDQL
FT                   EILKHAYGLDKPLWQQYFIYVGHMFTGNFGTSFVYTNQPVITMIAQRLPVSMQLGVQAL
FT                   ILGTILGAFMGKASARRKNGILDGIFGFVSVLGISVPSFVIGTLILLYLGFNLNLFPIS
FT                   GWGTFSQTIMPTIALSFAPMAVVTRFVRSEMIESLSSDYILLARAKGLSEKEVVNKHAL
FT                   RNSLIPMLTLIGPMAANLLTGSVLIEKIFSIPGIGSQFVDSIPAKDFPVIMATTIVYAV
FT                   ILMLFILVTDILTAIVDPRVRL"
FT   gene            347945..348976
FT                   /gene="optC"
FT                   /locus_tag="L147936"
FT   CDS             347945..348976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="optC"
FT                   /locus_tag="L147936"
FT                   /product="oligopeptide ABC trasporter permease protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.02 TRANSPORT AND BINDING
FT                   proteinS Amino acids, peptides and amines"
FT                   /db_xref="EnsemblGenomes-Gn:L147936"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04444"
FT                   /db_xref="GOA:Q9CIL0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIL0"
FT                   /protein_id="AAK04444.1"
FT                   /translation="MENLNKDFTLVGSKGSDSTEKIAKPALSFFQDAWRRFKKNKVALV
FT                   AMWIIAITLVFSVISAFVVPQSKANYFDPNKSQVYGNLPPKLSGDLPFWNGEFKAPGST
FT                   ERTDVYKSQDVPSKDKYVFGTDKYGRSLAKRTIVGLRISLIIALAAALIDLVIGVTYGI
FT                   ISGWMGGKVDMVMQRIIEIIQSVPNLVVVTMLALLLGQGISSIIIAIGLFAWTGMARQV
FT                   RNMVLSYKERDFVLASKTLGQSTWKIAVKHLLPNVSGVIVVQIMFDIPSMIMYEAVLSA
FT                   INLGVKPPTSSLGTLINDGIASLQFYPFQLIIPAVVLSVLSLTFIFFGDGLRDAFDPRA
FT                   SED"
FT   gene            348979..350028
FT                   /gene="optD"
FT                   /locus_tag="L148976"
FT   CDS             348979..350028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="optD"
FT                   /locus_tag="L148976"
FT                   /product="oligopeptide ABC trasporter ATP binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.02 TRANSPORT AND BINDING
FT                   proteinS Amino acids, peptides and amines. There are 60
FT                   paralogs in L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L148976"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04445"
FT                   /db_xref="GOA:Q9CIK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIK9"
FT                   /protein_id="AAK04445.1"
FT                   /translation="MAEEKVLEVKNLHVNFHTYAGDVKAIRDVSFDLEKGQTLAIVGES
FT                   GSGKSVTTKTLMGLNAKNAVIPQGELLFKGRNLLDLKEEEWQKIRGNEISMIFQDPMTS
FT                   LDPTMRIGKQIAEPLLKHNKGMSKADAMKRALELMQQVGIPDAEVHINDYPHQWSGGMR
FT                   QRAVIAIALAADPEILIADEPTTALDVTIQAQIMHMMAELQERINSSIVFITHDLGVVA
FT                   GFAHKVAVMYAGEIVEYGTVEEIFYNPQHPYTWGLLDSMPTVDSSVDRLVSIPGTPPDL
FT                   LNPPKGDAFAARNKFALAIDFEEEPPYFEVSPTHFAKTWLLDPRAPKVTPSDNILARWK
FT                   RWEELKGDK"
FT   gene            350025..350966
FT                   /gene="optF"
FT                   /locus_tag="L150031"
FT   CDS             350025..350966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="optF"
FT                   /locus_tag="L150031"
FT                   /product="oligopeptide ABC trasporter ATP binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.02 TRANSPORT AND BINDING
FT                   proteinS Amino acids, peptides and amines. There are 60
FT                   paralogs in L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L150031"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04446"
FT                   /db_xref="GOA:Q9CIK8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIK8"
FT                   /protein_id="AAK04446.1"
FT                   /translation="MMTEPKKVIEIKNLDLTFNKGKKGANKAINNVSLDIYEGETFGLV
FT                   GESGSGKTTIGRAILKLYDNFITGGEILFEGKDVRNLKGSELREYRSEAQMIFQDPQAS
FT                   LNGRMRVKDIVAEGLDANGLVKTKAERDARVLELLRLVGLNDDHLTRYPHEFSGGQRQR
FT                   IGIARALAVKPKFVVADEPISALDVSIQAQVVNLMRDIQAKENLTYLFIAHDLSMVKYI
FT                   SDRIGVMHWGKILEVGTSDQVYNHPIHPYTKSLLSSIPSPDPISERERTPIVYDPTAEL
FT                   DGQEREMREITPGHFVFSTEAEAEIYKKNATV"
FT   gene            351198..352769
FT                   /gene="prfC"
FT                   /locus_tag="L0369"
FT   CDS             351198..352769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="L0369"
FT                   /product="peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:L0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04447"
FT                   /db_xref="GOA:Q9CIK7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIK7"
FT                   /protein_id="AAK04447.1"
FT                   /translation="MTLQEEIKKRRTFAIISHPDAGKTTITEQLLKFGGAIREAGTVKA
FT                   RKTGNFAKSDWMDIEKERGISVTSSVMQFDYAGKRVNILDTPGHEDFSEDTYRTLMAVD
FT                   AAVMVIDSAKGIEAQTKKLFQVVKRRGIPVFTFINKLDRDGREPLDLLSELEEILGIAS
FT                   VPMNWPIGMGKNFQGLYDFTHGRVEVYQPEDGKRFVEFDENGEVPASHPLTKNPFFTQA
FT                   LEDAELLLDAGNQFSEEEVVAGQLTPVFFGSALTSFGVETFLETFLEYAPEPHSHKTVD
FT                   EEEIEPLNPDFSGFIFKIQANMDPRHRDRIAFVRIVSGEFERGMDVNLIRTGKKVKLSN
FT                   VTQFMAESRENVENAVAGDIIGVYDTGTYQVGDTLTTGKLKKSFEPLPTFTPELFMRVQ
FT                   AKNVMKQKSFQKGIDQLVQEGAIQLYKSYTTGDIMLGAVGQLQFEVFKDRMEREYNSET
FT                   IMTPMGTKTVRWIKEEDLDEKMSSSRNILARDRFDHPLFLFENEFAMRWFKDKYPDVEL
FT                   MEQFSV"
FT   gene            353033..354676
FT                   /gene="rheA"
FT                   /locus_tag="L0339"
FT   CDS             353033..354676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rheA"
FT                   /locus_tag="L0339"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO11.03 RNA processing.
FT                   PROBABLY AN ATP-DEPENDENT RNA-BINDING protein WITH AN
FT                   UNWINDING ACTIVITY (HELICASE). SIMILARITY TO OTHER 'DEAD'
FT                   BOX FAMILY HELICASES"
FT                   /db_xref="EnsemblGenomes-Gn:L0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04448"
FT                   /db_xref="GOA:Q9CIK6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIK6"
FT                   /protein_id="AAK04448.1"
FT                   /translation="MKFSELGLSEGIVNTLTEIGYEQPTPIQEQTIKLALEGRDVLGQA
FT                   QTGTGKTAAFGLPTIEKIDASNPAIQALVIAPTRELAVQGQEELFRFGKSKGLKVRTVF
FT                   GGSSIEKQIKGLKAGAHIVVGTPGRLVDLIKRKAIKLDQLETLILDEADEMLNMGFLED
FT                   IHFIIEKTPEARQTLLFSATMPNDIKKIGVKFMKNPEHIKIAAKEMTADRIDQYFVKTK
FT                   EFEKFDVLTRLLDVERPELAIVFGRTKRRVDELIRGLKLRGYRAEGMHGDLDQNKRLAV
FT                   LRDFKAGHIDVLVATDVAARGLDVSGVTHVYNYDITQDQESYVHRIGRTGRAGKSGRSV
FT                   TFVSYNEMGYLRAIENMTKKPMKGLKPPTKEEAYQASLSVAMDDVLRDLSDDSAKAKLA
FT                   KFDKQAASLLEKFDAKELVALLLQGRVKDPDNQEEVKITAERPLPYNGEGKGFKKKGKG
FT                   GGGRYKGRGNGDRDGNRGGYRGNRDGKDGDRGGDRKRNWKDRDDNRGGYRGKRDDRRFD
FT                   DRKQGEKTPRKRTTGTEKSAGFVMRSRGDK"
FT   gene            355047..355958
FT                   /gene="eraL"
FT                   /locus_tag="L0155"
FT   CDS             355047..355958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eraL"
FT                   /locus_tag="L0155"
FT                   /product="GTP-binding protein Era"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.10 GTP-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:L0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04449"
FT                   /db_xref="GOA:P0A3C1"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A3C1"
FT                   /protein_id="AAK04449.1"
FT                   /translation="MTNNKFKSGFVAILGRPNVGKSTFMNHVMGQKIAIMSDKPQTTRN
FT                   KIQGIYTTENEQIVFIDTPGIHKPHNALGDFMVQSAYSTLRECDVVLFMVAADEPRSTG
FT                   ENMIIERLKKAEVPVILVVNKIDKIHPDRLFEIVADYTSQMEFSEVVPISAKQGNNTER
FT                   LIDTLSEKLDEGPQYFPEDQITDHPERFLVSEMIREKILLLTREEVPHSIAVTTDQMTR
FT                   DEETGKIHIMATIIVERKSQKGIILGKGGDMIRKIGKMARRDIEIMLGDKVYLETWVKI
FT                   KNDWRDRKMDLADFGYNRDDYM"
FT   gene            356055..357647
FT                   /gene="asnB"
FT                   /locus_tag="L00396"
FT   CDS             356055..357647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="L00396"
FT                   /product="asparagine synthetase B"
FT                   /note="EVIDENCE BY HOMOLOGY BIO01.03 Aspartate family.
FT                   ASPARAGINE BIOSYNTHESIS"
FT                   /db_xref="EnsemblGenomes-Gn:L00396"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04450"
FT                   /db_xref="GOA:Q9CIK5"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIK5"
FT                   /protein_id="AAK04450.1"
FT                   /translation="MCGFLFMETSDLTIEEFKSNLELIEHRGPDDQQHVRDTLGNDFGF
FT                   CRLSIMDLSDLGRQPFGLNGKRVMCNGEIYNFLSLRKFLETKGYKFTGDSDCEVLLPLF
FT                   ETTGIETMVKMLDAEFAFVLVDENTAEIFAARDPFGIRPLFYGYNKVTGKISFSSEAKA
FT                   LISTCNDVTPFPPGYYYANGEFHVFNDIAEVSTIVEEPLAEISGHIRRKLERAVKKRLH
FT                   ADAPMGYLLSGGLDSSLVCAIAAKELESPIKTFAIGMETDPIDLKYAREVADFLRTDHT
FT                   EILMTKEDVLSAVREVIWHLETWDITTIRASIGMYLICKYIHENTELKVLMTGEVSDEM
FT                   FGYKYTDFAPSAGAFQKEAQKRVHELYMYDVLRADRCLAAHSLEARVPFADLDFAAYVM
FT                   SINPSRKLNTYGKGKYLLRHAFEGTELLPDEILFREKAAFSDAVGHSMVDYLKEFADEK
FT                   YSDEDLAKASEKYPKHTPFTKESLMYREIFEEFYPGYEDWILDFWMPNRDWVGAEVTDP
FT                   SARVLSNYGDSGK"
FT   gene            357841..358659
FT                   /gene="mutM"
FT                   /locus_tag="L0271"
FT   CDS             357841..358659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="L0271"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:L0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04451"
FT                   /db_xref="GOA:Q9CIK4"
FT                   /db_xref="InterPro:IPR000191"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIK4"
FT                   /protein_id="AAK04451.1"
FT                   /translation="MPELPEVETVRRELEKRIVGQKIVSIEATYPRMVLTGFEQLKKEL
FT                   TGKTIHGISRRGKYLIFEIGEKDRLISHLRMEGKYRLASLNVPMEKHDHLALKFTDEQL
FT                   IYADVRKFGTWELISTDQVLPYFLKKNIGPEPTYETFDEQIFREKLQKSTKKIKPFLLE
FT                   QTLVAGLGNIYVDEVLWLAKIHPEKVANQLTESSIHLLHDSIIEILQKAIKLGGSSIRT
FT                   YSALGSTGKMQDELRVYGKTGEKCVRCGNEIQKIKVAGRGTHFCPFCQQK"
FT   gene            358813..359976
FT                   /gene="recA"
FT                   /locus_tag="L0260"
FT   CDS             358813..359976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="L0260"
FT                   /product="RecA protein"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:1514816 BIO10.02 DNA
FT                   replication, restriction, modification, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:L0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04452"
FT                   /db_xref="GOA:P0C2U4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C2U4"
FT                   /protein_id="AAK04452.1"
FT                   /translation="MATKKKTNFDDITKKYGAERDKALADALALIEKDFGKGSLMRLGE
FT                   AANQKVSVVSSGSLALDIALGAGGYPKGRIVEIYGPESSGKTTVALHAVAAVQKEGGIA
FT                   AFIDAENALDPEYAKALGVNIDELLLSQPDYGEQGLQIAEKLITSGAVDLVVIDSVAAL
FT                   VPKAEIDGEIGDSSVGLQARMMSQAMRKLAGHINKTKTTAIFINQLREKVGVMFGSPET
FT                   TPGGRALKFYASVRLDVRGSTKIEEGSGDNKTQIGKITKIKVVKNKVAPPFKVALVDIM
FT                   FGEGISRTGELLNIAVDEGIIKKSGAWFAYNDEKIGQGAEKAKNYLKEHQEIFDEIDHK
FT                   VRTAHGLLDEAEVAETTEDTSTKAKATKAKKEEKVVETEEIELELED"
FT   gene            complement(359989..361362)
FT                   /gene="ydgB"
FT                   /locus_tag="L160176"
FT   CDS             complement(359989..361362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgB"
FT                   /locus_tag="L160176"
FT                   /product="amino acid permease"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.02 TRANSPORT AND BINDING
FT                   proteinS. Amino acids, peptides and amines. similar to many
FT                   amino acid permeases"
FT                   /db_xref="EnsemblGenomes-Gn:L160176"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04453"
FT                   /db_xref="GOA:Q9CIK2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIK2"
FT                   /protein_id="AAK04453.1"
FT                   /translation="MNTNQNEENKPSQRGLKNRHIQLIAIAGTIGTGLFLGAGKSIHLT
FT                   GPSIIFVYLIIGALMYILLRAIGEMLYQDPNQHSFLNFVSRYLGEKPGYFIQWSYLLVV
FT                   VFVAMAELIAIGTYINFWLPDLPIWMTEVFVLVLLTLLNTLNPKFFGETEFWFGMIKIV
FT                   AIIGLILTAIILIFSHYHTGTDTVSVTNITKGFEFFPNGLSNFFESFQMVMFAFVSMEF
FT                   IGMTAAETDNPRPTLKKAINQIPIRIVLFYVGALLAIMSIYQWRDIPADKSPFVTIFQL
FT                   IGIKWAAALVNFVVLTSAASALNSALFSITRNLYSLSKLNNDKILKPFTKFSKAGVPVN
FT                   ALLFTSLLILFTPFISMIPAISNSFVFITSVATNLFLVVYLMTLITYLKYRKSSDFDPK
FT                   GFVLPAAHIFIPLAIAGFVLIFISLFCFKDTIVPAIGSVIWVLIFGLFTFFKKIKTAE"
FT   gene            complement(361431..362810)
FT                   /gene="ydgC"
FT                   /locus_tag="L161441"
FT   CDS             complement(361431..362810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgC"
FT                   /locus_tag="L161441"
FT                   /product="amino acid permease"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.02 TRANSPORT AND BINDING
FT                   proteinS. Amino acids, peptides and amines. similar to many
FT                   amino acid permeases"
FT                   /db_xref="EnsemblGenomes-Gn:L161441"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04454"
FT                   /db_xref="GOA:Q9CIK1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIK1"
FT                   /protein_id="AAK04454.1"
FT                   /translation="MENLQEKHEAQRGLQNRHIQLIAIAGTIGTGLFLGAGKTIQMTGP
FT                   SVIFAYILIGIAMFFFLRTIGEMLYNDPSQHSFLNFVTKYSGVRTGYFTQWSYWLVIVF
FT                   VCISELTAIGTYIQFWLPQVPLWLIEIVMLALLFGLNTLNSRFFGETEFWFAMIKVAAI
FT                   IGMIVTAIILVAGNFHYSTVLSGKTVHDSASLSNIFDGFQLFPHGAWNFVGALQMVMFA
FT                   FTSMEFIGMTAAETVNPKKSLPKAINQIPVRILLFYVGALLAIMAIFNWHYIPADKSPF
FT                   VMVFQLIGIKWAAALINFVVLTSAASALNSSLFSATRNMYSLAQQHDKGRLTPFTKLSK
FT                   AGIPINALYMATALSLLAPVLTLIPQIKNAFDFAASCTTNLFLVVYFITLYTYWQYRKS
FT                   EDYNPKGFLTPKPQITVPFIVAIFAIVFASLFFNADTFYPALGAIVWTIFFGLYSHYKK
FT                   I"
FT   gene            362957..363337
FT                   /gene="ydgD"
FT                   /locus_tag="L162952"
FT   CDS             362957..363337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgD"
FT                   /locus_tag="L162952"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   similar to YlbF protein of Bacillus subtilis, involved in
FT                   competence and sporulation development"
FT                   /db_xref="EnsemblGenomes-Gn:L162952"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04455"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIK0"
FT                   /protein_id="AAK04455.1"
FT                   /translation="MLIIDQNLLEIDNLLEKIMDEFLKFPEVEAYQKAKADFMADENLQ
FT                   SQLKTLQDNSEYIAFRPELRALQHEINLNEKVYAFRLAENDLQQILTALTKKITNSISE
FT                   QIYVDENLPLKGGQHGRHHGKH"
FT   gene            363312..363638
FT                   /gene="ydgE"
FT                   /locus_tag="L163307"
FT   CDS             363312..363638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgE"
FT                   /locus_tag="L163307"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. partial
FT                   homology with hypothetical YlbG protein of Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L163307"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04456"
FT                   /db_xref="GOA:Q9CIJ9"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIJ9"
FT                   /protein_id="AAK04456.1"
FT                   /translation="MDDIMESIEKKEIRPLFIKERIAVYVYCYSYKGTRQLSKFGDVVY
FT                   TSQKSNYSLLYVNNENLSDLLSKLKDLKFVKKVRVGHIKELDQNFSEAFAQTNLAVKEE
FT                   IERL"
FT   gene            363868..364386
FT                   /gene="ydgG"
FT                   /locus_tag="L163845"
FT   CDS             363868..364386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgG"
FT                   /locus_tag="L163845"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L163845"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04457"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIJ8"
FT                   /protein_id="AAK04457.1"
FT                   /translation="MLETHYYFTPILDHLEPFDHNDWHLYPIVTLPAAKQLRDAEDLPK
FT                   NIVSLNACYDRLRKVSLDYLTVNLYGRKQGRAFLLLLQDVLEETTILDYTVQVRQQILK
FT                   EIGVSTLNFMEYRSFAKRHLALMLKDFRKNDFQASPASLIMTNEECLKIEDCPHALLQQ
FT                   YLEQIEKTA"
FT   gene            complement(364451..365044)
FT                   /gene="ydgF"
FT                   /locus_tag="L164461"
FT   CDS             complement(364451..365044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgF"
FT                   /locus_tag="L164461"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. partial
FT                   homology with hypothetical YjbK protein Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L164461"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04458"
FT                   /db_xref="InterPro:IPR009195"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIJ7"
FT                   /protein_id="AAK04458.1"
FT                   /translation="MSTNLEIEYKSLLSLAEYDQLKKLFTHVTPVRQTNHYLDSKDFKL
FT                   RKKKLALRIRTFDKSAEMTLKVPQEVGNIEYNIDLSLEEAQQLLGERNIVCGETDLSEI
FT                   CELLTARDINLEEITLIGSLTTIRYEQHLPIGLAALDKNDYLGHTDYELELEVDDSKQG
FT                   KKDFFDFLDKNRVEYRFSKSKVVRFLDCLRHLRK"
FT   gene            365261..365905
FT                   /gene="ydgH"
FT                   /locus_tag="L165247"
FT   CDS             365261..365905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgH"
FT                   /locus_tag="L165247"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL..
FT                   homology with hypothetical YoaT protein of Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L165247"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04459"
FT                   /db_xref="InterPro:IPR008535"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIJ6"
FT                   /protein_id="AAK04459.1"
FT                   /translation="MEKVEEKYHLKDFWDFGLKQFRSAIFGITIILSLIVTTFIKIPHL
FT                   ARYDTLLICVIVIQMILLVSKYERAYDLIPIMVFHVLGMILEIFKVKHGSWSYPDAGLF
FT                   KIMDVPLYSAFMYSAIGSYIVRAIKEFDLEAINWPHWLMSIGISVLIYFAENIGSYFSA
FT                   WTYSYQLKAWQFVDLGKISSWTLLIIVSIIIVIELQRYFSKKIKVKNIIKN"
FT   gene            366114..366752
FT                   /gene="ydgI"
FT                   /locus_tag="L166082"
FT   CDS             366114..366752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgI"
FT                   /locus_tag="L166082"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   56% identical to YjbM protein of B.subtilis."
FT                   /db_xref="EnsemblGenomes-Gn:L166082"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04460"
FT                   /db_xref="GOA:Q9CIJ5"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIJ5"
FT                   /protein_id="AAK04460.1"
FT                   /translation="MDPYVQTVGELKIKFRGVRKQYLKKGLYSPIEFVTGRVKRRESIR
FT                   NKAKLRGYTRENLAEMEDIAGVRVMVQFVDDVWDVLELLRKRKDFKIIEERDYINNQKA
FT                   SGYRSYHVIVEYPIDTIDGFQIVNAEIQIRTLAMNFWATIEHSLNYKYGGLIPEDVKAR
FT                   LTNAAREAAQLDLEMGEIREDIQEAQLLFDSPQQKQDFKKENGEENELW"
FT   gene            366739..367551
FT                   /gene="ydgJ"
FT                   /locus_tag="L166614"
FT   CDS             366739..367551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgJ"
FT                   /locus_tag="L166614"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.. high
FT                   similarity to hypothetical proteins YjbN and YtdI of
FT                   Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L166614"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04461"
FT                   /db_xref="GOA:Q9CIJ4"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIJ4"
FT                   /protein_id="AAK04461.1"
FT                   /translation="MNFGKKVWLIGNSSEKSKKTLNKLSKILKAEHFVFDDINPEIVIS
FT                   VGGDGTLLRAMHMYEYQLDRVRFLGVHTGHLGFYTDFTDEDLFEVVEALYDENPAQAIH
FT                   YPLIRVQVSFTDGYQIVRHVLNEATIRRASKTMVGDVRISDYLFERFRGDGLSISTPTG
FT                   STAYNKSIGGAVVHPRVKAMQVAEIASLNNVVYRTLGSPMIVAEKDTITVCPAPEDDYS
FT                   LTFDQLTFEYKNIKSIEFSLDGTTISFANCAHTPFWERVSKSFIGEVE"
FT   gene            367551..368432
FT                   /gene="rluE"
FT                   /locus_tag="L167555"
FT   CDS             367551..368432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluE"
FT                   /locus_tag="L167555"
FT                   /product="pseudouridine synthase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO11.02 RNA synthesis,
FT                   modification, and DNA transcription. responsible for
FT                   synthesis of pseudouridine from uracil-2650 in 23S
FT                   ribosomal RNA. Belongs to family 2 of pseudouridine
FT                   synthases. There are three paralogs in L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L167555"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04462"
FT                   /db_xref="GOA:Q9CIJ3"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIJ3"
FT                   /protein_id="AAK04462.1"
FT                   /translation="MQFAFRNEIEGSMVKSMLSRHGISRRLLTKVKFDGGKITVNGQEK
FT                   NAIYRLEKDDLVTVTVPDEPDNEKLIPDDFPLNVLFEDDHYLVVEKPAGKPSITGSLHP
FT                   TGAMSNAVKGYISQKNYANQTVHIITRLDRDTSGLMFLAKHRYAHALMNQHKFRDTMEK
FT                   RYFAIVNDQDLPDSGRIDLPIGRRDDSIIQRQVRFDEKAKDALTSYVVAERKNDLALLD
FT                   IILHTGRTHQIRVHFSHLGYPLIGDDLYGGNHDLISRQALHCHHLQFLNPFTDEMVHVE
FT                   LDMPEDMKNLLK"
FT   gene            complement(368474..369304)
FT                   /gene="ppiA"
FT                   /locus_tag="L168484"
FT   CDS             complement(368474..369304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiA"
FT                   /locus_tag="L168484"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.04 TRANSLATION protein
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:L168484"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04463"
FT                   /db_xref="GOA:Q9CIJ2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIJ2"
FT                   /protein_id="AAK04463.1"
FT                   /translation="MNTNKKNNTILFTIFGIVLVIVVGLLVFFANRPKTTDNTASSTST
FT                   SSSQKVDYPTNYKLHDAVKNSTTALNDLTLPQLSTTVAEDEAEVEIKTTAGNINIKLFP
FT                   KLAPNAVQNFLVLAKNGYYKNNEFFRVIKDFMIQSGDPSNQGTGTASIFGGKTFDTEIS
FT                   NQLYNIRGALALANTGQASSSSSQFFIVQNSQDMTSQIQDKTKYPQKIIDAYKKGGYPS
FT                   LDGSYTVFGQVISGMDVVDKIAKAEVTSSGSGEASSPVDPVKIKSVKILKNWKF"
FT   gene            369615..371048
FT                   /gene="lysQ"
FT                   /locus_tag="L169610"
FT   CDS             369615..371048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysQ"
FT                   /locus_tag="L169610"
FT                   /product="lysine specific permease"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.02 TRANSPORT AND BINDING
FT                   proteinS Amino acids, peptides and amines. there is another
FT                   lysine specific permease LysP"
FT                   /db_xref="EnsemblGenomes-Gn:L169610"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04464"
FT                   /db_xref="GOA:Q9CIJ1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIJ1"
FT                   /protein_id="AAK04464.1"
FT                   /translation="MENQNQVKRNLKQRHITMIALGGTIGTGLFLTSGATISQAGPWGA
FT                   VLAYCFIGIMVYFVMTSLGEMATYLPTSGSFSDYGGRYVDPAFGFALGWNYWLNGAITI
FT                   AVDLTTAGLITQFWFPHLPSWIFSGIATVLIFIINVMAVGAFGETEYWLSTIKVITIVL
FT                   FLAIGLLTIFGVLGQGNVDVVANLSAGNHGFVGGISGFVGVLLIAGFSFQGTELLGITA
FT                   GESEDPGKSIPKAMNSIFWRILLFYIFSIIVIAAIINFKDPRLLNPNSTAVMSPFTIVF
FT                   KNIGFAVAASVMNAVILTSVISSANSVMYASTRILYSLGQEKGAPKFFGRTAKNGIPFY
FT                   ALLATTIICFIAFLTGIFGTQIYLFLVDLSSLTGFLAWLGISISHIRFRRAYIAQGKKL
FT                   EDLPYKAKWFPFGPIVALLMTAAIAINLDPAMLFSEHWGEGLALYAAIPIFIILYFGYK
FT                   WKYNTKIIPLEEVDLSREK"
FT   gene            371163..371975
FT                   /gene="ydhB"
FT                   /locus_tag="L171116"
FT   CDS             371163..371975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhB"
FT                   /locus_tag="L171116"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL"
FT                   /db_xref="EnsemblGenomes-Gn:L171116"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04465"
FT                   /db_xref="GOA:Q9CIJ0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIJ0"
FT                   /protein_id="AAK04465.1"
FT                   /translation="MKFIAIVGTNASFSYNRKLLWYMKKHFTKEAQIEIVEITDLPLFS
FT                   EDIREIPEGVQKIAEAIREEDGLIFSTPEYDHAITAALKSLIEWLSWIKPQPLNSLPVM
FT                   IVGVSLGNMGTVFAQENLRQILSSPGLDAFVLPSNQFLLGRAAEAFNQQDELIDERTIS
FT                   WLEHCFNNFMIYSKTLKPMRLPSLKKENNKEIIESEESKNSTETDEVWWTKETNQGLPV
FT                   LSDADTGASEYEEVIEPENSAYLQFLEEGETWKFDDIGELRGKSEEED"
FT   gene            371975..372952
FT                   /gene="ydhC"
FT                   /locus_tag="L171943"
FT   CDS             371975..372952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhC"
FT                   /locus_tag="L171943"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL..
FT                   homology with hypothetical protein TP0796 Treponema
FT                   pallidum"
FT                   /db_xref="EnsemblGenomes-Gn:L171943"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04466"
FT                   /db_xref="GOA:Q9CII9"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CII9"
FT                   /protein_id="AAK04466.1"
FT                   /translation="MKILEKKSTLKISKTYRALGTVISLTIYGHQDEELLDKTYQLIKY
FT                   YEQLFTVNRDQSELMAVNHKAGIEPVQVSGAVYGLTKIALEKSKEAFGFNAAIGPLVKL
FT                   WHIGFSDAKLPTQAEIDEKLKIINPDRIILRDDEFSIFLPEKGMEIDLGAIAKGYIADR
FT                   IKDFWHAYGISSGIINLGGNLLLVGEAPHQTDKKWRIGIRNPLTNDKKSVLQLLSGEGS
FT                   VVTSGISERYLKVNDKIYHHIIDSKTGYPHHNQLASVTILSKKSIDGEIETTRLFFADG
FT                   PIENWLTENPEVYGAIFISKDKKIKAVGIPQSQIYVADQSFEFE"
FT   gene            373134..373424
FT                   /gene="ydhD"
FT                   /locus_tag="L173048"
FT   CDS             373134..373424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhD"
FT                   /locus_tag="L173048"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.04 Transposon related
FT                   functions"
FT                   /db_xref="EnsemblGenomes-Gn:L173048"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04467"
FT                   /db_xref="GOA:Q9CB12"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CB12"
FT                   /protein_id="AAK04467.1"
FT                   /translation="MARRKFDKQFKNSAVKLILEEGYSVKEVSQELEVHANSLYRWVQE
FT                   VEEYGESAFPGNGTALADAQHKIKLLEKENRYLKEELELLKKFRVFLKRSK"
FT   gene            373520..374281
FT                   /gene="tra904D"
FT                   /locus_tag="L0460"
FT   CDS             373520..374281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra904D"
FT                   /locus_tag="L0460"
FT                   /product="transposase of IS904D"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:1328163 BIO14.04
FT                   Transposon related functions. BELONGS TO THE
FT                   IS3/IS150/IS904 FAMILY OF TRANSPOSASE. There are 9 such
FT                   elements in the chromosome"
FT                   /db_xref="EnsemblGenomes-Gn:L0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04468"
FT                   /db_xref="GOA:Q9CB04"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CB04"
FT                   /protein_id="AAK04468.1"
FT                   /translation="MHRRPSKQQVEREILSEKIKAVFHEHKGRYGAVRITKVLHNTGIM
FT                   TNTKRVGKLMHLMGLYAKGSRYKYKHYNRKGASLSRPNLINQIFKATAPNKVWLGDMTY
FT                   IPTKEGTLYLAVNIDVFSRKIVGWSISSRMQDKLVRDCFLQACGKEHPQPGLIVHTDQG
FT                   SQYTSSRYQSTLRQVGAQSSMSRKGNPYDNAMMESFYKTLKRELINDAHFETRAEATQE
FT                   IFKYIETYYNTKRMHSGLDYKSPKDFEKYNS"
FT   gene            374338..374895
FT                   /gene="ydhE"
FT                   /locus_tag="L37953"
FT   CDS             374338..374895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhE"
FT                   /locus_tag="L37953"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.04 Transposon related
FT                   functions"
FT                   /db_xref="EnsemblGenomes-Gn:L37953"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04469"
FT                   /db_xref="GOA:Q9CB10"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CB10"
FT                   /protein_id="AAK04469.1"
FT                   /translation="MVKYSIELKQRIIQDYLSGKGGSTYLAKLHNVGSSSQVRHWIRNY
FT                   RAEGLPTAHSKVNKNYSMELKENAVQCYLTTDLTYEAVARKFEITNFTLLASWVNHFKI
FT                   YGEVPISKKRGRRKKLESIASSMTQNPNDSQRIKELEQELRYAQIEVAYLKGLRRLEKN
FT                   ALMNKNQDSSTVSVKPSNSKKS"
FT   gene            374892..375710
FT                   /gene="tra1077C"
FT                   /locus_tag="L0468"
FT   CDS             374892..375710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra1077C"
FT                   /locus_tag="L0468"
FT                   /product="transposase of IS1077C"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:1328163 BIO14.04
FT                   Transposon related functions. BELONGS TO THE
FT                   IS3/IS150/IS904 FAMILY OF TRANSPOSASE. There are 7 such
FT                   elements in the chromosome"
FT                   /db_xref="EnsemblGenomes-Gn:L0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04470"
FT                   /db_xref="GOA:Q9CII8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CII8"
FT                   /protein_id="AAK04470.1"
FT                   /translation="MKVTGFPKATYYYWVNCFERVNKDELIEKEMLKIRQEHANAGYRP
FT                   MRELLKQRGYHVNHKKVQRLMKKLGLRVTSYWHKSRKYNSYKGKVGTVAKNKLHRRFRT
FT                   SIPHQKITTDTTEFKYYEDGIQKKCYLNPYIALFNSEVISYHISKQPSYQSIDIALNQA
FT                   LAVTSDCPYRRTFHSDQGWGYQMRDYVSKLKSHRIFQSMSRKGNCHDNSVMENFFGLLK
FT                   QEIYYGHIFSSFEELEQVIVIWIRYYNTKRIKQKLNWMSPIQFRLNYQNN"
FT   gene            complement(375784..377268)
FT                   /gene="lysS"
FT                   /locus_tag="L0347"
FT   CDS             complement(375784..377268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="L0347"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.01 Amino acyl tRNA
FT                   synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:L0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04471"
FT                   /db_xref="GOA:Q9CII7"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CII7"
FT                   /protein_id="AAK04471.1"
FT                   /translation="MAEIEELNDQMKVRREKMENLREAGIDPFGHKFTRTHNSQELHEA
FT                   YDEKTKEELHELALSGIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDEVGEENYEI
FT                   FKKADLGDFLGVEGEIMKTDMGELSIKAKKLTFLSKALRPLPEKFHGLTDTETRYRKRY
FT                   LDLISNKESFNRFVTRSKIISEIRRYMDGRGYLEVETPVLNNEAGGAAARPFYTHHNSL
FT                   DIDMALRIATELHLKRLIVGGMEKVYELGRVFRNEGMDMTHNPEFTTMESYEAYADFED
FT                   IMDLTEGIFQHVAKTVVGQDVLEYDGKEINVGGKFKRVHMVDAIKEVAGVDFWPEMTFE
FT                   EATALAKEHDIHVEKHFTSVGHIINEFFEKYVEETLIQPTFVFGHPKEISPLAKMNEKD
FT                   PRFTDRFELFINGKEYANAFSELNDPIDQLERFEAQAKAKELGDDEATGVDYDYVEALE
FT                   HGMPPTGGLGIGIDRLVMLFTGTTSIRDVLLFPTMK"
FT   gene            complement(377467..378285)
FT                   /gene="rlrG"
FT                   /locus_tag="L0220"
FT   CDS             complement(377467..378285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlrG"
FT                   /locus_tag="L0220"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.04 LysR-family
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:L0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04472"
FT                   /db_xref="GOA:Q9CII6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CII6"
FT                   /protein_id="AAK04472.1"
FT                   /translation="MFALLETFIAVFETKSFTRAANQCFISQPTATVRIKKLEEELKVH
FT                   LFSRGQHQEVIPTESAHLLYPKALKTLNDWNELQFSLKNQTPSRKPFKIAASHSSATTV
FT                   LPLIFKNLIPELEQLNIELMMLDSQEVFDLIRNHEIHFGIIEKPMMDETIETFPLFKDE
FT                   LVLAGNPESDIFFIREAGSGVAHYTHNYLKENNLNPKNLVSVNNNDMIVSQLKAGIGLS
FT                   LISKRFINENIAFQNLGERYQRIFYGLSFLSEQDKLLKTVIKKIKNLSEF"
FT   gene            378449..379444
FT                   /gene="ydhF"
FT                   /locus_tag="L178384"
FT   CDS             378449..379444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhF"
FT                   /locus_tag="L178384"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL"
FT                   /db_xref="EnsemblGenomes-Gn:L178384"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04473"
FT                   /db_xref="GOA:Q9CII5"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CII5"
FT                   /protein_id="AAK04473.1"
FT                   /translation="MSILPGFLLSFAIAIVSYLLNRFIFHSLGSATIAILLGIILGNLY
FT                   FKQVTLFAGTAWSEKKLLEFSVMFLGATVTFQTIGKLGFSGVGFILIQMISTIIFVLFM
FT                   GKKLGFSANVSALMASGNAVCGSSAIAAVEPVIGAETSEKRTSIAMVNLMGTILMLSLP
FT                   FLGTWMFGNNDLLRGALIGGTEQSVGQVVASATMVNPNTTTLATLFKIMRIIMLVFVVL
FT                   YFGFRSKKQKRNEQGPTQIKIKRNSFLPWYVLGFLVLCTLDTLIHFVPEVSATAKFLSG
FT                   WCETIALAAIGLRLNLVEFIKAGKKLLIYGLSTLVFQVVLALILISLLIK"
FT   gene            complement(379657..380601)
FT                   /gene="ldhB"
FT                   /locus_tag="L0018"
FT   CDS             complement(379657..380601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldhB"
FT                   /locus_tag="L0018"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.09 Glycolysis. can be
FT                   malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:L0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04474"
FT                   /db_xref="GOA:Q9CII4"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CII4"
FT                   /protein_id="AAK04474.1"
FT                   /translation="MKITSRKVVVIGTGFVGTSIAYSMINQGLVNELVLIDVNQDKAEG
FT                   EALDLLDGVSWGQENVIVRAGDYKDCKNADIVVVTAGVNQKPGQSRLDLVNTNAKIMRS
FT                   IVTQVMDSGFDGIFVIASNPVDILTYVAWETSGLDQSRIVGTGTTLDTTRFRKELATKL
FT                   EIDPRSVHGYIIGEHGDSEVAVWSHTTVGGKPILEFIVKNKKIGVEDLSNLSNKVKNAA
FT                   YEIIDKKQATYYGIGMSTARIVKAILNNEQAILPVSAYLRGEYGQEGVFTGVPSIVNQN
FT                   GVREIIELNIDAYEKKQFEKSVSQLKEVIESIK"
FT   gene            complement(380895..381716)
FT                   /gene="rlrD"
FT                   /locus_tag="L0217"
FT   CDS             complement(380895..381716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlrD"
FT                   /locus_tag="L0217"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.04 LysR-family
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:L0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04475"
FT                   /db_xref="GOA:Q9CII3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CII3"
FT                   /protein_id="AAK04475.1"
FT                   /translation="MFSLFETFIVVYETKSFTLAGKYLFISQPTVTVRIKKLEEELKST
FT                   LFLRGKHQEIIPTEAAILFYPKAIAYLKKWEEDQAEVQKKSLAKHPFKIGVSHSAALSI
FT                   MPGIFKVFEGELEHLDVEINMYDSEKVFELVANHDLHFGIIERLLISDQTETFPLFLDE
FT                   LVLAGNTDSETFFTRESGSGIGYYIKRYLKSAPSAQRNIVRMNSNEMIISHIKAGLGSS
FT                   LISKSFLTDDIPYQELGSNYHREFLGVSFDEEKDPMIQKLISKIKKETEIH"
FT   gene            381871..382845
FT                   /gene="ydiA"
FT                   /locus_tag="L181867"
FT   CDS             381871..382845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiA"
FT                   /locus_tag="L181867"
FT                   /product="permease"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS. General. tellurite resistance protein or related
FT                   permease, evidenced by COGnitor"
FT                   /db_xref="EnsemblGenomes-Gn:L181867"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04476"
FT                   /db_xref="GOA:Q9CII2"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CII2"
FT                   /protein_id="AAK04476.1"
FT                   /translation="MMYSKFISFLKQIPLPICGLILGLISLGNLLYSKGYPILGNSYDM
FT                   LGLFLMFLILLKIVLAMKHTISTLNDPIVASVSPTFTMSLMVLSVFLKRLSGFSLLANV
FT                   TWWTALILHLILMMYFIYLHVLPKELKIHDVYPSWFITFVGIGVISATSPDFGLEVGKV
FT                   VVWITLLFYFILLPIVMHRVFILRKMHKSLLPLITIITAPGSLGLVGYLTVVEAKSKIF
FT                   VIFLFILSQAIYFITLGLLTKLLRSAFYPSYAAFTFPLVISATAVNLTSKLSVFQFLNL
FT                   ELLANMEILIAIAIVTYVLIRYCIFLGSKLVQIMSEKYSPESI"
FT   gene            383134..384354
FT                   /gene="ydiB"
FT                   /locus_tag="L183112"
FT   CDS             383134..384354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiB"
FT                   /locus_tag="L183112"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   SIMILARITY TO THE PROBABLE THIAMIN BIOSYNTHESIS protein
FT                   THII, REQUIRED FOR THE SYNTHESIS OF THE THIAZOLE MOIETY."
FT                   /db_xref="EnsemblGenomes-Gn:L183112"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04477"
FT                   /db_xref="GOA:Q9CII1"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CII1"
FT                   /protein_id="AAK04477.1"
FT                   /translation="MTVLYDEIMVRYGELSTKGKNRGYFINRLAKNIREVLADMPELKI
FT                   TAVRDRAHIELNGADYAEVSNRLTKVFGIQNFSPSIKVEKSMPIIKEEVVALFKEIYSE
FT                   GQTFKIATRRADHNFELDSTELNIALGDVVFDNFSYAKVQMKKPDITLRAEIRQDAAYL
FT                   SFEDIKGAGGMPVGTAGRGHLMLSGGIDSPVAGYLALKRGVEIEAVHFASPPYTSPGAL
FT                   KKAKDLAAKLTVFGGSITFIEVPFTEIQEEIKAKAPQAYLMTITRRFMMRVVDRVREER
FT                   GGKVIINGESLGQVASQTLGSMSAINEVTNTPVIRPVVTMDKNEIIEIAEKIDTFNLSI
FT                   LPFEDCCTVFAPPSPKTNPKLENCIQYEKRMDVEGMVDRAVKGIMLTTIIGENWDQTEE
FT                   EEFADFL"
FT   gene            384568..385971
FT                   /gene="ydiC"
FT                   /locus_tag="L184516"
FT   CDS             384568..385971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiC"
FT                   /locus_tag="L184516"
FT                   /product="efflux pump antibiotic resistance protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.08 TRANSPORT AND BINDING
FT                   proteinS Multidrug resistance"
FT                   /db_xref="EnsemblGenomes-Gn:L184516"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04478"
FT                   /db_xref="GOA:Q9CII0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CII0"
FT                   /protein_id="AAK04478.1"
FT                   /translation="MSDRIKALIALGIFTFMSTLDGSIVNIALPTMSKELHVSTSQITW
FT                   VVTIYLIVISAIVLIFGRLGDLIGKSRIARIGWGIFILGSALAGLNFGWGLGFLLFARV
FT                   IQAIGASMFMATGFGIISEIFPPESRARALSISAMFVSVGSIAGPALGGLILQVASWNY
FT                   IFWINVPIGILAWIFGNHALPKEKTSGKWSDIDFKGGTLMTSVIVLLFLALNFGQALGW
FT                   TNPLIIIGALLGFILFGIFILTEKKVAQPLLDLGIFKSKLFSMSIIMALFNFTVAMFSS
FT                   ILLPFYLQDFRNYGPGLAGMIMMAYPVAMLIASPLAGSAADKMDKEIVTFVGISGIVLS
FT                   QLGYLLINPHSAPWLVVVILLIQGMSMGIFQSPNNALIMETVDRKYLGIAGSVNSLARN
FT                   MAFVLGTSLATLILFTAMSNQLGYKVTTYLHNQPDVFLHGFHVAFYFSTFLVLVTWVLG
FT                   LFRLLGRKK"
FT   gene            386132..386737
FT                   /gene="ydiD"
FT                   /locus_tag="L186107"
FT   CDS             386132..386737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiD"
FT                   /locus_tag="L186107"
FT                   /product="acyl carrier protein phosphodiesterase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO07.01 FATTY ACID AND
FT                   PHOSPHOLIPID METABOLISM. General"
FT                   /db_xref="EnsemblGenomes-Gn:L186107"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04479"
FT                   /db_xref="GOA:Q9CIH9"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIH9"
FT                   /protein_id="AAK04479.1"
FT                   /translation="MSKLLVVKGHPLTADYSLSLKGLDAFVKAYKAAHPEDEIEELDVF
FT                   SADIPTLNTELVSAMFAGENAELTASQKDKLARFAGFTEQFLSADKVVIANPMYNLMIP
FT                   AELKSWVDTVNVAGKTFKYTAEGPVGLANGKKVLHLQANGGVYGAQDPATIYMSAIFNF
FT                   IGSDFRQIAVEGHAYDPEKTEELLSEFINKVELEAQTF"
FT   gene            386834..387268
FT                   /gene="ydiE"
FT                   /locus_tag="L186839"
FT   CDS             386834..387268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiE"
FT                   /locus_tag="L186839"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved. there are three paralogs in L.lactis"
FT                   /db_xref="EnsemblGenomes-Gn:L186839"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04480"
FT                   /db_xref="GOA:Q9CIH8"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019905"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIH8"
FT                   /protein_id="AAK04480.1"
FT                   /translation="MVKHLFNSHIDWVGGRNSIGDLQAGALNEKISIPKTMDGPGVGTN
FT                   PDEMLLGAASTCYSITLAAMLERNDILLEHLKVDAKGIVDVTKGTFTYEKITYHVAMKL
FT                   TKESDEVKAIKLAKRAESSCMISRAIQGNIELETIIRIEK"
FT   gene            complement(387304..389346)
FT                   /gene="ydiF"
FT                   /locus_tag="L187315"
FT   CDS             complement(387304..389346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiF"
FT                   /locus_tag="L187315"
FT                   /product="Na+/H+ antiporter"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.05 TRANSPORT AND BINDING
FT                   proteinS. Cations"
FT                   /db_xref="EnsemblGenomes-Gn:L187315"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04481"
FT                   /db_xref="GOA:Q9CIH7"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIH7"
FT                   /protein_id="AAK04481.1"
FT                   /translation="MLHIIFYVIVFLLVLVFSNVLNKVFPKLALPLIQVVLGLILGFFG
FT                   ADEVLHVAPEFFLGFIIAPLLFRESEEADVKHILKHSKIILVLIFPLVFITTLGLGLIS
FT                   NWIYMGLPLAACFALGASLAPTDAVAVGALSKNFSFPRRVMSVLQGEGLLNDASGIISF
FT                   QIALVALVTGYFSFPDATMKLVISALGGAAIGFTLIYIKGLVLRLLEDVDARDVSGYLL
FT                   LELVVPLAAFLISEELHVSGIIAAVVAGVMSANGLKRTTLFDAQVEKLKSTIWDTLTFI
FT                   LNSFVFLFLGIELYQLVVPLLVDPVYSSALLIVLALALTAGLFALRFIVIAFYYWLRSL
FT                   KQKQPFSAYWNDVFLLTFAGSKGTVSIATILLVPRTVDVQPVLVFLAAAVTGLSFLVGM
FT                   FILPFFAVKKVSKVNNISKIAILSEVVDELHQDMKSAKNPQGYDIAIDAYQERIQQLII
FT                   EQESTDMAIDYNDLQLLIIRIESEGLEVALRENKISMYTYRTYQRYIRSLETSIVHSLV
FT                   SSIQFVYVIALRAFHLLTSRVLHVDFYFKKTKAAMETTRDEITELYFNNTELILQALDN
FT                   LNGVFDEQLLNFLQSERLRTSEIVATGGHISRMMNKAQPNNITEMMRAYYLERKVIFEH
FT                   ELSGAITAREAKDMRLNVNILEDYSLASNHHTLLFDFLERRKNKN"
FT   gene            complement(389437..389907)
FT                   /gene="ydiG"
FT                   /locus_tag="L189448"
FT   CDS             complement(389437..389907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiG"
FT                   /locus_tag="L189448"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L189448"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04482"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIH6"
FT                   /protein_id="AAK04482.1"
FT                   /translation="MIDKKFEDKLNKLREMYINKRPEESEKLDDSKKFEAFMALSDEEK
FT                   EEKLNAKLELLTDKLVTLDEKLGDLLAKNASADDISELKYYIDAVKNKKLILEQKLELI
FT                   KNGEFDAARKERVKRQLTDLELKRCKALLGKKDCSKINEKIALKKKAINRLK"
FT   gene            complement(390031..391290)
FT                   /gene="tyrS"
FT                   /locus_tag="L0359"
FT   CDS             complement(390031..391290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="L0359"
FT                   /product="tyrosyl-tRNA synthetase 1"
FT                   /EC_number="6.1.1.1"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.01 Amino acyl tRNA
FT                   synthetases and tRNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:L0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04483"
FT                   /db_xref="GOA:Q9CIH5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIH5"
FT                   /protein_id="AAK04483.1"
FT                   /translation="MNIFDELKARGLVFQTTDEAALSKALTEDMVSYYVGYDPTADSLH
FT                   LGNLVLILTMKRLQMAGHKPYALVGGATGLIGDPSFKDSERSLQTKDTVTKWSGKIRSQ
FT                   LERFLDFENGENKAEMTNNYNWFENLTFIDFLRDVGKHFTVNYMISKDSVKSRMESGIS
FT                   YTEFAYQIMQGYDFYELNQLHNVTLQLGGSDQWGNMTAGTELLRRKANKQGHVITIPLI
FT                   TDSTGKKFGKSEGNAIWLDADKTSPYEMYQFWLNVDDADAVKMLKIFTFLSLEEIAEIE
FT                   EQFEAARHERLAQKVLAREVVSLVHGKAAYEQAVKTSEILFGGGDLRQLDAKSILTGLK
FT                   AAPQHQVTDDEDLTLVELLISAGIAPSKRQAREDITNGAIYINGERVQALDYVITDSDK
FT                   IENRLTVIRRGKKKNFVLTY"
FT   gene            391435..393840
FT                   /gene="pbp1B"
FT                   /locus_tag="L191431"
FT   CDS             391435..393840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp1B"
FT                   /locus_tag="L191431"
FT                   /product="penicillin-binding protein 1B"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.02 CELL ENVELOPE Murein
FT                   sacculus and peptidoglycan"
FT                   /db_xref="EnsemblGenomes-Gn:L191431"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04484"
FT                   /db_xref="GOA:Q9CIH4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIH4"
FT                   /protein_id="AAK04484.1"
FT                   /translation="MKKSSIDSQEEARARLKEKMENKRRKQSKSLSKNPKDNDEKSGWS
FT                   ITFKVVRGLIVIFGIIFALVGVFGAATGVGYFARLVEQTKTPNKTEMLAKINDIHGVSV
FT                   INYSNGQAISDISSDLVRVTVKSDEISPNVKNALIATEDDSFKTNKGVVPKAVVRGILG
FT                   SVGGGTSSGGSTLTQQLIKQQVLGDSVTFQRKASEIVYALKLNSYLSKDQILTDYLNVS
FT                   PFGRNNKGQNIAGIQEASLGIFGKSAKDLTIPEAAFIAGLPQSPIVYSPYAADGSLKSK
FT                   ENMSYGLERQKEVLFYLYRGGYISEADYKKYKAYDISTEFLQPGVAQSQEHGYLYNVVY
FT                   NEAITDIYNYLIKRDKVSATDLGNDSTKQRYRELAEQSLQNGGYTVTTTINQQVYDAMQ
FT                   NAVTNYSGLMQDGTGLIQTGNVLMDNKTGAVYGFIGGLDFSQSQVNHAFDTKRSPGSSI
FT                   KPILAYGPAIDMGLMGSASVLSNYPAKYSSGQDIEHVGNKGTEMMPFSEALNVSYNIPA
FT                   YWTYQTILNKGKSVEPYMTKMGYDVADYSVESLPLGGGIDPTVVQHTNGYQTLANGGKY
FT                   EPWYIVDSIKDDTGNVIYQHQSTGGTQVYSEATSTIMEYMLQDAIKSQKTSKFYGELQS
FT                   LNSSLATNVQWAGKTGTTDNYTDVWMMLSTPSVTLGSWAGHDDNSAMSQNSGFINNAKF
FT                   TANLVNAINAADPNIFGPGQKFTDPNSDPNVTKSKVLVSTGEKPGKVNVKLSNGKTQEV
FT                   NLGGDTTTSFWATKSGAPTTTYDFSIGGSASDIAAGWKKILPNYNFGQ"
FT   gene            complement(393898..394965)
FT                   /gene="pepA"
FT                   /locus_tag="L193909"
FT   CDS             complement(393898..394965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="L193909"
FT                   /product="glutamyl aminopeptidase"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:8535515 BIO12.02
FT                   Degradation of proteins, peptides, and glycopeptides"
FT                   /db_xref="EnsemblGenomes-Gn:L193909"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04485"
FT                   /db_xref="GOA:Q9CIH3"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017538"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIH3"
FT                   /protein_id="AAK04485.1"
FT                   /translation="MELFDKVKALTEIQATSGFEGSVRDYLKTRMIALGYQPEFDGLGG
FT                   IFVTKTSKVANAPRIMIAAHMDEVGFMVSSIKADGTFRVVPLGGWNPLVVSGQRFTLFT
FT                   RTGKKIPVVTGGLPPHLLRGTGVTPQIPAISDIVFDGAFENAAEATEFGIAQGDVIIPE
FT                   TETILSANGKNIISKAWDNRYGCLMILELLGFLADKELPATLIIGANVQEEVGLRGAKV
FT                   STTMFKPDLFFAVDCSPASDTFGDDNGRLGEGTTLRFFDPGHIMLPGMKNFLLETADKA
FT                   KVKTQVYMAKGGTDAGAAHLANNGVPSTTIGVVARYIHSHQTIFNIDDFNQAQTFLRNI
FT                   VTSLSTEKVAEIKNY"
FT   gene            395161..395352
FT                   /gene="ydjB"
FT                   /locus_tag="L195067"
FT   CDS             395161..395352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjB"
FT                   /locus_tag="L195067"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L195067"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04486"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIH2"
FT                   /protein_id="AAK04486.1"
FT                   /translation="MIHELTDRARQHFSTRKIDAFWIFEEPTTGALFEGGLVSENKAIT
FT                   FEINAKTLEVFEKNEKIL"
FT   gene            395394..395711
FT                   /gene="trxH"
FT                   /locus_tag="L195348"
FT   CDS             395394..395711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxH"
FT                   /locus_tag="L195348"
FT                   /product="thioredoxin H-type"
FT                   /note="EVIDENCE BY HOMOLOGY BIO02.10 Thioredoxin,
FT                   glutaredoxin, and glutathione. similar to the thioredoxin
FT                   H-type from plants."
FT                   /db_xref="EnsemblGenomes-Gn:L195348"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04487"
FT                   /db_xref="GOA:Q9CIH1"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIH1"
FT                   /protein_id="AAK04487.1"
FT                   /translation="MIIPENIENLAELVKGPEKTVFFFTAGWCGDCNFIKPKMPEIEVE
FT                   NPDFKFVEVDRDEYMDLAIEWGIMGIPSFVVIEDGKEKARLVNKLRKTKEEVNTFLASA
FT                   K"
FT   gene            395797..396423
FT                   /gene="ydjD"
FT                   /locus_tag="L195751"
FT   CDS             395797..396423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjD"
FT                   /locus_tag="L195751"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. homolog
FT                   to YtpR B.subtilis, has local similarity to similarity to
FT                   phenylalanine tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:L195751"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04488"
FT                   /db_xref="GOA:Q9CIH0"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027855"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIH0"
FT                   /protein_id="AAK04488.1"
FT                   /translation="MIATYNTNVGDVLMLITANDKGEKVNFERKGKVARVFIEETGATV
FT                   AWNIFEAKSLLANLSGNGQVVLSSDDIETLNKELGKSGFSDVLVHDAQPKFVVAEIVEM
FT                   EDHPDSDHLHICKVNVGFADPVQIVCGAPNAALGLKTVAALPGAMMPNGSLIFPGALRG
FT                   VQSYGMLCSARELELPNAPEVRGIIELSSDLSAGKAFDSETMWQA"
FT   gene            396586..397926
FT                   /gene="noxE"
FT                   /locus_tag="L196579"
FT   CDS             396586..397926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="noxE"
FT                   /locus_tag="L196579"
FT                   /product="NADH oxidase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.01 ENERGY METABOLISM.
FT                   Aerobic"
FT                   /db_xref="EnsemblGenomes-Gn:L196579"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04489"
FT                   /db_xref="GOA:Q9CIG9"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIG9"
FT                   /protein_id="AAK04489.1"
FT                   /translation="MKIVVIGTNHAGIATANTLIDRYPGHEIVMIDRNSNMSYLGCGTA
FT                   IWVGRQIEKPDELFYAKAEDFEKKGVKILTETEVSEIDFTNKMIYAKSKTGEKITESYD
FT                   KLVLATGSRPIIPNLPGKDLKGIHFLKLFQEGQAIDEEFAKNDVKRIAVIGAGYIGTEI
FT                   AEAAKRRGKEVLLFDAESTSLASYYDEEFAKGMDENLAQHGIELHFGELAQEFKANEKG
FT                   HVSQIVTNKSTYDVDLVINCIGFTANSALAGEHLETFKNGAIKVDKHQQSSDPDVSAVG
FT                   DVATIYSNALQDFTYIALASNAVRSGIVAGHNIGGKSIESVGVQGSNGISIFGYNMTST
FT                   GLSVKAAKKIGLEVSFSDFEDKQKAWFLHENNDSVKIRIVYETKNRRIIGAQLASKSEI
FT                   IAGNINMFSLAIQEKKTIDELALLDLFFLPHFNSPYNYMTVAALNAK"
FT   gene            398016..398405
FT                   /gene="ssbA"
FT                   /locus_tag="L0299"
FT   CDS             398016..398405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssbA"
FT                   /locus_tag="L0299"
FT                   /product="single-strand binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO10.02 DNA replication,
FT                   restriction, modification, recombination, and repair. THIS
FT                   protein IS INVOLVED IN DNA RECOMBINATION AND REPAIR"
FT                   /db_xref="EnsemblGenomes-Gn:L0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04490"
FT                   /db_xref="GOA:Q9CIG8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIG8"
FT                   /protein_id="AAK04490.1"
FT                   /translation="MNKTMLIGRLTSAPEISKTTNDKSYVRVTLAVNRRFKNEKGEREA
FT                   DFISIIIWGKSAETLVSYAKKGSLISIEGEIRTRNYTDKQNQKHYVTEILGLSYDLLES
FT                   RATIALRESAIKTEETLLDAEELPF"
FT   gene            398525..398809
FT                   /gene="groES"
FT                   /locus_tag="L198515"
FT   CDS             398525..398809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="L198515"
FT                   /product="10 KD chaperonin"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:8486277 BIO04.03
FT                   Chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:L198515"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04491"
FT                   /db_xref="GOA:P37283"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37283"
FT                   /protein_id="AAK04491.1"
FT                   /translation="MLKPLENRVVLRVKEEEEKSMGGIVLTSASQEKPQTAEVVAVGEG
FT                   KTNHHGTLISPLVKVGDTVIFEKFAGTTVKMDGEEFLILKDSDLLAIVE"
FT   gene            398897..400525
FT                   /gene="groEL"
FT                   /locus_tag="L198893"
FT   CDS             398897..400525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="L198893"
FT                   /product="60 KD chaperonin"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:8486277 BIO04.03
FT                   Chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:L198893"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04492"
FT                   /db_xref="GOA:P37282"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37282"
FT                   /protein_id="AAK04492.1"
FT                   /translation="MSKDIKFSSDARTAMMRGIDILADTVKTTLGPKGRNVVLEKSYGS
FT                   PLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLK
FT                   NVTAGANPVGIRRGIELAAETAVASIKEMAIPVHDKSAIAQVATVSSRSEKVGEYISDA
FT                   MERVGSDGVITIEESKGMQTELDVVEGMQFDRGYLSQYMVSNTEKMVAELDNPYILITD
FT                   KKISNIQEILPLLEQILKTNRPLLIVADDVDGEALPTLVLNKIKGVFNVVAVKAPGFGD
FT                   RRKAQLEDLAILTGGTVITEELGLDLKDATLEALGQAAKATVDKDHTTIVEGAGSADAI
FT                   SDRVAIIKAQIEKTTSDFDREKLQERLAKLAGGVAVVKVGAATETELKAMKLLIEDALN
FT                   ATRAAVEEGIVSGGGTALVNAIAALDKLSEEGDIQTGINIVRRALEEPVRQIAANAGYE
FT                   GSVIIDKLRSEEVGTGFNAATGQWVNMIEEGIVDPAKVTRSALQNAASVAGLILTTEAV
FT                   VANKPEPAAPAMPPMDPSMGMGGMM"
FT   gene            complement(400571..401383)
FT                   /gene="yeaA"
FT                   /locus_tag="L582"
FT   CDS             complement(400571..401383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaA"
FT                   /locus_tag="L582"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. homology
FT                   to yycJ B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L582"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04493"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIG7"
FT                   /protein_id="AAK04493.1"
FT                   /translation="MTEQNGFKYSILASGSTGNSFYLETPKKKILVDAGLSGKKIESLL
FT                   SEIDRDIHDIDALLITHEHSDHIKGIGVLARKYGIDLYANEDTWSELDSKNALGKIPVE
FT                   QKHLFEMGKTMTFGDIDIESFGVSHDAIAPQFYRFMKDNKSFVMLTDTGYVSDRMRGTI
FT                   ENADAYLMESNHDIEILRMGAYPWRTKQRILSDQGHLSNEDGAEAAFSIHGNKTKRIFL
FT                   GHLSLNNNIKELAHLTMDGYLQQHDVDTKKDLKILDTSHEHASQLYDI"
FT   gene            complement(401554..402996)
FT                   /gene="kinC"
FT                   /locus_tag="L0124"
FT   CDS             complement(401554..402996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kinC"
FT                   /locus_tag="L0124"
FT                   /product="sensor protein kinase"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:9172368 BIO09.02
FT                   Two-component systems"
FT                   /db_xref="EnsemblGenomes-Gn:L0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04494"
FT                   /db_xref="GOA:Q9CIG6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIG6"
FT                   /protein_id="AAK04494.1"
FT                   /translation="MIKFFNSMIFKGVVAHLLLFVILFMSSFDYNFAHLSTFIGYYLFS
FT                   LVFVLVFLNQQHRMIVNVSKQMNDIKNGYLNRDKIPKGTSEINELYDEILKLGEDIVRT
FT                   QNNLENQRNQLDSILAYMVDGVIATDRRGNIIMANKSALHYLNTDNDLLMQKNIVEVLK
FT                   ITDQYNFYDLLEKEPEITIETHDSGNESISLHIKFALFRRESGFISGIIAVLHDMTEQD
FT                   KAERERRLFVSNVSHELRTPLTSVKAYLEALEDGAIEDKETASSFINVSLTETNRMIRM
FT                   ISDLLTLSRMDQDRIVLNKEMINLIAFLDYQINRLDQILETESNDLISSNFTLVRKYSE
FT                   QPIWVEIDTDKIAQVIDNIIGNAIKYSPKGGTITISVEKRESDVLISISDQGMGIPKSD
FT                   LLKIFDRFYRVDNASRNSKVGGTGLGLSIVHDIVKIHGGTIFASSEGEGKGTTFSFTLP
FT                   YSLEAADDWDDGTDEFEFEDNE"
FT   gene            complement(402989..403690)
FT                   /gene="llrC"
FT                   /locus_tag="L0125"
FT   CDS             complement(402989..403690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="llrC"
FT                   /locus_tag="L0125"
FT                   /product="two-component system regulator"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:10708382 BIO09.02
FT                   Two-component systems. involved in acid stress resistance
FT                   development."
FT                   /db_xref="EnsemblGenomes-Gn:L0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04495"
FT                   /db_xref="GOA:Q9CIG5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIG5"
FT                   /protein_id="AAK04495.1"
FT                   /translation="MKKILVVDDEKPISDIVKFNLTKEGFEVFTAFDGEEALEAFKEVQ
FT                   PDLILLDLMLPKLDGLDVAREIRKTSDTPIIMVSAKDSEFDKVIGLELGADDYVTKPFS
FT                   NRELLARIKANLRRINVAPAESTDNVKKELIIGNLRINPAHYAAYKNDKQLDLTHREFE
FT                   LLYYLAQHLGEVITRENLLETVWGYDYFGDVRTVDVTVRRLREKVEDTPSRPQYVSTRR
FT                   GVGYYMSNPHD"
FT   gene            403868..404503
FT                   /gene="yeaB"
FT                   /locus_tag="L3846"
FT   CDS             403868..404503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaB"
FT                   /locus_tag="L3846"
FT                   /product="thymidylate kinase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO08.04 Pyrimidine
FT                   ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:L3846"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04496"
FT                   /db_xref="GOA:Q9CIG4"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIG4"
FT                   /protein_id="AAK04496.1"
FT                   /translation="MNGILISLEGPDGAGKTTVLKEILPEIQKMKREIVPTREPGGVRV
FT                   AEEIRQIILDPKNTDIDSKTELMLFAAARRLHMQEKMLPALQAGKVVIVDRFIDSSVAY
FT                   QGYGRDLGVEVVDWLNYFATDGLKPDLTLYFDVDTDVALERIMKNRADEVNRLDLERAE
FT                   MHRKVREGYLEIVVKEPERFVKIDASQPLEKVVADTLSVLKKRFVSEF"
FT   gene            404636..405496
FT                   /gene="holB"
FT                   /locus_tag="L0280"
FT   CDS             404636..405496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="L0280"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="EVIDENCE BY HOMOLOGY BIO10.02 DNA replication,
FT                   restriction, modification, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:L0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04497"
FT                   /db_xref="GOA:Q9CIG3"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIG3"
FT                   /protein_id="AAK04497.1"
FT                   /translation="MEIKDIQPQLYKQFSTILQHGKLSHAYLFSGGFGSFELAIWLSQA
FT                   LFCENPENALPCGHCRSCRLVAQQEFTDLHIVEPDGQTIKTAQIRELTQVFNESGYEGN
FT                   QQVLLIKEAEKMHPNAANALLKSIEEPETEIVVFLLTDNENMILQTIKSRTQIINFPKN
FT                   VQYLQDFLEKNGILKTQAELLAEICNSTDKALELAQQSWFNEGLQRLQQFVKLLKTSAD
FT                   EAFLYLKELVEIFDDKEKQNQAFELLLQLFNQERMSQELLKTFQAIKMWKSNVRFESSL
FT                   TFLVL"
FT   gene            405548..406330
FT                   /gene="yeaC"
FT                   /locus_tag="L5532"
FT   CDS             405548..406330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaC"
FT                   /locus_tag="L5532"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL"
FT                   /db_xref="EnsemblGenomes-Gn:L5532"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04498"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIG2"
FT                   /protein_id="AAK04498.1"
FT                   /translation="MIYEIKFAHGESNVFAISDIELAPQTEVILRSDKGNFYGKIVREI
FT                   SEEANLEIHHTIVREVNEDDLQVIAKLEERSKQAKDKVRQLVIEQGLEMKIIDVAYNFD
FT                   QMQLFISFTAENRVDFRLLLRELATTFRIRIELRQIGPRDAAKIHGGLGPCGRPLCCSE
FT                   FVYEFPNVSIKMAKNQNLSLKQNKLNGLCGRLMCCLTYEDSFYKEAQQLFPDFGEFVTT
FT                   SEGKGKVVGLNVLKNRVKIRFGEYSKDFELAEIEVNHG"
FT   gene            406323..406649
FT                   /gene="yeaD"
FT                   /locus_tag="L6328"
FT   CDS             406323..406649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaD"
FT                   /locus_tag="L6328"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL"
FT                   /db_xref="EnsemblGenomes-Gn:L6328"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04499"
FT                   /db_xref="GOA:Q9CIG1"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIG1"
FT                   /protein_id="AAK04499.1"
FT                   /translation="MADKYNVFDQLGELENTLNTTLTQISGIRQVLESSMTENATLRME
FT                   LEKLRDRLAEFEKKEVKKETPKDQPNPNLIQIFNEGFHVCHLHYAERLAEGESCLDCLE
FT                   LLYR"
FT   gene            406616..407524
FT                   /gene="yeaE"
FT                   /locus_tag="L6615"
FT   CDS             406616..407524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaE"
FT                   /locus_tag="L6615"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL"
FT                   /db_xref="EnsemblGenomes-Gn:L6615"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04500"
FT                   /db_xref="GOA:Q9CIG0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIG0"
FT                   /protein_id="AAK04500.1"
FT                   /translation="MFRLFGAFVSLMENKFSIQRSFKGLKTAGSLYLVPTPIGNMQDMT
FT                   LRSLETLKTVDLICSEDTRNTLRLLNHFEIKVPQESFHEHNSQEKIPKLIDFLKKGQSI
FT                   AQVSDAGMPSISDPGHDLVLAAIDEGIDVIALPGASAGITALIASGLVPQPHIFYGFLP
FT                   RKKGEQQKFLKSKLSYPETQIFYESPFRVGDTLANMQEIYGDREVVLVRELTKIYEEYR
FT                   RGKISEVLESLTDQPIKGECLIIVSGADEVAQEVQEPELTALEAVKVLVEQSVKPNVAI
FT                   KQIAKERGLNRQELYAEFHDL"
FT   gene            complement(407601..407792)
FT                   /gene="yeaF"
FT                   /locus_tag="L7612"
FT   CDS             complement(407601..407792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaF"
FT                   /locus_tag="L7612"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L7612"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04501"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIF9"
FT                   /protein_id="AAK04501.1"
FT                   /translation="MENQYEILQSLIEKMEIVTVGSAVSKTKLNRKEIIDFVRSQHSLR
FT                   IFDEENQKWINENVDGHC"
FT   gene            complement(407855..408787)
FT                   /gene="yeaG"
FT                   /locus_tag="L7866"
FT   CDS             complement(407855..408787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaG"
FT                   /locus_tag="L7866"
FT                   /product="mevalonate kinase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO07.01 FATTY ACID AND
FT                   PHOSPHOLIPID METABOLISM"
FT                   /db_xref="EnsemblGenomes-Gn:L7866"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04502"
FT                   /db_xref="GOA:Q9CIF8"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIF8"
FT                   /protein_id="AAK04502.1"
FT                   /translation="MTINKMGTGIAHSKLILIGEHSVVYGQPAIALPVTILKTTVTITS
FT                   SKYGQYIENNEFRRRLDLMGDEFEGIRQLIMRLLSKFHSSKMPFSLEIDSNIPQGRGLG
FT                   ASASLATAIIRAFYDFFDAELPQKDLLFYANFSENITHGKSSGIDVATVNSEHPLWFIK
FT                   DSTIEPFELNLHGFIVIGDTGVHGFTSQAINIVREKLVEEKEKTQDSINHLGQLATDSK
FT                   DFLMTDKLKEFGHVMNKAHERLSDLGVSHPRLDNLVETARKNGALGAKLTGSGLGGVMV
FT                   ALAENEKDAIRISQRLLKNGAKNTWIYSF"
FT   gene            409093..410049
FT                   /gene="yeaH"
FT                   /locus_tag="L9089"
FT   CDS             409093..410049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaH"
FT                   /locus_tag="L9089"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO07.01 FATTY ACID AND
FT                   PHOSPHOLIPID METABOLISM"
FT                   /db_xref="EnsemblGenomes-Gn:L9089"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04503"
FT                   /db_xref="GOA:Q9CIF7"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIF7"
FT                   /protein_id="AAK04503.1"
FT                   /translation="MKNIVTARAHTNIALIKYWGKADIALNIPTTSSLSMTLEPFYTTT
FT                   SVEFTDNESDSLILNSEVADSSRVSQFLEMMRGQYGNFPKVMIQSENHVPTAAGLASSA
FT                   SSFAALTAAMFGLLDLEKDDSEMSRIARRGSGSASRSIFGNFSVWNKGEDHQSSFAESF
FT                   YNEDIGLSMIVAEISAEKKKMSSTKGMQLAQTAPTYSAWVEKSAIQLEEMKQAILNADI
FT                   EKVGLVAQDNALGMHEQNRLSNQPFDYFTHETRHVIDFVNQAYQSGLLAFVTIDAGPNV
FT                   KIITDHATEKVLLAKLQAEFPELTFDIARAGGAYEYL"
FT   gene            410036..411025
FT                   /gene="yebA"
FT                   /locus_tag="L10014"
FT   CDS             410036..411025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebA"
FT                   /locus_tag="L10014"
FT                   /product="mevalonate kinase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO07.01 FATTY ACID AND
FT                   PHOSPHOLIPID METABOLISM"
FT                   /db_xref="EnsemblGenomes-Gn:L10014"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04504"
FT                   /db_xref="GOA:Q9CIF6"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIF6"
FT                   /protein_id="AAK04504.1"
FT                   /translation="MNISEKKMSIKVPGKLFFAGEYSVTKEGNLALITTIETNFEVRIS
FT                   ATTGKSIFKTNVGLSDFEFSLSKIEFTKENPWNFALTALKNTLSAADSFEKKSVSKILS
FT                   SSPEISLEIVSDLGFGENKKGYGSSASVVCGLVNAVNQFFDFQLSLEKRFEIAAKTHFE
FT                   VQGSGSMGDIAAIMYGGSVFYQNHKRVIPLEIPWATYVVQTGKAAKTSEKIKIKLSDEF
FT                   YQASNELVIELATAIDIQDFALFKEKLSENQLLLLENIPEGYMTKELAIALNLLNSYPE
FT                   FAAKISGAGFGENIILFAQNTQAIAEVQNKLSEYGINLEKFKVAQKNN"
FT   gene            411078..412121
FT                   /gene="yebB"
FT                   /locus_tag="L11083"
FT   CDS             411078..412121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebB"
FT                   /locus_tag="L11083"
FT                   /product="carotenoid biosynthetic protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.05 OTHER. putative
FT                   carotenoid biosynthetic gene"
FT                   /db_xref="EnsemblGenomes-Gn:L11083"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04505"
FT                   /db_xref="GOA:Q9CIF5"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIF5"
FT                   /protein_id="AAK04505.1"
FT                   /translation="MKTEKEIHQHRKDEHLSLAYKYWREEKNQTSGLTFSDSRIIPNSL
FT                   PELSTKKINFSSEVFGQNFEFPFYIEAMTGGTERADKINAQLAEIAKNQHLAMAVGSQS
FT                   IALKFPELAAGFSEVRKIHSSGFLFANIGAGHSLENAKRAVDMIEANALEIHVNTAQEL
FT                   PMDEGDREFYWLENINEIASQLEVPVVVKEVGFGISQKTFKALAKTSVSGINIGGAGGT
FT                   NFAWIERKRSKNGFNLDEFGLSTLESLLEAKMADNRKSLIATGGITSAQEIFKSLILGA
FT                   DLSSSAGFILKNLMQTGPEKVEEVIEQWKQDLNKLFVLTGSKNIEECRKVELLYSINML
FT                   NFIQQRK"
FT   gene            412279..412899
FT                   /gene="sodA"
FT                   /locus_tag="L12227"
FT   CDS             412279..412899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="L12227"
FT                   /product="superoxide dismutase"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:7665513 BIO04.04 CELLULAR
FT                   PROCESSES. Detoxification"
FT                   /db_xref="EnsemblGenomes-Gn:L12227"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04506"
FT                   /db_xref="GOA:P0A4J1"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4J1"
FT                   /protein_id="AAK04506.1"
FT                   /translation="MAFTLPELPYAPNALEPFFDEATMRLHHGKHHQTYVNNLNAAIEK
FT                   HNELDDLSLEELLTDLSAIPEDIRTAVRNNGGGHLNHSQFWLWLRPNTDGSENHADGEI
FT                   GDAIAKEFGSFETFKTEFKAAATGRFGSGWAWLVVDEAGKLKVVSTANQDNPISEGLTP
FT                   VLGLDVWEHAYYLKYHNVRPDYIEAFFNLVNWDKVNELYAKAK"
FT   gene            413148..415502
FT                   /gene="cstA"
FT                   /locus_tag="L13150"
FT   CDS             413148..415502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="L13150"
FT                   /product="carbon starvation protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.01 Adaptations and
FT                   atypical conditions. PEPTIDE utilization DURING CARBON
FT                   STARVATION"
FT                   /db_xref="EnsemblGenomes-Gn:L13150"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04507"
FT                   /db_xref="GOA:Q9CIF4"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIF4"
FT                   /protein_id="AAK04507.1"
FT                   /translation="MKDIGNSSNFTEEEELFLLRNKQGKIVGIKDLKQANFQETMKDWK
FT                   KHLPKPSLLSIIIWVAVALLGGLAWSLIALAQGETINAIWFVIAAVCSYLIGYRFYALY
FT                   IQRKIMRPNDLRATPSESHNDGKEFDPTNRVVLFGHHFASIAGAGPLVGPVLAAQMGYL
FT                   PGTIWIIFGVIFAGGVQDMLVLWYSHRRRAKSIGAMAHDEVGRFAGGLTSFIVFIMTMI
FT                   VLAVLALICVTAMANSAWAVFSIGMTIPIALLMGIYLKYIRPGHVNEISAIGFILLLVA
FT                   IFGGRWVSESSFAHIFMLSPTALVWWVMGYTFIAAIIPAWILLTPRDYLSMFMKIGTIA
FT                   VLAIAVVGVRPDVTIPALTNFAHNTDGPAFAGSLFPFLFVTIACGALSGFHVMMSSGTT
FT                   PHLIAKESQTRMIGYGGMLFESFVAIMALVAAISLNPGIYYSMNTPQASIQKLAASSYQ
FT                   ADKSAEYNAAKAIPNVAMMPDGSKLSIDWEGTTGEKALEQVAKDVGEQSIVSRTGGAPT
FT                   LAVSMSNILHKVPLIGGTNMMGFWYHFAIMFEVLFILSAVSAATKSTRYLLNDALRGFK
FT                   KLGRLGDDDWLPSKIITTAVIVGVWGALLLMGVSDPNGGIKIMYPLFGISNQLIAAVAL
FT                   AIVCVMVIRKGYLKWVWIPALPLVWDVCVTFAASWQKIFSNDVNIGYFASYSAAKAQVA
FT                   SGKLSGLALTNAQATMRNTMIQGSLSVIFLLCVAILLVICAFKVAKILRTNEVGDKFSS
FT                   EEVFEESNLFETSSFWPSKLEHKVLKSKVNE"
FT   gene            415804..417144
FT                   /gene="rheB"
FT                   /locus_tag="L0340"
FT   CDS             415804..417144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rheB"
FT                   /locus_tag="L0340"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO11.03 RNA processing.
FT                   PROBABLY AN ATP-DEPENDENT RNA-BINDING protein WITH AN
FT                   UNWINDING ACTIVITY (HELICASE). SIMILARITY TO OTHER 'DEAD'
FT                   BOX FAMILY HELICASES"
FT                   /db_xref="EnsemblGenomes-Gn:L0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04508"
FT                   /db_xref="GOA:Q9CIF3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIF3"
FT                   /protein_id="AAK04508.1"
FT                   /translation="MKFTDFNFKDYINQTLENIKFEKPTEVQEKLIPIVLSGRDLVGES
FT                   KTGSGKTHTFLLPIFQKIDTDLDEVQAVITAPSRELATQIYKAAQEFTKVNDKLRVSNF
FT                   VGGTDKARQIKKLESSQPHVVIGTPGRIHDLIKSNALIVHTANTFVVDEADMTLDMGFL
FT                   ADVDQIASSFGKRVQMLVFSATIPQKLQPFLKKYLHNPVMQKIANKTVISDTIENWLVS
FT                   TKGSSHNQLLLQLTKATNPYMAMIFANTKGRVDDIHHFLTSNGLKVAKIHGDVPPRERK
FT                   RIMNSIKNLDYQYVVATDIAARGIDIEGVSHIINDEIPKDLTFFVHRVGRSGRNGLQGT
FT                   AITLYSPSDDSSIREIEKMGVTFQPKAIKDGEIVDSYDRDRREKRTKKQDEISTKTIGA
FT                   LKKGKKHVKPGYKRAIKWQIEEDNKKKRRAERNKNARKTRDSRKQSF"
FT   gene            417148..417732
FT                   /gene="yebE"
FT                   /locus_tag="L17153"
FT   CDS             417148..417732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebE"
FT                   /locus_tag="L17153"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   there are three paralogs in L.lactis. Membrane protein."
FT                   /db_xref="EnsemblGenomes-Gn:L17153"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04509"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIF2"
FT                   /protein_id="AAK04509.1"
FT                   /translation="MKKTFKIIGAFVGLILLIPVICLALILSKSTDRTAENSTDIKTIL
FT                   VLGSRINQNKKPAKITQERLDAALLLAKNNPQAKIIVSGAKGADEPVSEAFSMKNYLIT
FT                   HHIRADRIISEDKAGDTAENIAYSKKYFDGKTVIVTSDFHLYRALYLAKQEGVKVEGFA
FT                   AKTKVNNLLYYPNYYGHEILGLIYAFVFGKG"
FT   gene            417888..418634
FT                   /gene="yebF"
FT                   /locus_tag="L17893"
FT   CDS             417888..418634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebF"
FT                   /locus_tag="L17893"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General. There are eight paralogs in L.lactis. Belongs to
FT                   RpiR family of transcription regulators."
FT                   /db_xref="EnsemblGenomes-Gn:L17893"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04510"
FT                   /db_xref="GOA:Q9CIF1"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIF1"
FT                   /protein_id="AAK04510.1"
FT                   /translation="MMFLPEQISKLNELETLVFDFIIKSPEEVQQMTIRDLASQAHVST
FT                   STIVRLCTKLGFEGWSDLKFYLKNQLKEKTPEEQHYDNMLEFNMFLRRMNTDNYQAKLN
FT                   NAAQMIAKADYTVFLGLGTSGSLSEYATKYFVNTGLRSFVISDPFQAVQVQGMGNVVAV
FT                   IMSVSGETEQVVNKELEFKAGGAKIISITNNEDCTVAKLADYQLSYNLVNEWSKQYPLG
FT                   NLTTQLPVLAILEILAHKSIDYHLKK"
FT   gene            418876..419202
FT                   /gene="ptcB"
FT                   /locus_tag="L18872"
FT   CDS             418876..419202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptcB"
FT                   /locus_tag="L18872"
FT                   /product="cellobiose-specific PTS system IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.07 TRANSPORT AND BINDING
FT                   proteinS. PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:L18872"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04511"
FT                   /db_xref="GOA:Q9CIF0"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIF0"
FT                   /protein_id="AAK04511.1"
FT                   /translation="MADKVIALACAAGMSTSLLVSKMQKAAADNGKDYEIFAKSTADID
FT                   NMLAGTGSPKPDVLLLGPQVAFMKGEVAKKAEIAGVPMDVIKMQDYGMMRGDKVLAAAE
FT                   NLMN"
FT   gene            419287..419637
FT                   /gene="ptcA"
FT                   /locus_tag="L19292"
FT   CDS             419287..419637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptcA"
FT                   /locus_tag="L19292"
FT                   /product="cellobiose-specific PTS system IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.07 TRANSPORT AND BINDING
FT                   proteinS. PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:L19292"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04512"
FT                   /db_xref="GOA:Q9CIE9"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIE9"
FT                   /protein_id="AAK04512.1"
FT                   /translation="MTDKYENPTSDDYMGVVMGIIMSGGNAKGLAFQAIQQAKAGEFAE
FT                   AESSLNEASEQLREAHDVQTDLLTRLAQGEKIGWNLYMVHAQDHLMNAITFKDLAVEVV
FT                   GQEQRLQALENK"
FT   gene            419728..420459
FT                   /gene="yecA"
FT                   /locus_tag="L19721"
FT   CDS             419728..420459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yecA"
FT                   /locus_tag="L19721"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General. There are eight paralogs in L.lactis. Belongs to
FT                   RpiR family of transcription regulators."
FT                   /db_xref="EnsemblGenomes-Gn:L19721"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04513"
FT                   /db_xref="GOA:Q9CIE8"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIE8"
FT                   /protein_id="AAK04513.1"
FT                   /translation="MMSFFGNVDFQKLTYTERTCYSYLRDNVDKIPYMRVRDIALEAHV
FT                   GTSSVMRLIHKMGYDSYTDFKEYIIDKKELEKGSSNTAIPFSLDIFSNDIEQRLDNLAH
FT                   RVIESDNIIFTGVGSSGLICDYAARRLAGVGINTFSFSDVTYPIASKLPNTTNTLVIAL
FT                   SISGETNEIIEVLTSLRSNKDVYISCITPKLNSSIAELSDFVLTYRINEHRINTHYDLT
FT                   SQLPTVYLTERLTDLVYQLSN"
FT   gene            420905..422074
FT                   /gene="ptcC"
FT                   /locus_tag="L20847"
FT   CDS             420905..422074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptcC"
FT                   /locus_tag="L20847"
FT                   /product="cellobiose-specific PTS system IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.07 TRANSPORT AND BINDING
FT                   proteinS. PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:L20847"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04514"
FT                   /db_xref="GOA:Q9CIE7"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIE7"
FT                   /protein_id="AAK04514.1"
FT                   /translation="MNKIKLGPLFLQINNASFGIMALLAVFGIAYAWVRDAGYEGVPAG
FT                   LTGIIVHILLQPDTIHQVTSVTDPTKVSTAYQVGGVIDRAWLGGKGMVLSIIVGLLVGW
FT                   IYTGFMRRNITIKMPEQVPENVAASFTSLVPAGAIIALAGVVHGITTIGFNTTFIELVY
FT                   KWIQTPLQHVTDGPVGVFVIAFMPVFIWWFGVHGATIIGGIMGPLLQANSADNAALYKA
FT                   GHLSLSNGAHIVTQSFMDQYLTVTGSGLTIGLVIFLLVSAKSVQGKTLGRMEIGPAVFN
FT                   INEPILFGLPIVLNPILAIPFILAPLISGILTYLVIYLGIIPPFNGAYVPWTTPAVLSG
FT                   YLVGGWQGMVWQVIILALTSLLYWPFAKAYDNILLKEEAETEAEINAAE"
FT   gene            422156..423592
FT                   /gene="bglA"
FT                   /locus_tag="L22116"
FT   CDS             422156..423592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA"
FT                   /locus_tag="L22116"
FT                   /product="phospho-beta-glucosidase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.12 ENERGY METABOLISM.
FT                   Sugars"
FT                   /db_xref="EnsemblGenomes-Gn:L22116"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04515"
FT                   /db_xref="GOA:Q9CIE6"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIE6"
FT                   /protein_id="AAK04515.1"
FT                   /translation="MTLKKDFLWGGAVAAHQLEGGWNAGGKGVSVADVMTAGSNGVERK
FT                   ITDGVIEGENYPNHEAIDFYHRYKEDIALFDELGLNCFRTSIAWTRIFPNGDEAEPNEE
FT                   GLQFYDDLFDECLKHGIEPVITLSHFELPYHLVTEYGGFRNRKLIDFFVHFSEVVMNRY
FT                   KDKVKYWMTFNEINNQANYLRDFAPFTNSGLKFPEGASEKEREEMMYQAAHYELVASAK
FT                   VVALGHKINPDFQIGCMIAMCPIYPATCKPEDMMASTVAMQRRYWFADVHVRGHYPSYL
FT                   KAYFDRKEFKLDILDDDLKALEEGKVDYIGFSYYMSFAIKDHGKAPTFDYNEDKDLVKN
FT                   EYVKASEWGWQIDPLGLRYAMNWFYERYEKPLFIVENGFGAVDEVEADGSIHDPYRVDY
FT                   LKAHIEAMKNAVDYDGVDLMGYTPWGFIDLVSAGTGEMKKRYGVIYVDKDNEGNGTLER
FT                   SKKDSFTWYQKVIATNGEEL"
FT   gene            423878..424159
FT                   /gene="yecD"
FT                   /locus_tag="L23787"
FT   CDS             423878..424159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yecD"
FT                   /locus_tag="L23787"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L23787"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04516"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIE5"
FT                   /protein_id="AAK04516.1"
FT                   /translation="MQAKYRGQLVEVWKISHRPIHEIWVRQAFEQERLSWNEWNKNVLN
FT                   FESISGDLALVGDFLIQKDGRRFHVVSRENVQRDLVFMDTETNFKIGN"
FT   gene            424521..426485
FT                   /gene="ligA"
FT                   /locus_tag="L0304"
FT   CDS             424521..426485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="L0304"
FT                   /product="DNA ligase"
FT                   /EC_number="6.5.1.2"
FT                   /note="EVIDENCE BY HOMOLOGY BIO10.02 DNA replication,
FT                   restriction, modification, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:L0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04517"
FT                   /db_xref="GOA:Q9CIE4"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CIE4"
FT                   /protein_id="AAK04517.1"
FT                   /translation="MNIESKIKELTEKLNQYAYEYYTLDEPSVEDSEYDRLYQELVKLE
FT                   AENPQLTRADSPTHRTGGVILDGFVKFRHPYNLYSLGDVFSREELAVWEERVRKEIANP
FT                   EYICELKIDGLSLSLYYENGLLMTAATRGDGTTGENITENVKRIKDVPLKLKEAIDIVV
FT                   RGEAYLPRKNFAKLNKERELEGATPFANPRNAAAGTLRQLDTKIVAKRGLATFLYQEAS
FT                   PATNDTQEEVLEYFEELGFQVNPERKFARNMDEIWEFIEEATRLRDELPYDIDGVVVKV
FT                   NNLAEQEELGFTVKAPRWAIAYKFPAEQAETEILSVDWTVGRTGVVTPTANMTPVLLAQ
FT                   TTVARATLHNVDYIEEKDIRIGDHVLIYKAGDIIPKVGKVLLDKRPEGLEGLEIPTKCP
FT                   ECGSELIHFEDEVALRCVNPLCPAQIREKLIHFASRDAMNIVGLGPSVISQLFDKKLVA
FT                   DVADLYQLTIEDLLTLDKVKETLAQKIVSAIAQSRENSAEKLLFGLGIRHVGGKAAKLL
FT                   LERFANLRALSKATEEEISEIPSLGGVIATAVVSYFETDGAKILLDELENAGVNFDYLG
FT                   AVNIEGILSGKTVVLTGKLTTLKRSEAKEKLEALGANVSGSVSKKTDLVVAGEEAGSKL
FT                   TKAQDLGIEIWSEQDLLDL"
FT   gene            426638..427666
FT                   /gene="yecE"
FT                   /locus_tag="L26628"
FT   CDS             426638..427666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yecE"
FT                   /locus_tag="L26628"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General"
FT                   /db_xref="EnsemblGenomes-Gn:L26628"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04518"
FT                   /db_xref="GOA:Q9CIE3"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIE3"
FT                   /protein_id="AAK04518.1"
FT                   /translation="MMKARLIYNPTSGQEIIKKYIADILDKLEQYGYEASAYQTTAEQD
FT                   SAKKEAARATEAGFDLIIAAGGDGTINEVVAGISPFEKRPQLAIVPTGTTNDFARALKI
FT                   PRGKPLEAIEIIGKNQILNIDVGHAVIRETQDEQYFINIAAGGGLTELTYSVPSHLKTA
FT                   FGYLAYLAKGAELLPRVRKAPVRVVHDEGVFEGDISMFFAALTNSVGGFEKIAPDAKLD
FT                   DGLFTLILVKTDNLFELIALLAIVANGKHLDDVNLEYIKTSKIEIEALGGQKILLNLDG
FT                   EYGGDAPVQFDNLKGHLDMYVNLDEINDDHYLGDEETLALEAVAQKFAEEANKIKDEDE
FT                   ED"
FT   gene            427883..429019
FT                   /gene="msmK"
FT                   /locus_tag="L27865"
FT   CDS             427883..429019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msmK"
FT                   /locus_tag="L27865"
FT                   /product="multiple sugar ABC transporter ATP-binding
FT                   protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.04 TRANSPORT AND BINDING
FT                   proteinS. Carbohydrates, organic alcohols and acids. There
FT                   are 60 paralogs in L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L27865"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04519"
FT                   /db_xref="GOA:Q9CIE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIE2"
FT                   /protein_id="AAK04519.1"
FT                   /translation="MTTLSLDKIYKKYPNATQYAVEDFNIDIKDKEFIVFVGPSGCGKS
FT                   TTLRMVAGLEDITEGEFKIDGKIMNDVAPKDRDIAMVFQNYALYPHMTVFDNMAFGLKL
FT                   RKFKKDEIKRRVEEAGTILGLSDLLDRKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPL
FT                   SNLDAKLRVSMRTEIAKIHRRIGATTIYVTHDQTEAMTLADRIVIMSSSPNSDKTGTVG
FT                   RVEQIGTPQELYNEPANKFVAGFIGSPAMNFFNVKVASGKLTNNEGLNMDLPEGKAKLL
FT                   KEQGYEGKEVILGIRPEDIQASNLAQQAYPNQTIEAEVVVSELLGAETMLYLRAGSTEF
FT                   VSRVEARDFRNPGEKITVALNLNKSHFFDAQTEHRIID"
FT   gene            429327..432899
FT                   /gene="nifJ"
FT                   /locus_tag="L29321"
FT   CDS             429327..432899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifJ"
FT                   /locus_tag="L29321"
FT                   /product="pyruvate-flavodoxin oxidoreductase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.05 Electron transport.
FT                   OXIDOREDUCTASE REQUIRED FOR THE TRANSFER OF ELECTRONS FROM
FT                   PYRUVATE TO FLAVODOXIN, WHICH REDUCES NITROGENASE"
FT                   /db_xref="EnsemblGenomes-Gn:L29321"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04520"
FT                   /db_xref="GOA:Q9CIE1"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIE1"
FT                   /protein_id="AAK04520.1"
FT                   /translation="MKKTMDGNMAAAHIAYAFSEIAVIYPITPSSPMADYTDAWSVAGR
FT                   KNIWGSTVKITELQSEAGAAGAMHGVLKAGGLATTYTASQGLLLMLPNMYKMAGELLPA
FT                   VIHVAARAVAAGALNIFGDQSDVMSARITGFAMLAESSVQEVMDLSAVAHLATLEGSVP
FT                   FLNFFDGFRTSHEIQKIDVIDYQDLLPMVNQEKLADFRDRAMNPDHPTVSGTNQNADIY
FT                   FQQRETVNSYYEALPEIVQKYMGKINKLRGTDYDLVNYYGAPDATEVIVSMGSVAGTIE
FT                   QTVDYLNEQGRKVGFINVHLYRPFPLENFLEKLPKTVKSVAVLDRTKESGSNGEPLFLD
FT                   VQSALFNSNVKQVIGGRYGIGGKDTRPEHIVSVFDELVKAQPKRMFTIGINDDVTNLSL
FT                   TNSRVLDLTPADTFQAKFWGFGSDGTVGANKAAIKIIGDHTDKYVQAAFEYDSKKSGGL
FT                   TISHLRFGDSPITSEYMTATLDFVACHNMTYVRKYNLTKGLKAGGLFLLNTSWNLEQLS
FT                   KNLPNEMKKFIAENQIRFYTIDAMKIAHETGMERRINTIMQVAFFKLAHVMPFDEAYEI
FT                   LKKDAQKYAKKSPTIVEQNLNAMALALNGLHEVKIPESWAETQEEKTKVLTTESSRKKY
FT                   VFEIVNKTNAFEGDELSVQTLVDNKMTFGDEPLGTSASEKRVIALEIPEWNAQACIQCN
FT                   ECSFVCPHAAIRPFLVDEDEWNQAPEGFHVMDYKGADGLKYRIQVSVEDCTGCGLCVEA
FT                   CPKKGEALKMIPYEGQEKESVNWAFAQTLKTKENPARPGTIAASQFEKPLFEFSGACSG
FT                   CGETPYIKLLTQMFGDRMMISNATGCSAIYGGTQATPYTTNEFEQGPAWSNSLFEDNAE
FT                   YGYGMWLASQTRRQKLAAQVLEALPEMSDDLQKLAKDWVEHLEDSEGTRARAEKMKGML
FT                   ASEHFNSAKLDEIYKQKDQFVKPTQWIFGGDGWAYDIGFGGLDHIVASGADVNILVMDN
FT                   EVYANTGGQVSKATPASAIAQFAAGGKSNTKKDLGAMLMTYGDVYVAQIASGANMMQTI
FT                   RTFDEAEKFKGPSVIIAYTPCISHGLYGGIHLALDEAKEAVNSGYWQLYRYNPLLEDLG
FT                   KNPMILDFKKPDFSKVRDFLLTQSRFGNLLKVDAEHAESLYAKAAKDSRKRFMRYARTS
FT                   GDLDKYLEREAKALAKKILNQRGL"
FT   gene            433205..434083
FT                   /gene="yedA"
FT                   /locus_tag="L33187"
FT   CDS             433205..434083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yedA"
FT                   /locus_tag="L33187"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:L33187"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04521"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIE0"
FT                   /protein_id="AAK04521.1"
FT                   /translation="MTDFNQFFNLEFWQKIFELNESPLRIAIAILDIAIISFFLYQAIR
FT                   FVQGTKLMTLVRGVIIFIFIRIIAGLIGLTTVEWLLNQVITYGVIAGVIIFQPEIRRAL
FT                   ESLGRTTTLFTPTRKSSPDGHISAYEKSFAYMSERKIGALIAIEQGQNLNEFVSTGIRL
FT                   DADITSELLINIFIPNTPLHDGAVIVQGNKIAVTSAYLPLTEKSGISKQFGTRHRAAIG
FT                   LSEVSDALILVVSEETGGISIAHNGEFFADISKEKFHDILVAILVPKVEKNEKGTGKNR
FT                   KNKAGGKKNGK"
FT   gene            434073..434650
FT                   /gene="yedB"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   probably a frameshift mutation in this gene"
FT   gene            435077..436435
FT                   /gene="femD"
FT                   /locus_tag="L35068"
FT   CDS             435077..436435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="femD"
FT                   /locus_tag="L35068"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO05.02 Amino sugars"
FT                   /db_xref="EnsemblGenomes-Gn:L35068"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04522"
FT                   /db_xref="GOA:Q9CID9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CID9"
FT                   /protein_id="AAK04522.1"
FT                   /translation="MGKYFGTDGVRGEANVELTPEMAFKLGRFGGYVLSQHELGTPKVY
FT                   VGRDTRISGQMLASSLISGLLSVGIEVYDLGVIATPGVAYLVKKDGASAGVMISASHNP
FT                   ALDNGIKFFGGDGYKLEDEKELEIEALIDAEEDTLPRPSAQGLGMLHDYIEGVRKYQAF
FT                   LKTTAEGNFEGYKVVLDTANGAAYTSARAVFADLEANLTVIGENPDGLNINVKVGSTHP
FT                   EAMAKKVVETGSDLGLAFDGDADRLIAVDENGEIVDGDKIMFIVGKYLLGQGKLAQDTL
FT                   VTTVMSNLGFHLALEEAGINSVITAVGDRYVVEEMKKNNYNFGGEQSGHMIFLDYNTTG
FT                   DGQLSAIQLLKVMRETGKSLSELASEVTIYPQKLVNVRVKDNAAKKSAMDVPAIQKVIS
FT                   EMETSMNGKGRILVRPSGTEPLLRVMAEAPTHEEVNHVVDTIVEVVEAEIGVK"
FT   gene            complement(436511..437227)
FT                   /gene="rgrA"
FT                   /locus_tag="L0150"
FT   CDS             complement(436511..437227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgrA"
FT                   /locus_tag="L0150"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.06 GntR-family
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:L0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04523"
FT                   /db_xref="GOA:Q9CID8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012770"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CID8"
FT                   /protein_id="AAK04523.1"
FT                   /translation="MKKYEVILQDLEKKIFNDIYKTNDILPSENELSANYESSRSTVRQ
FT                   ALKILEEKGLIQRRHGYGSIVLAHDRLLFPISGLTSYKELQTSMGFHSETEVIRFERLE
FT                   INPKLSETTGFAVGEHAISILRRRKVDGKFSILDWDLFLEKYSEGLTPEHAKISTYDYL
FT                   EDTLGLDIAYAQKEVTIDFACEDDFKYLDLNPKDHHVVSVKSHVYLADNTLFQYTESRH
FT                   QVDRFRFTEFARRQKR"
FT   gene            437338..437823
FT                   /gene="yedE"
FT                   /locus_tag="L37338"
FT   CDS             437338..437823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yedE"
FT                   /locus_tag="L37338"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. homology
FT                   to C part of PTS protein"
FT                   /db_xref="EnsemblGenomes-Gn:L37338"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04524"
FT                   /db_xref="GOA:Q9CID7"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CID7"
FT                   /protein_id="AAK04524.1"
FT                   /translation="MFGIGKKKELKDDKELYNPVSGEVIELSKVNDPVFSKKIMGDGFA
FT                   VEPKENKIFAPVSAKVTLVQGHAIGFKRADGLDILLHLGIDTVALKGAPFKIKVKVDDI
FT                   VNGGDELGTVDWGQIEAAGLDKTTMVIFTNTKDLLSGFEVKYGSANARDELGQASVK"
FT   gene            437960..439525
FT                   /gene="yedF"
FT                   /locus_tag="L37906"
FT   CDS             437960..439525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yedF"
FT                   /locus_tag="L37906"
FT                   /product="beta-glucoside-specific PTS system IIABC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.07 TRANSPORT AND BINDING
FT                   proteinS. PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:L37906"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04525"
FT                   /db_xref="GOA:Q9CID6"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CID6"
FT                   /protein_id="AAK04525.1"
FT                   /translation="MANYSQLATDIIANVGGAENVTKVIHCITRLRFTLKDKDKADTAA
FT                   IEALPGVAGAVYNSNLNQYQVVIGQAVEDVYDEVVEQLGDAVVDDEATAQAVAVTAPAN
FT                   GKKQNPIVHAFQVVIGTITGSMIPIIGLLAAGGMINGLLSIFVKGNRLIEVIDPASSTY
FT                   VIISTLAMTPFYFLPVLVGFSAAKQLAPKDTVLQFIGAAVGGFMINPGITNLVNAHVGT
FT                   NAAGKNVVVEAAAPVANFLGVTFNTSYFGIPVALPSYAYTIFPIIVAVAIAKPLNAWLK
FT                   KVLPLALRPIFQPMITFFITASIVLLLVGPVISTISSGLSFVIDHILSLNLGIASIIVG
FT                   GLYQCLVIFGLHWLVVPLISQELAATGASSLNMIVSFTMLAQGVGALTVFFKSKKADLK
FT                   GLSAPAAISAFCGVTEPAMYGINLKYVRVFIMSSIGAAIGAGVAGFGGLQMFGFSGSLI
FT                   GFPNFISNPLTHHAPAGNLMLFWIATAVCAVATFLLVWFFGYKDTDVMGEGVEQKNAFK
FT                   DAVK"
FT   gene            439593..441902
FT                   /gene="yeeA"
FT                   /locus_tag="L39593"
FT   CDS             439593..441902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeeA"
FT                   /locus_tag="L39593"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL
FT                   COMMENTS=100% homology with Y18267 L.lactis ATCC 19435
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:L39593"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04526"
FT                   /db_xref="GOA:Q9CID5"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CID5"
FT                   /protein_id="AAK04526.1"
FT                   /translation="MTEKDWIIQYDKKEVGKRSYGQESLMSLGNGYLGLRGAPLWSTCS
FT                   DNHYPGLYVAGVFNRTSTEVAGHDVINEDMVNWPNPQLIKVYIDGELVDFEASVEKQAT
FT                   IDFKNALQIERYQVKLAKGNLTLVTTKFVDPINFHDFGFVGEIIADFSCKLRIETFTDG
FT                   SVLNQNVERYRAFDSKEFEVTKISKGLLVAKTRTSEIELAIASKSFLNGLAFPKIDSEN
FT                   DEILAEAIEIDLQKNQEVQFDKTIVIASSYESKNPVEFVLTELSATSVSKIQENNTNYW
FT                   EKVWSDADIVIESDHEDLQRMVRMNIFHIRQAAQHGANQFLDASVGSRGLTGEGYRGHI
FT                   FWDEIFVLPYYAANEPETARDLLLYRINRLTAAQENAKVDGEKGAMFPWQSGLIGDEQS
FT                   QFVHLNTVNNEWEPDNSRRQRHVSLAIVYNLWIYSQLTEDESILTDGGLDLIIETTKFW
FT                   LNKAELGDDGRYHIDGVMGPDEYHEAYPGQEGGICDNAYTNLMLTWQLNWLTELSEKGF
FT                   EIPKELLEKAQKVRKKLYLDIDENGVIAQYAKYFELKEVDFAAYEAKYGDIHRIDRLMK
FT                   AEGISPDEYQVAKQADTLMLIYNLGQEHVTKLVKQLAYELPENWLKVNRDYYLARTVHG
FT                   STTSRPVFAGIDVKLGDFDEALDFLITAIGSDYYDIQGGTTAEGVHIGVMGETLEVIQN
FT                   EFAGLSLREGQFAIAPYLPKSWTKLKFNQIFRGTKVEILIENGQLLLTASADLLTKVYD
FT                   DEVQLKAGVQTKFDLK"
FT   gene            442048..442713
FT                   /gene="pgmB"
FT                   /locus_tag="L0001"
FT   CDS             442048..442713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgmB"
FT                   /locus_tag="L0001"
FT                   /product="beta-phosphoglucomutase"
FT                   /EC_number="5.4.2.6"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:9084169 BIO06.09
FT                   Glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:L0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04527"
FT                   /db_xref="GOA:P71447"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010972"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="PDB:1LVH"
FT                   /db_xref="PDB:1O03"
FT                   /db_xref="PDB:1O08"
FT                   /db_xref="PDB:1Z4N"
FT                   /db_xref="PDB:1Z4O"
FT                   /db_xref="PDB:1ZOL"
FT                   /db_xref="PDB:2WF5"
FT                   /db_xref="PDB:2WF6"
FT                   /db_xref="PDB:2WF7"
FT                   /db_xref="PDB:2WF8"
FT                   /db_xref="PDB:2WF9"
FT                   /db_xref="PDB:2WFA"
FT                   /db_xref="PDB:2WHE"
FT                   /db_xref="PDB:3FM9"
FT                   /db_xref="PDB:3ZI4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P71447"
FT                   /protein_id="AAK04527.1"
FT                   /translation="MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLK
FT                   GVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLR
FT                   SNKIKIALASASKNGPFLLEKMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPS
FT                   ESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSYYTLEFLKEVWLQKQK"
FT   gene            complement(442772..443578)
FT                   /gene="yeeB"
FT                   /locus_tag="L42784"
FT   CDS             complement(442772..443578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeeB"
FT                   /locus_tag="L42784"
FT                   /product="sugar hydrolase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.12 ENERGY METABOLISM.
FT                   Sugars. 27% identical to beta-1,4-D-xylanase of
FT                   Butyrivibrio fibrisolvens"
FT                   /db_xref="EnsemblGenomes-Gn:L42784"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04528"
FT                   /db_xref="GOA:Q9CID4"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="PDB:3HXK"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CID4"
FT                   /protein_id="AAK04528.1"
FT                   /translation="MIFLSTLFWYNKLMNKSTFSLNDTAWVDFYQLQNPRQNENYTFPA
FT                   IIICPGGGYQHISQRESDPLALAFLAQGYQVLLLNYTVMNKGTNYNFLSQNLEEVQAVF
FT                   SLIHQNHKEWQINPEQVFLLGCSAGGHLAAWYGNSEQIHRPKGVILCYPVTSFTFGWPS
FT                   DLSHFNFEIENISEYNISEKVTSSTPPTFIWHTADDEGVPIYNSLKYCDRLSKHQVPFE
FT                   AHFFESGPHGVSLANRTTAPSDAYCLPSVHRWVSWASDWLERQIKN"
FT   gene            443651..444346
FT                   /gene="yeeC"
FT                   /locus_tag="L43651"
FT   CDS             443651..444346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeeC"
FT                   /locus_tag="L43651"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L43651"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04529"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CID3"
FT                   /protein_id="AAK04529.1"
FT                   /translation="MKKIIYSIGLISLLNFGTIAYGETATGTSASSGDATAQSSTGTSS
FT                   TSNSASSASSSSQNTSSSEGTNSTSQNQTQTSTTAQNQTDNVGQNQTPPVVENRDSSTD
FT                   KNSGSQKETKNSTTIINETVNNNAKGNNILLMTLTSLSASVTIIGGIIAFVRHLRGRGK
FT                   KKNPVSKAQSSKNGKTPSNSMTAEPSVSSKKTPNEEKVLTETQQINMQADELLKNHKKQ
FT                   QKEYRRRRR"
FT   gene            444288..444488
FT                   /gene="yeeD"
FT                   /locus_tag="L44267"
FT   CDS             444288..444488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeeD"
FT                   /locus_tag="L44267"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L44267"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04530"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CID2"
FT                   /protein_id="AAK04530.1"
FT                   /translation="MNCSKIIKNNKKNIVAEEDKKPFKVFYFAQIFEKLSVKFTDSFYF
FT                   KDCDNEGDKLFEVATLKFSKV"
FT   gene            444575..445000
FT                   /gene="yeeE"
FT                   /locus_tag="L44542"
FT   CDS             444575..445000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeeE"
FT                   /locus_tag="L44542"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL"
FT                   /db_xref="EnsemblGenomes-Gn:L44542"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04531"
FT                   /db_xref="GOA:Q9CID1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CID1"
FT                   /protein_id="AAK04531.1"
FT                   /translation="MLQFAQKLGRKLEAQDVIVLTGELGAGKTTFTKGLALGLEIHQMV
FT                   KSPTYTIVRSLEGRLPLHHMDVYRIGDDPDSFDLDDYLFGDGVSVIEWGEMLGDDLPKD
FT                   YLEVIFDKYSKDLVNDQEREIILKPHGKRYEELVNNL"
FT   gene            444997..445515
FT                   /gene="yeeF"
FT                   /locus_tag="L45003"
FT   CDS             444997..445515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeeF"
FT                   /locus_tag="L45003"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL"
FT                   /db_xref="EnsemblGenomes-Gn:L45003"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04532"
FT                   /db_xref="GOA:Q9CID0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CID0"
FT                   /protein_id="AAK04532.1"
FT                   /translation="MTTELIVREANGADSSRVIEFLNKVGTESNFLTIDEVGILISEAE
FT                   MTDFLNQQAEKDNNAYFLAFVGDEIAGILHLTADYHYRVRHIAELFIAVSEDYQGYGIG
FT                   TILLEDALEWVEEVGTIKRLELTVQARNKKARHLYEKFDFELENVKKWGARDENGQLID
FT                   VCEYVLFFD"
FT   gene            445619..447004
FT                   /gene="yeeG"
FT                   /locus_tag="L45616"
FT   CDS             445619..447004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeeG"
FT                   /locus_tag="L45616"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General. belongs to LytR family"
FT                   /db_xref="EnsemblGenomes-Gn:L45616"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04533"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIC9"
FT                   /protein_id="AAK04533.1"
FT                   /translation="MKLWIKTLLMLGSIILVTAIAAGGYTLTVLNSTTKAFKMTYTNAG
FT                   NKKTEQVIQATEPLTILLMGVDTGGEGRGTSDSWNGNSDSQILMTLNPKTHTTTMVSIE
FT                   RDTMTNILDADGNIVSKQKMNAAYPLGYNSGSSSDGLKNAVSYAMKTISAQTGINIDSF
FT                   VTVNFDGLVNMVDNVGGIDINNTTGQTLYISDTEPQYTAKVPPGKQHINGDQALVYTRD
FT                   RHHLSNGDYGRAAHQREVIAALMKKILALDNITRYEQFLNEASKDFRTNIPINASTITS
FT                   LLGYKDCFNKVVSIQYEGVGEMVDGASYQFMPTDIYLAMQNIMKKSLDESTVTTLPSSL
FT                   ITYESVFGSGTAPFYYLPSATVTEKGKSTVTYGVDTQGNLVSLNSKNSGNYVSTSGGSV
FT                   QSDSSSGSSSSSSDSTATSSSDSTYQQDNTYNDGYNNSNDSTTSSYGTDDTNTGNYGYG
FT                   TSQ"
FT   gene            complement(447236..448369)
FT                   /gene="pi101"
FT                   /locus_tag="L47248"
FT   CDS             complement(447236..448369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi101"
FT                   /locus_tag="L47248"
FT                   /product="prophage pi1 protein 01, integrase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. high homology with integrase of
FT                   Lactococcus lactis phage BK5-T"
FT                   /db_xref="EnsemblGenomes-Gn:L47248"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04534"
FT                   /db_xref="GOA:Q9CIC8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIC8"
FT                   /protein_id="AAK04534.1"
FT                   /translation="MARYIKRGKVWQYEISYKDTDGKYKKLRKSGFPKKADAISEAGEI
FT                   EANLAKGFYTVSQDILLTDHFKQWIEIFKKGKVSDGTYRKYLYTLSVLKKHFSTATIKT
FT                   MNRVKYQEMLNEFAEGHSDSSVKQINVHVRASLENLLDDFIIKNDFTKGAISKGGKGSK
FT                   SAELKYLDFEDFTKLIALAKEKINPIYSSSFMIYIAAMTGMRFSELLGLTWDNVDFEKG
FT                   QIYVKRTWDIYKNNFAPTKNDQSVRFLAIDSSTMQVMINYKEQQEKLLKRLEIEPEHPF
FT                   VFYNIKNGLITNNSLNKQLRNMCKKLGFKKIITCHGLRHTHASTMLYKGINILYVSKRL
FT                   GHSSLNVTMSVYSHILKELEEKDNENIKKIFSEINDE"
FT   gene            complement(448492..449070)
FT                   /gene="pi102"
FT                   /locus_tag="L48504"
FT   CDS             complement(448492..449070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi102"
FT                   /locus_tag="L48504"
FT                   /product="prophage pi1 protein 02"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. homology with orf3 of L.lactis
FT                   phage TP901-1"
FT                   /db_xref="EnsemblGenomes-Gn:L48504"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04535"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIC7"
FT                   /protein_id="AAK04535.1"
FT                   /translation="MGFKELLKAKSFNEYFDAKKDHQKMEEIKNRTQTDVLKNAGASLI
FT                   PSSISNFGFKLSKDSISKGFEKKPLNDVTARLESGSELQSRVTMTRLVALGVFAFAAKK
FT                   KKGGEKYLTIEGPDFVWTAEIKRDKKDIDKAMKFINQVNTNSKIYSKSMQINSSTTSIA
FT                   DELKKFKELLDSGTISQEEFEIQKAKLLK"
FT   gene            complement(449154..449990)
FT                   /gene="pi103"
FT                   /locus_tag="L0250"
FT   CDS             complement(449154..449990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi103"
FT                   /locus_tag="L0250"
FT                   /product="prophage pi1 protein 03, transcriptional
FT                   regulator"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:8730874 BIO14.03 Phage
FT                   related functions and prophages. 97% identical to the
FT                   repressor protein Rro of L.lactis phage r1t. cI type
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:L0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04536"
FT                   /db_xref="GOA:Q9CIC6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIC6"
FT                   /protein_id="AAK04536.1"
FT                   /translation="MKKIRLPEMIDYFRKENGWTMKEFGEKLGKSESAISKWIKGVRSP
FT                   MVEDFDKMVNLFNTDPDTLMYGASDLSTTLSEINKISSQLEEPRQKVVLNTATNQLDEQ
FT                   NQEKKKESKVIPINKIPDDLPPYISRKILENFVMPTNTMEYEPDEDMVDVPILGRIAAG
FT                   LPLDAVENFDGTRPVPAHFLSSARDYYWLMVDGHSMEPKIPFGSYVLIEAVPDVTDGTI
FT                   GAVLFQDDCQATLKKVYHEIDCLRLVSINKEFKDQFATQDNPAAVIGQAVKVEIDL"
FT   gene            450207..450389
FT                   /gene="pi104"
FT                   /locus_tag="L50216"
FT   CDS             450207..450389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi104"
FT                   /locus_tag="L50216"
FT                   /product="prophage pi1 protein 04, transcriptional
FT                   regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 94% IDENTICAL TO BK5-T PHAGE
FT                   PUTATIVE REPRESSOR protein Cro."
FT                   /db_xref="EnsemblGenomes-Gn:L50216"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04537"
FT                   /db_xref="InterPro:IPR006848"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIC5"
FT                   /protein_id="AAK04537.1"
FT                   /translation="MEVLMEQVVTHYGEAIQQHSVEWYKKQLLKDLSVQFIKDSLLPQL
FT                   FEWSNAYKAAVELTK"
FT   gene            450421..450654
FT                   /gene="pi105"
FT                   /locus_tag="L50391"
FT   CDS             450421..450654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi105"
FT                   /locus_tag="L50391"
FT                   /product="prophage pi1 protein 05"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L50391"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04538"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIC4"
FT                   /protein_id="AAK04538.1"
FT                   /translation="MNLEKIKQVKMLDNYEEIKDIVNAHIEMGWIVLLSDSNKVILGAE
FT                   WPESYNMNFNLTVERKHFGVVGKPGVPGIGVI"
FT   gene            450763..450912
FT                   /gene="pi106"
FT                   /locus_tag="L50721"
FT   CDS             450763..450912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi106"
FT                   /locus_tag="L50721"
FT                   /product="prophage pi1 protein 06"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L50721"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04539"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIC3"
FT                   /protein_id="AAK04539.1"
FT                   /translation="MPKETKQKLVISATVKTTEEAKKLLDDLEVLKNEYKLNISLSVGT
FT                   LLIA"
FT   gene            451007..451414
FT                   /gene="pi107"
FT                   /locus_tag="L51016"
FT   CDS             451007..451414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi107"
FT                   /locus_tag="L51016"
FT                   /product="prophage pi1 protein 07"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 100% identical to tec gene product
FT                   of bacteriophage r1t"
FT                   /db_xref="EnsemblGenomes-Gn:L51016"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04540"
FT                   /db_xref="GOA:Q9CIC2"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIC2"
FT                   /protein_id="AAK04540.1"
FT                   /translation="MNFISVYLSATSWALCSFEFIRHPPFYSTKQIPQISAHSYYTKEN
FT                   TKIHTQKGASMAEKKTYEPLDELLDSSGMKYKVIAKKINVPYTTFYKWRINPSRIDAVS
FT                   AANIAEVIGVDLTDVIFVLKNFNQKLDKLAS"
FT   gene            451426..452181
FT                   /gene="pi108"
FT                   /locus_tag="L51420"
FT   CDS             451426..452181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi108"
FT                   /locus_tag="L51420"
FT                   /product="prophage pi1 protein 08"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 36% identical to orf5 of the phage
FT                   r1t"
FT                   /db_xref="EnsemblGenomes-Gn:L51420"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04541"
FT                   /db_xref="GOA:Q9CIC1"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIC1"
FT                   /protein_id="AAK04541.1"
FT                   /translation="MKELQNFTNGIFNLDVKVDGENILFSAEQAAKAMGITQVKNGKEY
FT                   VKWERVNSYLPNSPEVGKGSFISEPMVYKLAFKANNAVSEKFTDWLAVEVLPTIRKHGA
FT                   YMTDSKLEEALLNPDTLINLATQLKQEREEKAQLRALNSTLAVENQIMQPKAQYFDDLV
FT                   ERNLLTSFRDTAKMLKVGQKQLIDWLLENKYIYRDKKNKLMPYAQYNNDLFEIKESKGA
FT                   TNSWKGAQTLITPVGRETFNLLLNEYKAS"
FT   gene            452194..452523
FT                   /gene="pi109"
FT                   /locus_tag="L52191"
FT   CDS             452194..452523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi109"
FT                   /locus_tag="L52191"
FT                   /product="prophage pi1 protein 09"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 75% identical to orf6 of
FT                   bacteriophage r1t"
FT                   /db_xref="EnsemblGenomes-Gn:L52191"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04542"
FT                   /db_xref="InterPro:IPR008489"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIC0"
FT                   /protein_id="AAK04542.1"
FT                   /translation="MEQTLEVQATISVLIPEDKILVDKVEYQELKEKDFDGWVGMDVFI
FT                   KKSNRSRTTIKNLLNCPEMVKKLSIENGGWVFYPADAGKWSFHYKEMMEFINNEFYQKF
FT                   NGGSK"
FT   gene            452738..452911
FT                   /gene="pi110"
FT                   /locus_tag="L52711"
FT   CDS             452738..452911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi110"
FT                   /locus_tag="L52711"
FT                   /product="prophage pi1 protein 10, transcriptional
FT                   regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 96% identical to orf8 of
FT                   bacteriophage r1t, 53% identical to Cro repressor protein
FT                   of the phage BK5-T"
FT                   /db_xref="EnsemblGenomes-Gn:L52711"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04543"
FT                   /db_xref="InterPro:IPR006848"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIB9"
FT                   /protein_id="AAK04543.1"
FT                   /translation="MEQEKTINHLGQVVYQESVEFYKEKLSVHSKDFLQNSLIPQLYEW
FT                   SNAYKAAVELTK"
FT   gene            453010..453816
FT                   /gene="pi111"
FT                   /locus_tag="L53019"
FT   CDS             453010..453816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi111"
FT                   /locus_tag="L53019"
FT                   /product="prophage pi1 protein 11, recombinase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 45% identical to a putative
FT                   recombinase of the Listeria monocytogenes bacteriophage
FT                   A118"
FT                   /db_xref="EnsemblGenomes-Gn:L53019"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04544"
FT                   /db_xref="GOA:Q9CIB8"
FT                   /db_xref="InterPro:IPR004590"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIB8"
FT                   /protein_id="AAK04544.1"
FT                   /translation="MSNQITKTQQTLKSPEVKKKFEEVLGKKTEGFVASLLSVVGNSNL
FT                   KNADANSVMTAAMKAATLDLPIEPSLGFAYVIPYGREAQFQIGYKGFIQLALRSGQLTG
FT                   LNCGIVYESQFVSYDPLFEELELDFSQQASGDAVGYFASMKLANGFKKVTYWSKEQVLA
FT                   HKKKFVKSANGPWRDHFDAMAQKTVLKAMLTKYAPASIESKMIQTAITEDDSERFENAK
FT                   DVTPDEPVISIDESMTSEVSQNEPATESQEQLPEDEVEELFPIGKS"
FT   gene            453816..454592
FT                   /gene="pi112"
FT                   /locus_tag="L53819"
FT   CDS             453816..454592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi112"
FT                   /locus_tag="L53819"
FT                   /product="prophage pi1 protein 12"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L53819"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04545"
FT                   /db_xref="InterPro:IPR016974"
FT                   /db_xref="InterPro:IPR024432"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIB7"
FT                   /protein_id="AAK04545.1"
FT                   /translation="MNKRLSFSSLKAFSDCEAEAVAVMAGDWDRQATFSPSTIEAMNAG
FT                   SYVHKYFESNKALEEFKLEHESDMFTKKGSLKSQFQIAEKMVQTLDHDPLFKTIYQGVK
FT                   ELEIFGKIQGIEFHGFLDCLNLERNIFIDIKTIRGSIRDKEWSEIEYRRVSWIKARKYL
FT                   WQMAIYQEILRQSDDEKIGKNISPVIYAVTKETFPDSAGITIPQEWLDDSLDEVCEFTD
FT                   KYIEVLNGRVPVRCEQCNYCKATKRNIQTISYSDLI"
FT   gene            454928..455596
FT                   /gene="pi113"
FT                   /locus_tag="L54802"
FT   CDS             454928..455596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi113"
FT                   /locus_tag="L54802"
FT                   /product="prophage pi1 protein 13, replisome organiser"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages. 52% identical to a putative
FT                   replisome organiser protein Rep2009 of the bacteriophage
FT                   Tuc2009"
FT                   /db_xref="EnsemblGenomes-Gn:L54802"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04546"
FT                   /db_xref="InterPro:IPR009696"
FT                   /db_xref="InterPro:IPR010056"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIB6"
FT                   /protein_id="AAK04546.1"
FT                   /translation="MVLIYQRMMLQSLSNEGVLYYEGALDNLSEELSLSLDEDVEKIQM
FT                   TLAFFSKYGLIQIDEEQNAEMLQVHAIVDQETDWARYKRNQRSSQKLDNVQSVSNTCPT
FT                   EIELEKEKDIELKKDIEIRDIDSNSLLSKFLDTFINFSSKNRSKRAVATAEFIKLPSFQ
FT                   REQAVIGAMNYIQSYKNEHPDDEAGQYSVNAVNFLSNMMFMDYQEEVKADAGYDEDLGF
FT                   "
FT   gene            455615..456490
FT                   /gene="pi114"
FT                   /locus_tag="L0311"
FT   CDS             455615..456490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi114"
FT                   /locus_tag="L0311"
FT                   /product="prophage pi1 protein 14, DNA replication protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 33% identical to the orf12 of the
FT                   phage r1t. Functional equivalent to DnaC of E.coli or DnaI
FT                   of B.subtilis, which are required for chromosomal
FT                   replication."
FT                   /db_xref="EnsemblGenomes-Gn:L0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04547"
FT                   /db_xref="GOA:Q9CIB5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIB5"
FT                   /protein_id="AAK04547.1"
FT                   /translation="MADGIREFHKKREVKTGLFCEKHQQTELVRYKHPVSIDYDPLIHG
FT                   ELVDGLQVTSMSYCTECAKEGIYQHHQQSSAEIKANEDFLNKSKYGKYSLLKTQSLVGK
FT                   KSLWFARFNTFKVNGLEEQNVLNQAQRIAREYTQGQRFNTVFVGGAGRGKSHLAMAILQ
FT                   EVNENLKDDKFSTLFINISELIREIKNSWNYSDTKAEEERLTTLMRTVDLLVIDDLGTE
FT                   STFSKDNSWVQGVIYNIYNAREGNTIITSNLTGKEMRSSYDDKIVSRIMEGSKNSVVKF
FT                   EGITDKRKSK"
FT   gene            456575..457051
FT                   /gene="pi115"
FT                   /locus_tag="L56509"
FT   CDS             456575..457051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi115"
FT                   /locus_tag="L56509"
FT                   /product="prophage pi1 protein 15"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L56509"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04548"
FT                   /db_xref="GOA:Q9CIB4"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIB4"
FT                   /protein_id="AAK04548.1"
FT                   /translation="MRLFLFLIAWLRCLQLLDLEKQVKFEFNFLRKEMINENDNKGTTY
FT                   GSRIAANNTKQRLRRIACRTAHEWLDQSEEVFEQFHEKHRCDVFVVIYPPKRFKYDPPN
FT                   YEPTSKALIDGLTDAGIWNDDNYNVIRRTSFEHGGLSGDTKTWKVELVVKELTE"
FT   gene            457298..457660
FT                   /gene="pi116"
FT                   /locus_tag="L57295"
FT   CDS             457298..457660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi116"
FT                   /locus_tag="L57295"
FT                   /product="prophage pi1 protein 16"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 42% identical to orf18 of
FT                   bacteriophage r1t"
FT                   /db_xref="EnsemblGenomes-Gn:L57295"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04549"
FT                   /db_xref="InterPro:IPR007020"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIB3"
FT                   /protein_id="AAK04549.1"
FT                   /translation="MARLEKIYDVYFNGIKMGTGTKKELSKMLLVSPHSVAGWVKNGMA
FT                   NSPKNNAVKIAVVNEKAMMEKYPGWKPYGGSKSKISDEITDRDRRKHETKEERRLRRNI
FT                   RAQMAIEAARKEELGL"
FT   gene            457854..458060
FT                   /gene="pi117"
FT                   /locus_tag="L57860"
FT   CDS             457854..458060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi117"
FT                   /locus_tag="L57860"
FT                   /product="prophage pi1 protein 17"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L57860"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04550"
FT                   /db_xref="InterPro:IPR009503"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIB2"
FT                   /protein_id="AAK04550.1"
FT                   /translation="MTVESLLKVIEEGMTVILKTEKNRIIVQFECGNDIEAFSCGFLYR
FT                   KIKIIKIKNGSELIAILEDTKND"
FT   gene            458053..458325
FT                   /gene="pi118"
FT                   /locus_tag="L58038"
FT   CDS             458053..458325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi118"
FT                   /locus_tag="L58038"
FT                   /product="prophage pi1 protein 18"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L58038"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04551"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DAW7"
FT                   /protein_id="AAK04551.1"
FT                   /translation="MTKFETANELISFVKEKDLKRGFYQKGKRIQWLVGFDMLGFMQVT
FT                   TPAQVRKSRSGFNCSVTNWNVLLEENFPKLDWFLSAKYIGTELEK"
FT   gene            458322..458876
FT                   /gene="pi119"
FT                   /locus_tag="L58289"
FT   CDS             458322..458876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi119"
FT                   /locus_tag="L58289"
FT                   /product="prophage pi1 protein 19"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 72% identical to orf24 of the
FT                   bacteriophage Tuc2009"
FT                   /db_xref="EnsemblGenomes-Gn:L58289"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04552"
FT                   /db_xref="InterPro:IPR012865"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CB08"
FT                   /protein_id="AAK04552.1"
FT                   /translation="MKMTKFEEKLEILPIKTIQHPVGDTKYYAAVHVKTLIAQADEEIA
FT                   NLKSQLQQQALPVVPDFIGKLINTFGAPEDGKYINYSASYLEIQKELDWIDNHQKTWLT
FT                   ALLIGFRVEKPQLFYLRDELTGQFLAKDNQFKNEDRYFFWTGADPLTHSIGTAWKLTFT
FT                   QQEIDSMQTGSYELVPVEDGE"
FT   gene            458873..459292
FT                   /gene="pi120"
FT                   /locus_tag="L58858"
FT   CDS             458873..459292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi120"
FT                   /locus_tag="L58858"
FT                   /product="prophage pi1 protein 16, deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. DE NOVO SYNTHESIS OF THYMIDYLATE,
FT                   98% identical to dUTPase of bacteriophage r1t"
FT                   /db_xref="EnsemblGenomes-Gn:L58858"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04553"
FT                   /db_xref="GOA:Q9CIB1"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIB1"
FT                   /protein_id="AAK04553.1"
FT                   /translation="MTRGFKKLDENATIPERATEHSAGYDISASETVTIQPDEIKMVST
FT                   GLAVQLGDDEVLKLYDRSSNPVKRGIALINSVGIIDSDYYPQEFKGLFMNISKEPVTIS
FT                   KGQRIMQGVFVKYLTTDDDNANGKRTGGFGSTGEL"
FT   gene            459292..459582
FT                   /gene="pi121"
FT                   /locus_tag="L59286"
FT   CDS             459292..459582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi121"
FT                   /locus_tag="L59286"
FT                   /product="prophage pi1 protein 21"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L59286"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04554"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIB0"
FT                   /protein_id="AAK04554.1"
FT                   /translation="MDNKRISEIVEEEMIKQDANRYRDMRKILTIPKSIADELDSVFAG
FT                   VDATDIGYVLDQTGPYGSRAFDDYYFKNKNIIALYLAGKALGVDLVKVGEG"
FT   gene            459579..459743
FT                   /gene="pi122"
FT                   /locus_tag="L59567"
FT   CDS             459579..459743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi122"
FT                   /locus_tag="L59567"
FT                   /product="prophage pi1 protein 22"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 38% identical to orf17 of
FT                   bacteriophage o1205"
FT                   /db_xref="EnsemblGenomes-Gn:L59567"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04555"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIA9"
FT                   /protein_id="AAK04555.1"
FT                   /translation="MIEYAIYKGEKFIAEGTADELAKLLNVKPTTIKWWSRPVNSRRDK
FT                   GNRKIAVKL"
FT   gene            459932..460114
FT                   /gene="pi123"
FT                   /locus_tag="L59938"
FT   CDS             459932..460114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi123"
FT                   /locus_tag="L59938"
FT                   /product="prophage pi1 protein 23"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 33% identical to orfx from
FT                   lactococcal bacteriophage 712"
FT                   /db_xref="EnsemblGenomes-Gn:L59938"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04556"
FT                   /db_xref="InterPro:IPR012455"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIA8"
FT                   /protein_id="AAK04556.1"
FT                   /translation="MKLMCKLSGHKWSKWRANLFSTHEERFCRRCYIRDKRLNRSDLDE
FT                   SENVFPEKWLDKHMD"
FT   gene            460296..460481
FT                   /gene="pi124"
FT                   /locus_tag="L60272"
FT   CDS             460296..460481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi124"
FT                   /locus_tag="L60272"
FT                   /product="prophage pi1 protein 24"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L60272"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04557"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIA7"
FT                   /protein_id="AAK04557.1"
FT                   /translation="MKKFRLISNSFLKEDGQLHSRQQFVEANSLADVIEYIESNAGWYT
FT                   DINVAFKVAYIEEVVE"
FT   gene            complement(460534..460743)
FT                   /gene="pi125"
FT                   /locus_tag="L60543"
FT   CDS             complement(460534..460743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi125"
FT                   /locus_tag="L60543"
FT                   /product="prophage pi1 protein 25"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L60543"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04558"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIA6"
FT                   /protein_id="AAK04558.1"
FT                   /translation="MSYVVNKTGDFSGYHEVHKGACPNRPIVTDSYLINKQFENDLDAM
FT                   EYVKEIYPSLQVRPCLSCMDTSSR"
FT   gene            460956..461249
FT                   /gene="pi126"
FT                   /locus_tag="L60929"
FT   CDS             460956..461249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi126"
FT                   /locus_tag="L60929"
FT                   /product="prophage pi1 protein 26"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 85% identical to orf4 of abiN
FT                   locus from Lactococcus lactis S114 (acc no Y11901)"
FT                   /db_xref="EnsemblGenomes-Gn:L60929"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04559"
FT                   /db_xref="InterPro:IPR010772"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIA5"
FT                   /protein_id="AAK04559.1"
FT                   /translation="MSQEITVDFSEQIAKAQTKIDRLKDMIHDVRDQKIVLDDIKNNHM
FT                   PRDTKLELNLGGVLKCSVKINVGTLIPLLEQNIEDNTALIHELAKELGIDIK"
FT   gene            461360..461605
FT                   /gene="pi127"
FT                   /locus_tag="L61369"
FT   CDS             461360..461605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi127"
FT                   /locus_tag="L61369"
FT                   /product="prophage pi1 protein 27"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 41% identical to ORF20 of
FT                   S.thermophilus bacteriophage o1205"
FT                   /db_xref="EnsemblGenomes-Gn:L61369"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04560"
FT                   /db_xref="GOA:Q9CIA4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIA4"
FT                   /protein_id="AAK04560.1"
FT                   /translation="MRKNRIKELRKAQKITLKGLSEKLKEKGLSFSDSQLSYYEQGKRS
FT                   PRNEDIWEALAEIFDVSLAYVMGMEMGLVNIYPPTL"
FT   gene            461650..462039
FT                   /gene="pi128"
FT                   /locus_tag="L61641"
FT   CDS             461650..462039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi128"
FT                   /locus_tag="L61641"
FT                   /product="prophage pi1 protein 28"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 32% identical to orf4 of abiN
FT                   locus from Lactococcus lactis S114 (acc no Y11901)"
FT                   /db_xref="EnsemblGenomes-Gn:L61641"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04561"
FT                   /db_xref="InterPro:IPR010772"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIA3"
FT                   /protein_id="AAK04561.1"
FT                   /translation="MDKVSTYERPKRTNAPMIKRAEKKEINMLSETKIRRNIETIEQKT
FT                   CRLKNVIHAIKRQTELVELLEDKLQSGEIKKTDKFGAELTDRFSFFESNFNIPVGTLIS
FT                   LLKDNIEGNTTIASELVAKLGIEVE"
FT   gene            462041..462439
FT                   /gene="pi129"
FT                   /locus_tag="L62008"
FT   CDS             462041..462439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi129"
FT                   /locus_tag="L62008"
FT                   /product="prophage pi1 protein 29"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 40% identical to the 64 protein
FT                   (GP64) from Mycobacteriophage l5"
FT                   /db_xref="EnsemblGenomes-Gn:L62008"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04562"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIA2"
FT                   /protein_id="AAK04562.1"
FT                   /translation="MKKIKNIAISTVLGASALIGLSACSQADKVSQNVSNDADNFKVER
FT                   RVVIINTRTDKIEFVAKGLISVNTEDSKKLVILAKVGKSQYKKDIINLTNNNMYTVEDL
FT                   SGANVNSYKYEVTWLPESVVPVKIVGEK"
FT   gene            462436..462588
FT                   /gene="pi130"
FT                   /locus_tag="L62412"
FT   CDS             462436..462588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi130"
FT                   /locus_tag="L62412"
FT                   /product="prophage pi1 protein 30"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L62412"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04563"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIA1"
FT                   /protein_id="AAK04563.1"
FT                   /translation="MMGISIANFLITLLTYLSIWSVIVVIFIGLMSLIAYWAYLVYKFL
FT                   RKIGK"
FT   gene            462765..463187
FT                   /gene="pi131"
FT                   /locus_tag="L62774"
FT   CDS             462765..463187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi131"
FT                   /locus_tag="L62774"
FT                   /product="prophage pi1 protein 31"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 68% identical to orf6 of abiN
FT                   locus from Lactococcus lactis S114 (acc no Y11901)"
FT                   /db_xref="EnsemblGenomes-Gn:L62774"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04564"
FT                   /db_xref="InterPro:IPR007927"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CIA0"
FT                   /protein_id="AAK04564.1"
FT                   /translation="MADKLDRIIGDYVNGRLEARIKSIESRYLYKQKVDNLGIRTAYSG
FT                   GSEPESHVLNKEALENDEEYIKLKDLMYQFSLWYEPLIKEEKEIIKLKHCGYGGFTWYR
FT                   VMMELDNEGIEISEKKAKFIYYRFRKDINPHIGYFI"
FT   gene            463359..463928
FT                   /gene="pi132"
FT                   /locus_tag="L63293"
FT   CDS             463359..463928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi132"
FT                   /locus_tag="L63293"
FT                   /product="prophage pi1 protein 32"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L63293"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04565"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI99"
FT                   /protein_id="AAK04565.1"
FT                   /translation="MLLYFITGCPMGSLLLLERRCPMRLHRCANVGCRELIPLKHNYCQ
FT                   KHYDERLGNYINQRAESKAKASLTLRGQRNQAEQNREYDQTRRKELHNGFYQDKRWSKV
FT                   SEYVKARDGYVDAIEGKVWDKGDLIADHIIPRRLLSGMEQYNTDNLWLLTKSQHNKKTA
FT                   IENKLSDQQLKNVGRDWWKKVLKNKK"
FT   gene            464045..464497
FT                   /gene="pi133"
FT                   /locus_tag="L64021"
FT   CDS             464045..464497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi133"
FT                   /locus_tag="L64021"
FT                   /product="prophage pi1 protein 33, terminase small subunit"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 43% identical to small subunit
FT                   (orf152 gp) of terminase from Streptococcus thermophilus
FT                   bacteriophage Sfi21"
FT                   /db_xref="EnsemblGenomes-Gn:L64021"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04566"
FT                   /db_xref="InterPro:IPR006448"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI98"
FT                   /protein_id="AAK04566.1"
FT                   /translation="MAKKSFKDINDGRLIYQPPDHLGRTAKQIWRRVVLFLETQKPVER
FT                   IDQTLVEMYCTQYEIYRNSYEHLKKHGEVQEIYKPVQDMTGEIIDRQFQGFKRNPMTQI
FT                   YSDAIKNLTKIGSELGLSPKSRSELMGLNMQEDEEEIDWTSKFGGG"
FT   gene            464497..466311
FT                   /gene="pi134"
FT                   /locus_tag="L64491"
FT   CDS             464497..466311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi134"
FT                   /locus_tag="L64491"
FT                   /product="prophage pi1 protein 34, terminase large subunit"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 37% identical to large subunit
FT                   (orf623 gp) of terminase from Streptococcus thermophilus
FT                   bacteriophage Sfi21"
FT                   /db_xref="EnsemblGenomes-Gn:L64491"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04567"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI97"
FT                   /protein_id="AAK04567.1"
FT                   /translation="MDNYKDLTERYPDDPALSYAIGVLDGTIISGEKIKQACKRHIDDL
FT                   RRIDKDDAFIYIYDSEQAKKIVEFSTLLKDVTSGEPFEASPYQKFILASVQGWRNPETK
FT                   GMRFKTIFISMARTNGKTQVLATYALYNFLFGSPKINRQLAVSSIDIAHTHNLFNYMRF
FT                   NWIQLKDGVFKKLAKALDINDNSQVMEIKKQSAVMKKLSAQGSPADSDHYTTGIVDEYH
FT                   LFGQKQRDFISSMTSGMVNNPLAQMFFISTAGVDPTVPMFEDYKRYSKMLESGDWSSSE
FT                   KDLVLIWDQDSEDEAYLIETWPKSNPLMEIESMRKNLTEGMITERDSLNSQGRIRDFYV
FT                   KNMNLWQNAKKNAYLPLDLVQDAIVDEFDYFGRDVFIGFDYSQTNDDTSLAFVFPHSGS
FT                   KFHLYQHSWIPIAKAGSIEAKEQRDNIDYRAVQEKGFATITRDRFGLIDEDEVFNWMLN
FT                   FIEKNELRVKAILYDQWGTGNFIRRLDEVKEEYLLIPVRQGIKSLNEPTKFLQSSFIKH
FT                   NITMLDDQALIQGLVNAVTVSDNNGIKLDKNVNSQKIDAADAIVNALYEGQFYFNDFTN
FT                   VEEKKTNSPFGNMNDEEISDYFINGFSF"
FT   gene            466481..467560
FT                   /gene="pi135"
FT                   /locus_tag="L66478"
FT   CDS             466481..467560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi135"
FT                   /locus_tag="L66478"
FT                   /product="prophage pi1 protein 35"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 31% identical to a hypothetical
FT                   protein of Lactobacillus bacteriophage phi adh (acc no
FT                   AJ131519)"
FT                   /db_xref="EnsemblGenomes-Gn:L66478"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04568"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI96"
FT                   /protein_id="AAK04568.1"
FT                   /translation="MSILNPFERRSSITPNNYYPFMVQNGSIVPNSLVDATEALKNSDL
FT                   YAVTSLISSDIAGTRFIGNQVFTSVLNNPSHLTNAFSFWQTAILNLLLNGNVFLAILKG
FT                   DNSLMKELRLIPSNAITIDLTDDTLTYEVNQFDDYPSAKYNASEMIHVKIMAYGVDTLH
FT                   NLVGHSPLESLTSEIGQQKEANRLSLSTLKGALNPTSVVKVPQGTLSSEAKDSIRKEFE
FT                   KANGGNNSGRVMVLDQSADFSTVSINADVANYLNSMNWGRTQIAKAFGVSDSYLNGTGD
FT                   QQSSLDQIKDLYVNALNRFIEPLISELRIKCDSSIGVDMSPITDYSNSVFKADILNWVK
FT                   EGIIEPTEAKTLLESKGII"
FT   gene            467560..468147
FT                   /gene="pi136"
FT                   /locus_tag="L67524"
FT   CDS             467560..468147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi136"
FT                   /locus_tag="L67524"
FT                   /product="prophage pi1 protein 36, prohead protease"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 36% identical to orf26 of
FT                   B.subtilis bacteriophage phi-105"
FT                   /db_xref="EnsemblGenomes-Gn:L67524"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04569"
FT                   /db_xref="GOA:Q9CI95"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI95"
FT                   /protein_id="AAK04569.1"
FT                   /translation="MENIEYRYFDSTELETRSPTNTGFIGQIAGYAIKFNTPSTAMAPF
FT                   IEYIAPIALDNVDLSDVLALYNHDYANVLGRVDAGTLKLSIDKVGLHFVLDMPDTTVGH
FT                   DVYNNIKAGNLKGMSFGFSVADGGDSWQQGADSPIRIINQLQTLSEISVVSRPAYDDTS
FT                   VQVTRSMDAFLSERTRKYKEKVKIYLGGLNEN"
FT   gene            468137..469450
FT                   /gene="pi137"
FT                   /locus_tag="L68137"
FT   CDS             468137..469450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi137"
FT                   /locus_tag="L68137"
FT                   /product="prophage pi1 protein 37, capsid protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 28% identical to orf27 of
FT                   B.subtilis bacteriophage phi-105, encoding capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:L68137"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04570"
FT                   /db_xref="InterPro:IPR006444"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI94"
FT                   /protein_id="AAK04570.1"
FT                   /translation="MKIEKLKKDLATKTAELNTKKAEIRSFTESEDKTIDEVKAGMTEI
FT                   KEKEDEIKEIRSNIEVLEQASALKVEEKRDDSDLVAPELEENSADNEEDDPEKLKTETK
FT                   SEAEKDKKTVKDEEKRDAGGLQDMKLKVGGEIADKKVTAFADYLKTGEVRDVTGIALKD
FT                   GKVIIPETILTPEKEVHQFPRLGSLVRTESVTTTTGKLPIFNNSTDLLTAHTEYGQTTK
FT                   NATPVITPILWDLKTYTGGYVFSQELISDSSYDWQAELQSRLIELRDNTDDSLIITALT
FT                   DGIKKTTSTYLLGDLKKVLNVTLKPQDSAAASIVMSQSAYNLFDMATDAMGRPLLQPNV
FT                   TAATGYTLLGKTVVIVDDKLFPSASAGDVNIVVAPLKKAVINFKLTEITGQFQDTYDIW
FT                   YKQLGIFLRQNVVQASKDLIVNLTGKLKAVTVVQSTAV"
FT   gene            469461..469766
FT                   /gene="pi138"
FT                   /locus_tag="L69467"
FT   CDS             469461..469766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi138"
FT                   /locus_tag="L69467"
FT                   /product="prophage pi1 protein 38"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L69467"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04571"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI93"
FT                   /protein_id="AAK04571.1"
FT                   /translation="MALITAQELLDENHIDSNYDEIATMNRLIHDASALIRGSISDSVT
FT                   DEQIMDNLPDQYNRAVSALATRLYFSRDLSEGYGIGIQIMINQIRARMWEVLNGTT"
FT   gene            469753..470088
FT                   /gene="pi139"
FT                   /locus_tag="L69762"
FT   CDS             469753..470088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi139"
FT                   /locus_tag="L69762"
FT                   /product="prophage pi1 protein 39"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 33% identical to putative
FT                   head-tail joining protein (orf10) of Streptococcus
FT                   thermophilus bacteriophage DT1"
FT                   /db_xref="EnsemblGenomes-Gn:L69762"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04572"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI92"
FT                   /protein_id="AAK04572.1"
FT                   /translation="MAQLNLADFNKKVQLGDVKTLTNEYTGAGYDSFVPKINVWFASKT
FT                   RTLSQSYQLQGTALENSRTIIIRHNSSAEKLKAAVIDNVQYDIVNYSPDETSNIIRYDY
FT                   LTLKRSS"
FT   gene            470085..470570
FT                   /gene="pi140"
FT                   /locus_tag="L70070"
FT   CDS             470085..470570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi140"
FT                   /locus_tag="L70070"
FT                   /product="prophage pi1 protein 40, tail component"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 35% identical to putative tail
FT                   component protein (Orf11) of Streptococcus thermophilus
FT                   bacteriophage DT1"
FT                   /db_xref="EnsemblGenomes-Gn:L70070"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04573"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI91"
FT                   /protein_id="AAK04573.1"
FT                   /translation="MMEEKQLFEDIMNGIIFQAESVSTSLTVEDKAKITKAGANAFAIG
FT                   LEKVTKDKHYRIRKTGENPHLADSILVQNTNIDGIKDGNSTVGWDYTKSRVGHLIENGT
FT                   RFPMYSKKGTKYRKGGQVAITSDPFVSTYRDSMEAQVAMFSAEAEVFSEILKKKGAE"
FT   gene            470567..470962
FT                   /gene="pi141"
FT                   /locus_tag="L70498"
FT   CDS             470567..470962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi141"
FT                   /locus_tag="L70498"
FT                   /product="prophage pi1 protein 41, tail component"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 33% identical to a putative tail
FT                   component protein (Orf12) of Streptococcus thermophilus
FT                   bacteriophage DT1"
FT                   /db_xref="EnsemblGenomes-Gn:L70498"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04574"
FT                   /db_xref="InterPro:IPR008524"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI90"
FT                   /protein_id="AAK04574.1"
FT                   /translation="MRPTQEVSQIVGAFRPSWLVFENFIPKEHVNDLDNTQVLLTEFKS
FT                   DITNYGDGTFNSVVLAVTIQIFYGFNLSESMLLAEIELMEKLKDSGWLTISSEPHYLDV
FT                   STNTTKQQTKKNITVEKIVEINELKGE"
FT   gene            470964..471569
FT                   /gene="pi142"
FT                   /locus_tag="L70961"
FT   CDS             470964..471569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi142"
FT                   /locus_tag="L70961"
FT                   /product="prophage pi1 protein 42, small major structural
FT                   protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 46% identical to small major
FT                   structural protein of Streptococcus thermophilus phage
FT                   phi7201 (acc no AF001793)"
FT                   /db_xref="EnsemblGenomes-Gn:L70961"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04575"
FT                   /db_xref="InterPro:IPR006724"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI89"
FT                   /protein_id="AAK04575.1"
FT                   /translation="MTIVGLKKTYLGLIDKKTGKIIAGPEGLTTDGLYMSNPKDLGTAS
FT                   ANITNIAAAGTQKFGDNGLVDVVSSKSFPQVAAVWNNLPFDIKAKIKGEVSDKKGGYVQ
FT                   SQDLPQVALIIESELIDRSHSIFYAFGNGHMTETALNIQTDNAAQNRVEDALTYQSLAF
FT                   EAWNNQGMKTFNSADSGFDKTAMLKEVMGGYAASGLGV"
FT   gene            471629..471973
FT                   /gene="pi143"
FT                   /locus_tag="L71563"
FT   CDS             471629..471973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi143"
FT                   /locus_tag="L71563"
FT                   /product="prophage pi1 protein 43"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L71563"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04576"
FT                   /db_xref="InterPro:IPR009681"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI88"
FT                   /protein_id="AAK04576.1"
FT                   /translation="MEIKIKKLKKTVEVKASIKNLKKSYKFAKNMAEAEEKISEGNDEL
FT                   VLDYLDSIIEFVSDIAKLSKKEKEELEELEMEELMEVVSYIVAKLQGASDSDIKKAKEN
FT                   GEVGLAQESE"
FT   gene            472143..475982
FT                   /gene="pi144"
FT                   /locus_tag="L72137"
FT   CDS             472143..475982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi144"
FT                   /locus_tag="L72137"
FT                   /product="prophage pi1 protein 44, tail component"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 26% identical to putative tail
FT                   component protein (Orf15) of Streptococcus thermophilus
FT                   bacteriophage DT1"
FT                   /db_xref="EnsemblGenomes-Gn:L72137"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04577"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI87"
FT                   /protein_id="AAK04577.1"
FT                   /translation="MEFVNLKRKEEYMAKEKVAGTLATNIGVNTTNAVTSIESLKNSVK
FT                   DSTNAWKQMESQMKLSGDTLGASKAKYEGLSDSLSKQKSVLERLKQEQSEVNRSTSAGE
FT                   KAYQKYASQITQAEVKLTALNGQQDKAKQAYEYQKSGLAKLNEEVQHSNKLTEERVKQL
FT                   EAEGKTEEANKAKIDGLKSAQEKYSQILKIQKTELEKLGESGDKNSKAYRLQEVRVAQM
FT                   STKVSEATRDIKRLNGTEIKPRTEGIGKVKSQLRSLNGLLDRTHSHFKDVFLGNILATG
FT                   VIGAIGDIKSKFTGALEAGVEYNKEMQNLSVSLNNFTNGNQKLNDSLVDNIKNLREESG
FT                   YSIDTLSLLTKKTYGLTGSADGAKKLSDAFVNLGRATGKSDDAMQNIITKFTQMNASGE
FT                   ITSGSITKMEKTLPGFAKTLATTMGVSRDKLNELANNGKISMSDLSKTIENMSAAKPKG
FT                   LENYLTSFDGFSGHLKEKYQSLSGKITEGFFKTNNNFLKNISKSLDGEETEKAFTHIGD
FT                   SANKAVTTISTAFSSVFKGTKNPLADFANGLANEIEKLGNFISKHANDIKNFFGMVKEL
FT                   GSAAFKLIGDTLKTVIPWLEKFGTWASKHPKDVKKIALAIIGLNVALKGTLGVLKGVEK
FT                   YEALKKLFVIKDAEKGTKALTGLGKAAVGAGKGMKLAFNFLKTNPFILIITGIVAVVAA
FT                   FVELYKHNKKFRKFINGIAKAVSKWAGSVVKWFKKTWDGVSKGFNNFGKSFSKVFNSLL
FT                   NGIKNAWNGAWSWIGNVFNKYIDIFKSVLKLFTDFFTGKWGNLGKDIQKIWNALWGFVE
FT                   SIFGKKVDSIKKGIEGFGTKIWDTFNTIKTKVSDFWKGMWDGLIQFGKDGINSVIGVIN
FT                   NGIGGINGVIHTFGGSKNAISKIPKLANGTKGAPKGVALINDAPGEHYQEAVIDNSGQM
FT                   HVLEGRNRLVNFQGGETVVPAHAIPHFENGTPDWLSSIGSWVKDKWDGLTEMIKHPIKT
FT                   LTHFMTNAISGISGSPLVTSIAPALGNGFVNAIVDPIKKLLGSLKKKHEDDGGGSQGSP
FT                   SGSGVQRWAGQVKQALAANGLSTSQDMIDRVLRQIASESSGNEKAVQGNIGDINNITGD
FT                   LAKGLMQTISSTFNANKFPGHGDIFNGYDNLLAALNYAKKKYGPSLSFLGNGHGYENGG
FT                   IINAHGFYEIGEGNKPEMVIPLSVEKNARANQLLAEANQRINGNNRASSNTADLSPVLT
FT                   LLSNIFNSIEDVKKNPLIAYALLDGRNVSQGLAPYMNQALTDYVNQQDRLWGKN"
FT   gene            475985..477520
FT                   /gene="pi145"
FT                   /locus_tag="L75985"
FT   CDS             475985..477520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi145"
FT                   /locus_tag="L75985"
FT                   /product="prophage pi1 protein 45, tail component"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 27% identical to putative tail
FT                   component protein (Orf17) of Streptococcus thermophilus
FT                   bacteriophage DT1"
FT                   /db_xref="EnsemblGenomes-Gn:L75985"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04578"
FT                   /db_xref="InterPro:IPR006520"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI86"
FT                   /protein_id="AAK04578.1"
FT                   /translation="MAFSVKFNDVDLSTIVDGFTAITRNIGAGWTNTVQPNPIIGADFT
FT                   QNSINSKSITVNFIANVKLDRFTSVRKALASALNVKQPAALIFDDDPNQVWWAVPDGTP
FT                   TLDESSFYQAVGSITFLVPSGVSESVETNVLNASNSGGQLGTITNNSDSSVDVEINNTG
FT                   NLDAFPTIEITNVHENGYIAIAGQNGAIEIGNRQEADGVVKPESEYLYNSNSDLSFSKF
FT                   IDATGTANPQNSGLGTNGTISFQSDGLRFATQGTMSGSQFAGGGMKVMTLPADSNGHVG
FT                   AVNFYSHFNLFAWAGAMGQTGILQILFTDINDKLVAGYGITKSDMSGNSAKCSFWVGGN
FT                   TPKEYTSFGFETNNAEKNQKYPNNMFNSSTGDADFLKEGASLGFYWYGSRKTIYVPELA
FT                   DVEVSKVYLYLGQFKGSNKFINNLSIRQVNLTKNNVSVWKDVPNRYAANSKITVNMNGK
FT                   DTVVINGMPAIQEKIRGTEPFSIPPGRSTLKILQSTWNTTPPIVQISYKERNL"
FT   gene            477520..481845
FT                   /gene="pi146"
FT                   /locus_tag="L77514"
FT   CDS             477520..481845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi146"
FT                   /locus_tag="L77514"
FT                   /product="prophage pi1 protein 46, tail component"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 37% identical to putative
FT                   tail-host specificity protein (Orf18) of Streptococcus
FT                   thermophilus bacteriophage DT1"
FT                   /db_xref="EnsemblGenomes-Gn:L77514"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04579"
FT                   /db_xref="InterPro:IPR015028"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI85"
FT                   /protein_id="AAK04579.1"
FT                   /translation="MEIVVHDNTLKTVAIINNDIPMLPSFFNDNWHRYKDQGAETFIFT
FT                   VNKFINGQLQDYCRFLNEQAYISFTYDGIDHLFGVENVQESDYQITLTCSSLNLELRNE
FT                   QANALVNTSSHNIQWYFDQMELISNAQITIGTNEVSSLTRTINYDGQESKLARLISVIG
FT                   NFNAEFEFITHLNDDGTLDSIILNIYRANDGVNIQGVGTNRNDVSLNFGKNISGITRTG
FT                   DTTNLFNATKITGSDDLNWNSSEFSYVNSDGVEEFYKRKNDDTAFAPLSLNLFKSQIKS
FT                   NNGDKWIRKDFQTEYTNVNDMWGYCVSQFKQFAYPTVTYEVLANSSLVLESVGNDRPLS
FT                   IGDTINIQDDNFMDSDGNVGLLLSARVSEMEISFSNPTLNKITFSNFKKQQSEASADIQ
FT                   AIVNQLVDAATPYIGSIDTTNGTQFKNGTGSTTLSAHIFKGSATTETIADSYEWSKDGT
FT                   VIAPTQTITVDASGVSDKAVYSFKATVAGKVVANQSVTITNVDDGTNGRSVTNVSQKWR
FT                   LTTTTATPTQTWSDAGWLTTQPTTTATNKYLWSITRTTFNLAPLTQDVIEQKAVYGDKG
FT                   DKGDTGNDGRAGKDGVGLRSTTVTYTISSSGTVTPTTGWTSQVPTLVKEQYLWTKTLWT
FT                   YTDNTSETGYSVSYIAKDGNNGHDGFPGKDGVGISNTIIEYVGAVSGTSKPTGGWSTTI
FT                   PTVPAGQYLWTRTTWQYTDGTSEQGYINALMGLTGASGRDGIAGKDGKGIKATAITYQA
FT                   STNGTTAPTGTWSTSVPSVAKGSFLWTRTIWTYTDNTTETGYAVAYMGTNGNNGTNGIA
FT                   GKDGTGIKTTTITYAVGTSGTTAPTGGWNSQVPNVPAGQYLWTKTVWDYTDKTSETGYS
FT                   VSKFGEKGDKGDQGVQGIQGVDGRQGIPGPKGADGKTQYTHIAYANSADGKTNFSTSDS
FT                   NRTYIGMYVDFNINDSTTPSDYSWTLVKGADGTQGTPGKPGTDGKTPYFHTAWSYSADG
FT                   TDGFTTVYPNLNLLDGTSKSAKTATIYKDDVAGIIYWDTKQLSEKTITGSVYLDLTNSP
FT                   YDVWFQLYTTNGVLYGNTIKAGQKGYSRFSGKVSTITDNNANIAFRTPTKVTDTITFDY
FT                   SEMKIEEGSTATPYMPSSSKITTADYPSYIGQYTDFKQSDSTNPSDYTWSLIRGNDGDP
FT                   GKVVSDTEPTTRFKGLTWKYSGTADLTASDGTVIKPNTEYYYNGTHWMINYLSANNIEA
FT                   NSIKADKIDAKNLTITDGEFVSTTTNGPVTTSTEIKDNHIAISKTDGTVNTKNDLAVDT
FT                   EQGFAMKFTNNTTGLTREASVNFQGVSTSDSNGNYAQLTPQGTKLSTDVPWTDITRASG
FT                   VGTSGTLRARINNGVFYAQSKDVTIPSIAPNSLITIGTMSSKFSGVSGFDTLGLLYSPG
FT                   QLSVASVTVGNDGKINIGNPNPTTMSGKVIQFSINIPLG"
FT   gene            481865..482191
FT                   /gene="pi147"
FT                   /locus_tag="L81862"
FT   CDS             481865..482191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi147"
FT                   /locus_tag="L81862"
FT                   /product="prophage pi1 protein 47"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 Phage related
FT                   functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L81862"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04580"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI84"
FT                   /protein_id="AAK04580.1"
FT                   /translation="MESVIQHALVVVKDVIDNWGAITVVSIIIGSGYRILNKKQELRDK
FT                   AQEDQLLIMRQEIKRIELSQAINHDYGLQIVSSIFDEYTSLGGNHYAHEIYEKYKKEKE
FT                   HENN"
FT   gene            482178..482465
FT                   /gene="pi148"
FT                   /locus_tag="L82103"
FT   CDS             482178..482465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi148"
FT                   /locus_tag="L82103"
FT                   /product="prophage pi1 protein 48, holin"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 38% identical to holin of
FT                   Staphylococcus aureus bacteriophage phi PVL, 98% identical
FT                   to orf95 of Lactococcus lactis phage BK5-T"
FT                   /db_xref="EnsemblGenomes-Gn:L82103"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04581"
FT                   /db_xref="InterPro:IPR006479"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI83"
FT                   /protein_id="AAK04581.1"
FT                   /translation="MKTIDKGTLTRTVLLWLAIINQILTALGINPLPLDDNTVSTVITT
FT                   VFALWAWWKNNDFTHAAKKGTELTKSLKNGDSVQVVKASDADHEFTEGGE"
FT   gene            482465..483244
FT                   /gene="pi149"
FT                   /locus_tag="L82453"
FT   CDS             482465..483244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pi149"
FT                   /locus_tag="L82453"
FT                   /product="prophage pi1 protein 49, muramidase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 Phage related
FT                   functions and prophages. 97% identical to orf259 of
FT                   Lactococcus lactis phage BK5-T"
FT                   /db_xref="EnsemblGenomes-Gn:L82453"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04582"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR008044"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI82"
FT                   /protein_id="AAK04582.1"
FT                   /translation="MSSIENMIAWMQARKGKVTYSMTSRMGPKSYDCSSSVFFAMIAGG
FT                   FLSEGSMGNTETLFGMSGTKLKEISRGEVQRGDIFISGTPGGSAGSDGHTGIFLSNGSF
FT                   IHCSYTHNGIAVDTNDAYMSTRLPHHFYRIVGSGSGKTDSKPQMITLNVDGQFGNATAK
FT                   RLQEYFDTAGKDGVISHQYKQTFNQNIYAAQFDSSLTGSNVVKALQRFLGIGQDGLFGQ
FT                   GTIKALQKHLGTTQDGTISPVSDSVRELQRRLNANKL"
FT   gene            complement(483349..483552)
FT                   /gene="yeiD"
FT                   /locus_tag="L83361"
FT   CDS             complement(483349..483552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeiD"
FT                   /locus_tag="L83361"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L83361"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04583"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI81"
FT                   /protein_id="AAK04583.1"
FT                   /translation="MNLLKKYFLEYKNYITFYFRCQEKSALALEKSALSLPKYLVICTC
FT                   IWNSIYDKDIILIYLKKNSNIC"
FT   gene            484226..484987
FT                   /gene="truA"
FT                   /locus_tag="L0331"
FT   CDS             484226..484987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="L0331"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.06 tRNA modification.
FT                   FORMATION OF PSEUDOURIDINE AT POSITIONS 38, 39 AND 40 IN
FT                   THE ANTICODON STEM AND LOOP OF TRANSFER RNAS"
FT                   /db_xref="EnsemblGenomes-Gn:L0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04584"
FT                   /db_xref="GOA:Q9CI80"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI80"
FT                   /protein_id="AAK04584.1"
FT                   /translation="MTRYKATIAYDGTDFAGFQSQTNQRTVQKEIEKILTKLNSFEPVI
FT                   LQGSGRTDSGVHAFGQVIHFDLKGKVRDLERLRFGLDTQTPADIAVKKVELVPDDWHAR
FT                   YQKHEKTYEYYLENSITRSPFQRHSKAYFRYPLNFERMQEAMSKLVGEHDFTGFTASGS
FT                   SVDDKVRTIYQAEIIRLDEENFKFIFRGNGFLYKQVRNMVGTVIKIGNDRMPVSQIDKI
FT                   LTSKNRDFAGPTAAPEGLYLKEVKYAENTDI"
FT   gene            485020..485808
FT                   /gene="thiD2"
FT                   /locus_tag="L0202"
FT   CDS             485020..485808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD2"
FT                   /locus_tag="L0202"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="EVIDENCE BY HOMOLOGY BIO02.11 Thiamine. functions
FT                   also in a salvage pathway"
FT                   /db_xref="EnsemblGenomes-Gn:L0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04585"
FT                   /db_xref="GOA:Q9CI79"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI79"
FT                   /protein_id="AAK04585.1"
FT                   /translation="MPKNLNESKKILTIAGSDILSGGGMQADLATFAANGLYGFCALTS
FT                   IVTVKEDKFFVHPVEKELFQEELESLSDVDFSAIKIGLLPNKEILELTKNWLTDLSVKS
FT                   DTPIILDPVIVFKENADYSVNEMRDLFISQLFPLATVITPNLKEAEILTGLSVKSKSEM
FT                   KEAAKLLHDFGAKNVVIKGGNRFDQKQAIDLAYDGKAFYELSSPIIENNNNGAGCTFAS
FT                   SIAANMAYNHPFKDSVKNAKDFVYQAIQNANEYGVFQNKK"
FT   gene            485857..486348
FT                   /gene="yeiE"
FT                   /locus_tag="L85854"
FT   CDS             485857..486348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeiE"
FT                   /locus_tag="L85854"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L85854"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04586"
FT                   /db_xref="GOA:Q9CI78"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI78"
FT                   /protein_id="AAK04586.1"
FT                   /translation="MDNRNIKKLTLLAIWTAVTFVLGRLFTFPIPGSAGNILTLLDVGI
FT                   YTAVFLFGKREAAIIGGFAAFLLDLTAGYSNYMFFSLIIHGGQGYLAGLTRYKWLNFLL
FT                   SLVFMVGGYFIVGGLMYGWGSAIAGLWVNIIQVVVGFALAKVLSPLIERTGILNGFRKA
FT                   "
FT   gene            486329..486871
FT                   /gene="yeiF"
FT                   /locus_tag="L86338"
FT   CDS             486329..486871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeiF"
FT                   /locus_tag="L86338"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.General.
FT                   44% identical to YwlG protein from B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L86338"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04587"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI77"
FT                   /protein_id="AAK04587.1"
FT                   /translation="MDLEKLKKDTQVIIDDVIKQTEIKAGQVFVLGLSSSEVNGGLIGH
FT                   ASSSEIGQVIVSVIHKTLSDKGIYLAVQACEHLNRALLIEEELAEKKDWEIVSVIPQLH
FT                   AGGSGQVAAYQLFKSPVEVEHIVANAGLDIGDTSIGMHVKHVQIPVRPILRELGGAHVT
FT                   ALKSRPKLIGGERARYK"
FT   gene            486872..488008
FT                   /gene="yeiG"
FT                   /locus_tag="L86881"
FT   CDS             486872..488008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeiG"
FT                   /locus_tag="L86881"
FT                   /product="Amino acids and amines aminotransferase"
FT                   /note="BIO06.02 ENERGY METABOLISM. Amino acids and amines
FT                   aminotransferase; EVIDENCE BY HOMOLOGY . 35% identical to
FT                   several amino acid aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:L86881"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04588"
FT                   /db_xref="GOA:Q9CI76"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI76"
FT                   /protein_id="AAK04588.1"
FT                   /translation="MKEMLIMTPGPTEVAENVRLARAKATTNPDIDLAFYDFYKKTCSK
FT                   LAQFLKTKNDVRVLAGEGILGLEAACASLTEKGDRVLVLDNGIFGHGFSDFIELYGGEA
FT                   ILLESSGKEAFSLEILEKFLEKDHDFKYATVVHCDTPSGVLNDLSSICPLLKKYGILTV
FT                   VDSVAAMGGEELQVDKWQIDIALGGSQKVISAPPGLTIASISTEAYQAMTERKSPIASF
FT                   YCNLLTFKDYYEKKWFPYTMPISDIYGLDQAIDNLLADQEILKRHAMIGHATRQAIENS
FT                   PLELYLQNGYSNTVSVIKVPEGLNDQEILRKMRENYRVMITGSFDHLAGKVLRIGHMGE
FT                   NARPNKVAYSLYALQKVLEDFGIAFKNNLQEDFLEALN"
FT   gene            488243..489850
FT                   /gene="pyrG"
FT                   /locus_tag="L88252"
FT   CDS             488243..489850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="L88252"
FT                   /product="CTP synthetase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO08.04 Pyrimidine
FT                   ribonucleotide biosynthesis. 98% identical to PyrG protein
FT                   of Lactococcus lactis cremoris"
FT                   /db_xref="EnsemblGenomes-Gn:L88252"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04589"
FT                   /db_xref="GOA:Q9CI75"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI75"
FT                   /protein_id="AAK04589.1"
FT                   /translation="MSTKYIFVTGGGTSSMGKGIVAASLGRLLKNRGLKVTVQKFDPYL
FT                   NIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTSGKVYSEILRKER
FT                   KGEYLGATVQMVPHVTNMLKEKIKRAATTTDADIIITEVGGTVGDMESLPFIEALRQMK
FT                   AEVGADNVMYIHTVPILHLRAAGELKTKIAQNATKTLREYGIQANMLVLRSEVPITTEM
FT                   RDKIAMFCDVAPEAVIQSLDVEHLYQIPLNLQAQNMDQIVCDHLKLDAPKADMTEWSAM
FT                   VDHVMNLKKKVKIALVGKYVELPDAYISVTEALKHAGYSSDAEVDINWVNANDVTDENV
FT                   AELVGDAAGIIVPGGFGHRGTEGKIAAIKYARENDVPMLGICLGMQLTAVEFARNVLGL
FT                   EGAHSFELDPETKYPVIDIMRDQVDVEDMGGTLRLGLYPAKLKNGSRAKAAYNDAEVVQ
FT                   RRHRHRYEFNNKFREDFEKAGFVFSGVSPDNRLVEIVELSDKKFFVACQYHPELQSRPN
FT                   RPEELYTEFIRVAVENSK"
FT   gene            489989..490569
FT                   /gene="hicD"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.02 ENERGY METABOLISM.
FT                   Amino acids and amines. 42% identical to
FT                   L-2-hydroxyisocaproate dehydrogenases. There is a
FT                   frameshift, maybe a pseudogene. Catabolism of
FT                   branched-chain amino acids."
FT   gene            complement(490934..491806)
FT                   /gene="yejC"
FT                   /locus_tag="L90946"
FT   CDS             complement(490934..491806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yejC"
FT                   /locus_tag="L90946"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L90946"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04590"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI74"
FT                   /protein_id="AAK04590.1"
FT                   /translation="MAPTPINKNKVVCLVNGRVHRRSGGDFLENLDPSLQTVIMRDYPE
FT                   ATSHDFICNEHQVKFRLEVLDTLFHLDLQKNFTVNDLLNEELTKANFEIHDVEEQLQTQ
FT                   ETIGERVADKVTEFVGSWAFILTYLGILVVWMFVNVSGIFGVEWDKYPFILLNLFLSIT
FT                   AAMQAPLIMMSQNRAAHHDRLSAKNDFQVNVKSEKGVAALHEKLDHLMMDDQASNMQIQ
FT                   KIQTEMLGDIQILLNEVYQQNQDIRERLDDVEDQLDDFEETFDSFEETLDSIEENTDDE
FT                   EEEGMANAD"
FT   gene            complement(492452..492931)
FT                   /gene="yejD"
FT                   /locus_tag="L92464"
FT   CDS             complement(492452..492931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yejD"
FT                   /locus_tag="L92464"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 36%
FT                   identical to a protein from Actinobacillus
FT                   actinomycetemcomitans. Homologs not detected in
FT                   Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L92464"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04591"
FT                   /db_xref="GOA:Q9CI73"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI73"
FT                   /protein_id="AAK04591.1"
FT                   /translation="MNKLFNQAVNVYLAAPFFSESQIKKVELLENALSKNKTVANFFSP
FT                   MRCQHPESLPQEVEAFTPEWAKATMENDVNEVNKADIIVAIVDFDHQDTDSGTAWELGY
FT                   AIALEKPTYLIRFEDTIPANIMLTERNRAFFTQIEQVEEYDFLESKLIPYSGKYQ"
FT   gene            complement(492915..493337)
FT                   /gene="yejE"
FT                   /locus_tag="L92927"
FT   CDS             complement(492915..493337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yejE"
FT                   /locus_tag="L92927"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:L92927"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04592"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI72"
FT                   /protein_id="AAK04592.1"
FT                   /translation="MGMVSDAVIRHQGKVIAVYPDGILPLEPPRQNASQLYLTSGMDER
FT                   KRKLIDLGEAFVILAGGFGTMEESFQLLTEMSINQTAVRPVIFVGRKFYQPLFDLLRLQ
FT                   LKEGMISKEVIDAISLVDTAEETIELLGDLKLEQVV"
FT   gene            complement(493469..494122)
FT                   /gene="dukA"
FT                   /locus_tag="L93481"
FT   CDS             complement(493469..494122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dukA"
FT                   /locus_tag="L93481"
FT                   /product="deoxynucleoside kinase"
FT                   /EC_number="2.7.1.113"
FT                   /note="EVIDENCE BY HOMOLOGY BIO08.02 Nucleotide and
FT                   nucleoside interconversions. HETERODIMER OF A
FT                   DEOXYADENOSINE AND A DEOXYGUANOSINE KINASE"
FT                   /db_xref="EnsemblGenomes-Gn:L93481"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04593"
FT                   /db_xref="GOA:Q9CI71"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI71"
FT                   /protein_id="AAK04593.1"
FT                   /translation="MTVLVLAGTIGAGKSSLTEMLAEELKTQAFYESVDDNKVLPLFYE
FT                   NPQKYAFLLQIYFLNKRFDSIKRALSDNNNVLDRSIYEDSLLFHLNADLGRADETEVEV
FT                   YDDLLNNMLEEIDSLSFKKRPDLLIHVKVSFDKMLERIKKRGRQFEQLEYDPSLYDYYK
FT                   ELNSRYDTWFEDFDICPKIQIGGDKYDFVEDEQSKIHVLQQIKEKLKEIEGENN"
FT   gene            494602..497784
FT                   /gene="dnaE"
FT                   /locus_tag="L0307"
FT   CDS             494602..497784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="L0307"
FT                   /product="DNA polymerase III, alpha chain 2"
FT                   /EC_number="2.7.7.7"
FT                   /note="EVIDENCE BY HOMOLOGY BIO10.02 DNA replication,
FT                   restriction, modification, recombination, and repair. DNA
FT                   polymerase III responsible for most of the replication
FT                   synthesis in bacteria. Exhibits also 3' to 5' exonuclease
FT                   activity."
FT                   /db_xref="EnsemblGenomes-Gn:L0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04594"
FT                   /db_xref="GOA:Q9CI70"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI70"
FT                   /protein_id="AAK04594.1"
FT                   /translation="MFAPLNTKTEYSFLDSVVKVDDYLETAHRLGYQTVGICDVGNLHA
FT                   AFRFVRKAQKFNLQPIISIELNFEWRGLPIAFSFIAKDTEGYKNLLRISTLHNYGRRQF
FT                   SDIQNHLSGIALIIPETYGSLSELTELSSVADEAFIGIDQLTDKGAKFNLPTLPFPAIR
FT                   YLNFADNEILAILHAVRDGVSFDESLTISSNELLQRPEAYETYFLKYFPQALKNLSALT
FT                   AKIAYQFDEKLELPRFDKKRQAVEHLREEATLGLSARLEEKNLLTEVSSVNLQDLSVYQ
FT                   ERLEKELSVIHQMGFDDYFLIVADLLRYAREQDIYCGMGRGSAAGSLVAYVLGITQVDP
FT                   VQHNLFFERFLNPERVAMPDIDIDMPDDRRAELLAYMKNRYGSDHVAQIVTFSTLGKRQ
FT                   ALRDVGKAFGMTEAELSNLTRMLVRRFGTLADEYENNQRFKAEVLKNGKLKRIYEVARR
FT                   IEGMPRQTSTHASGVVLSEESLVNYVSLKPSEDLALTQYEAPDVEAIGLLKIDFLGLRN
FT                   LTIISRLRDLVKRRQKIDIDPLKINLEDEDTLALFRAGNTMGIFQFENPQMRRFLRNLA
FT                   PSKFDDIVDATSIFRPGPSQFIPQFVARRHGKEIVPTVDDSISEILKPTYGIMIYQEQI
FT                   MQVAQAFAGFSLGKADLLRRAISKKKGSELEKLREDFLDSASHNGHSKEKAEEIYDLIE
FT                   RFANYGFNRSHGFAYGALAFQIAYFKAHFPDEFYEIQLRDRKREVMILDALENGFEIEK
FT                   PSINLMKIGDFVKNKKIRLGLAHVQGISRDLAKWIVENQPYKDLADFVEKLPNNFHKKE
FT                   NILPLIQIGAFDYADSNRGKLAYNLADHANLLNYYSDDIFMASSGGGFAYHEAEDYSET
FT                   EKYDFEKNLLGIGVTPHPLQNLARRFEGNFTPLAQLVKNRRMTILVEINYIRTHRTKTG
FT                   QTMAFLTVSDSRENFDVTLFPEIYRQFSGELEQGKFYLISGKVTERNDELQLVTDRISP
FT                   ALETDRKLWLNLRDDKYNQKISQILREFPGSHQVILHYSNLKKTIQTKIYVEESEILQK
FT                   RLEGYVIAGIYK"
FT   gene            complement(497815..498468)
FT                   /gene="hly"
FT                   /locus_tag="L97827"
FT   CDS             complement(497815..498468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hly"
FT                   /locus_tag="L97827"
FT                   /product="hemolysin like protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO04.02 Cell killing"
FT                   /db_xref="EnsemblGenomes-Gn:L97827"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04595"
FT                   /db_xref="GOA:Q9CI69"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI69"
FT                   /protein_id="AAK04595.1"
FT                   /translation="MEETQGSKTYQILNEIFNAVTHGAGTGLAIAALVLLVIKGAASGS
FT                   ALEVVAFTIYGASLVILFLCSTLAHGLHFTKAVKVFRVFDHNGIFFLIAGTYTPYCLVA
FT                   LNNWLGWIVLAVIWICSILGIVLTSIYLPKWGKTPKLSTVLYVVLGWMILIVIYPLWNA
FT                   LDPVGFWLLVAGGVVYSVGALIYHFKFPFAHVVWHLFVLLAAMLMFFSVYLYVG"
FT   gene            498649..499506
FT                   /gene="yejH"
FT                   /locus_tag="L98583"
FT   CDS             498649..499506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yejH"
FT                   /locus_tag="L98583"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved. there are four paralogs in L.lactis. 30%
FT                   identical to DegV of B.subtilis."
FT                   /db_xref="EnsemblGenomes-Gn:L98583"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04596"
FT                   /db_xref="GOA:Q9CI68"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI68"
FT                   /protein_id="AAK04596.1"
FT                   /translation="MGVQIVNMPIKIVTDSSITIEPGIARELDITIVPLSVTIDGTMYS
FT                   DDDLKFEDFMVKMAASKNLPKTSQPPVGVFAEVYEKIAAEDDEIISIHLTEALSGTVEA
FT                   ARQGGMLSGRNVTVIDSDFTDQAQKFQVVEAARLAKAGASKEEILEKIKYIRENTELFI
FT                   GFSTLENLVKGGRVSRMTGLFGSLLQVRVIGTLKDRELNTLLRGRGSKTFYKWLEELSD
FT                   SISSSGRKIREIGISHAQGLEFSQKAKEVLQKFVEKPISILDTNTTIATHTGPGAWAIM
FT                   IDYE"
FT   gene            499493..500359
FT                   /gene="yejI"
FT                   /locus_tag="L99502"
FT   CDS             499493..500359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yejI"
FT                   /locus_tag="L99502"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L99502"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04597"
FT                   /db_xref="GOA:Q9CI67"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI67"
FT                   /protein_id="AAK04597.1"
FT                   /translation="MIMNDKSKNMMKNFIRTFAGLLLAILLILGFFLLVFPKAGDRFLA
FT                   DKKVSTLSAKNLTYAALGDSLTEGVGDATGQGGFVPLFAKDIENKTDSSVSSQNFGKAG
FT                   DTSTQIYNRMMKSKKITDGLKKADIITITIGGNDVLKVIRDNVSKLSSMTEKDFTKPEE
FT                   LYQARVKKLLDKIREDNPKAQIYVLGIYNPFYLNFPELTVMQNVIDSWNTATAGVVSQE
FT                   KNTYFIPINDLLYKGSGDKQAVESGSTSDAVSNNLLYTEDHFHPNNVGYQLMADAVFAS
FT                   YKEVNQK"
FT   gene            500356..501567
FT                   /gene="yejJ"
FT                   /locus_tag="L100350"
FT   CDS             500356..501567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yejJ"
FT                   /locus_tag="L100350"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved. similar to many different glycosyl hyrolases"
FT                   /db_xref="EnsemblGenomes-Gn:L100350"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04598"
FT                   /db_xref="GOA:Q9CI66"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI66"
FT                   /protein_id="AAK04598.1"
FT                   /translation="MTKRLKKKAKPVVFLALVLGCALILSGVLGLAGHLNEQESSKTKK
FT                   KSQLSETKRSSTSPKNMDKNIEQMTLEQKVGQLFMTGMPANNYNQATFDAIEKYQVGSI
FT                   ILTGRSNLSVPEMKDITDKLQGLEPANRKLLISCDQEGGNVQVLQGQGFSQIPDGLTQG
FT                   SWTADKLQKESQTWGSELYAAGVNFDLAPVADQVLSADFAPQNAPIGYWSRQYAYDKAS
FT                   IISHAQAFTEGMKAAKVLTTAKHFPGLGAVTGNTDISAGVRDDQTNSNSESVQIFKDLI
FT                   SSGTPSIMTATAIYDKIDPNLPGAFSSKMVDGLLRKQLGFDGLVITDDLSNAVQVQSWT
FT                   PGQRAVLALSAGNDLVLANEPTQIPEMISEVLQKVKADPDFAKKISQSATRVIKVKEEM
FT                   KLVE"
FT   gene            501577..502233
FT                   /gene="yfaA"
FT                   /locus_tag="L101577"
FT   CDS             501577..502233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfaA"
FT                   /locus_tag="L101577"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L101577"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04599"
FT                   /db_xref="InterPro:IPR018672"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI65"
FT                   /protein_id="AAK04599.1"
FT                   /translation="MENNENQTRKSKTKNSTKPKTEKEEGLKKRPIWKWLFIILLALNI
FT                   AGVVFIAIRVTSPRDQTVLNQKSTNSSDQKVAQITSTTSQLNELINSYLETYQTKEMTY
FT                   KFYISNQQAVLEASYKLFGTKIPLYIYFEPLALSDGSISLSVQNISAGSLSLPTSEVLQ
FT                   IVKAYDLPDFVQVESKKNQVVINLSKINVSGNLYIKANQIDLAKGNFVFDFMKKA"
FT   gene            502338..502613
FT                   /gene="hslA"
FT                   /locus_tag="L102317"
FT   CDS             502338..502613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslA"
FT                   /locus_tag="L102317"
FT                   /product="HU like DNA-binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO10.02 DNA replication,
FT                   restriction, modification, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:L102317"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04600"
FT                   /db_xref="GOA:Q9CI64"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI64"
FT                   /protein_id="AAK04600.1"
FT                   /translation="MANKQDLIAEVAAKTGLTKKDSEKAVNAFGEVVTEFLAKGEKVQL
FT                   IGFGTFETRERAAREGRNPQTGEAIKIAATVVPAFKAGKALKDAVK"
FT   gene            complement(502723..503871)
FT                   /gene="ps201"
FT                   /locus_tag="L102735"
FT   CDS             complement(502723..503871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps201"
FT                   /locus_tag="L102735"
FT                   /product="prophage ps2 protein 01, integrase"
FT                   /db_xref="EnsemblGenomes-Gn:L102735"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04601"
FT                   /db_xref="GOA:Q9CI63"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI63"
FT                   /protein_id="AAK04601.1"
FT                   /translation="MWIENLPNGKYKYFERYRDPLTEKLKKVSVTLDKKTPRAQKVAQA
FT                   ELLEKIESKINNSSTSNAKFTDIAEEWWSFYKKSIKQSSISALQSSFNFIIDYFDKEIK
FT                   ISNVTSKVIQKFINDADCPRSKLERSKSTLNLIFDYAVDLEYIEYNPARKAKLPKKIQT
FT                   VKDLEKIQNKYLEQNELKALLSELYSRPNTRRLALLAEFMSLNGCRMGEAIALKKENYK
FT                   RSERKIDIHGTLDKTVGYSKGVKTTPKTASSFRTVDLSDREIEILDEIIEQNNLSKSVI
FT                   NDYNEMGYIFVSKRGIPLQTNSFNLAIKRANSRLKSPINKNLSSHIFRHTLISYLAENN
FT                   VPLKAIVDRVGHKDGGKTTTAIYTHVTENMKSSIIDILNKKN"
FT   gene            complement(503995..504486)
FT                   /gene="ps202"
FT                   /locus_tag="L104007"
FT   CDS             complement(503995..504486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps202"
FT                   /locus_tag="L104007"
FT                   /product="prophage ps2 protein 02"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L104007"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04602"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI62"
FT                   /protein_id="AAK04602.1"
FT                   /translation="MKKILITIMGLLLILSLFSFSDIASAKTKKSVKKKSFTVHNVYKI
FT                   YYSKVDSKTTGVITETGPDVARFIRVGYSAKVDTLKNAEKAKKNAKLFLNNVVKNIKPP
FT                   KNEDDVIIIQYGEGEGFDRSKNFQTFFNILLNKNSYNILKENKGDFTKLDKQDYSNNGY
FT                   "
FT   gene            complement(504540..504836)
FT                   /gene="ps203"
FT                   /locus_tag="L104552"
FT   CDS             complement(504540..504836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps203"
FT                   /locus_tag="L104552"
FT                   /product="prophage ps2 protein 03"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L104552"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04603"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI61"
FT                   /protein_id="AAK04603.1"
FT                   /translation="MEMFTKTQKAQSDNIYEKEVKSHIAPKDGFTHVLMINSLSKWINQ
FT                   LFGVEDKYTTQIDNILTKMQKEGYEIISVEHTAIKNQGLFKDMEGFHTLISYK"
FT   gene            complement(504883..505470)
FT                   /gene="ps204"
FT                   /locus_tag="L104895"
FT   CDS             complement(504883..505470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps204"
FT                   /locus_tag="L104895"
FT                   /product="prophage ps2 protein 04"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. 27% identical to
FT                   gp17v protein of E.coli bacteriophage KVP40"
FT                   /db_xref="EnsemblGenomes-Gn:L104895"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04604"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI60"
FT                   /protein_id="AAK04604.1"
FT                   /translation="MNEQELIGYLLLEMEKQNIHITCDDCFPKNAMVNIKRKLMIYNPT
FT                   KITAFKIAHELSHVINKDICRGSENDALNPQEFRANHEAILLLWEIFEANGGSYEYFNV
FT                   FVDITESPFELAESIIKNEYLELHEAITEIFEDEIKVSINKQEMHDYIVDYIGYFDVIE
FT                   AINVYQFLDRYHLSHNFFNMAEKEFQQLLGVG"
FT   gene            complement(505482..505850)
FT                   /gene="ps205"
FT                   /locus_tag="L105494"
FT   CDS             complement(505482..505850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps205"
FT                   /locus_tag="L105494"
FT                   /product="prophage ps2 protein 05, transcriptional
FT                   repressor"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. 27% identical to Rad
FT                   protein of Lactobacillus bacteriophage phi adh"
FT                   /db_xref="EnsemblGenomes-Gn:L105494"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04605"
FT                   /db_xref="GOA:Q9CI59"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR009498"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI59"
FT                   /protein_id="AAK04605.1"
FT                   /translation="MDLYEKIKELAAQKHTSIRKIEEHLGYGNGTIRRWNKNKPNYDKI
FT                   QAVAKYFNVSVDYLLGNEELKKTNKPVDLKKVISEKKPTSWDDPRIDWNEWVSFDGEPI
FT                   SDDVKKILFAIYGDKLTD"
FT   gene            506144..506335
FT                   /gene="ps206"
FT                   /locus_tag="L106117"
FT   CDS             506144..506335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps206"
FT                   /locus_tag="L106117"
FT                   /product="prophage ps2 protein 06"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. 40% identical to
FT                   Orf65a of Lactobacillus bacteriophage phi adh"
FT                   /db_xref="EnsemblGenomes-Gn:L106117"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04606"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI58"
FT                   /protein_id="AAK04606.1"
FT                   /translation="MPTSDNGLRLVNSFIEETGIEKMSLAAKYGVAKNVMIDILSGHLQ
FT                   SPKAHQVILKIIDDFKLR"
FT   gene            506351..506611
FT                   /gene="ps207"
FT                   /locus_tag="L106345"
FT   CDS             506351..506611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps207"
FT                   /locus_tag="L106345"
FT                   /product="prophage ps2 protein 07, excisionase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. 50% identical to
FT                   excisionase of Streptococcus pneumoniae transposon Tn5252"
FT                   /db_xref="EnsemblGenomes-Gn:L106345"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04607"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI57"
FT                   /protein_id="AAK04607.1"
FT                   /translation="MPYAKITYLPVENAEDAEWCDKKHLMQKWEGLTKGTLTAWLTEMR
FT                   DRPEFKKGVLNPTHGLVFINKEVFKDFVEWKEATRYKSYKK"
FT   gene            506770..506964
FT                   /gene="ps208"
FT                   /locus_tag="L106731"
FT   CDS             506770..506964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps208"
FT                   /locus_tag="L106731"
FT                   /product="prophage ps2 protein 08"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L106731"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04608"
FT                   /db_xref="InterPro:IPR012450"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI56"
FT                   /protein_id="AAK04608.1"
FT                   /translation="MNNTTNKETYILDDSIAFELMDLLKAKARHFIKLNEYVYRLFDGQ
FT                   SVVTFTTLENDIQVEMIKG"
FT   gene            506969..507394
FT                   /gene="ps209"
FT                   /locus_tag="L106963"
FT   CDS             506969..507394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps209"
FT                   /locus_tag="L106963"
FT                   /product="prophage ps2 protein 09"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L106963"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04609"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI55"
FT                   /protein_id="AAK04609.1"
FT                   /translation="MATIDEQLNVRTEIEQAVAKQCDYTEFNPVFEDLFFSLNWLEEQD
FT                   GLKLEKYDIYKALMTAYSVGFNRGKKAHKPTKWLEKETEEFEDYWQLYNTVKNQAIKDI
FT                   SGGSEVRQSREFNSLVTRRMYEAGMAEEKKNWTSWDK"
FT   gene            507429..507668
FT                   /gene="ps210"
FT                   /locus_tag="L107339"
FT   CDS             507429..507668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps210"
FT                   /locus_tag="L107339"
FT                   /product="prophage ps2 protein 10"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L107339"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04610"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI54"
FT                   /protein_id="AAK04610.1"
FT                   /translation="MQNIIRACPYVAGIDSVGLRSLKGYHTELTDKQIEKLDPLNANTG
FT                   TVDYSFKVRKYKQGVRFEGEKEGGEISLFDEVAK"
FT   gene            507665..507919
FT                   /gene="ps211"
FT                   /locus_tag="L107665"
FT   CDS             507665..507919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps211"
FT                   /locus_tag="L107665"
FT                   /product="prophage ps2 protein 11"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L107665"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04611"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI53"
FT                   /protein_id="AAK04611.1"
FT                   /translation="MIEHHQGYTAIKRYGRNSFRPAGKHPFKMIHNARAVKYDLIQQFE
FT                   ASTGILLSSGMKSNLCTQPVPFLGKQLAVMKVQIKENKP"
FT   gene            507916..508110
FT                   /gene="ps212"
FT                   /locus_tag="L107922"
FT   CDS             507916..508110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps212"
FT                   /locus_tag="L107922"
FT                   /product="prophage ps2 protein 12"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L107922"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04612"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI52"
FT                   /protein_id="AAK04612.1"
FT                   /translation="MKITIDVLENESNKDNLEYLISDTSNEAITVLMFALIGEARQRAS
FT                   YEQFLETITRIWGYMNEDN"
FT   gene            508097..508423
FT                   /gene="ps213"
FT                   /locus_tag="L108106"
FT   CDS             508097..508423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps213"
FT                   /locus_tag="L108106"
FT                   /product="prophage ps2 protein 13"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L108106"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04613"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI51"
FT                   /protein_id="AAK04613.1"
FT                   /translation="MKITDLQKIDQNIIKILADHKGIDKAINGKMLAQSLNVDFRTLQG
FT                   RISFLQGKGCAIGSIDNIGYFAPTNEEERTKGITKKENMAYSTLKAVMGVRSASLDWLD
FT                   EMID"
FT   gene            508431..509009
FT                   /gene="ps214"
FT                   /locus_tag="L108425"
FT   CDS             508431..509009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps214"
FT                   /locus_tag="L108425"
FT                   /product="prophage ps2 protein 14"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L108425"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04614"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI50"
FT                   /protein_id="AAK04614.1"
FT                   /translation="MELLTIRLNKIVAKKLMKGGGETLILEKEDFYQYVYLVPNNMSFS
FT                   GHFDSVLDISVSQHWEIFNFLTSKYQEQGYKKVHYKHPAHPSNKFMKFLNKLQRDQSEK
FT                   VATVYRQNAFEKFKDEIVMHQGFLNSKNMMKFIILGKKHGYNYKYLMMWAVSEIEATCD
FT                   GTQKQGLLADFISLADEYFDEKEREVLSD"
FT   gene            509002..510444
FT                   /gene="ps215"
FT                   /locus_tag="L109011"
FT   CDS             509002..510444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps215"
FT                   /locus_tag="L109011"
FT                   /product="prophage ps2 protein 15"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. 32% identical to
FT                   Orf11 of S.aureus transposon Tn557"
FT                   /db_xref="EnsemblGenomes-Gn:L109011"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04615"
FT                   /db_xref="InterPro:IPR007936"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI49"
FT                   /protein_id="AAK04615.1"
FT                   /translation="MTNVDDDFQNMINSYEEEKAKAESKKSEQKPPQSDKIVKVKFEAE
FT                   NFALNQYGKPKVNSLKNIRIAIENDNILKNQFVFNSFTQEIEIRTPFKLRGVEIENDGL
FT                   KEVYITAILEHFEEKYDVLFDSRLLVNVINKIAYENKYNPVQDFMEDCYKNWDKVKRAR
FT                   SLFPDYLGAKESDLTERMTKLFFVGAVSKVYRPHDKFDFVLDLVGGQGSGKTTFLTKMG
FT                   QGWYTDSMKNFDDKDQLVMMLRALIVNDDEMAISNKIPFADLKKFITQTVLSFRAPYGT
FT                   KVENYAKNFVIARTTNHEEYQKDRTGARRFLPVHCSKELQKYHPVSDLDDATVRQVWGE
FT                   MVHYYKEGFSFKLSEEEEKQLNLERSDYEYFDEQEELLEQYLEIPIPTDFYKVQGNNTR
FT                   MHERRAYIGFILQSGETPKHEFRGEIKPREFVTATYFYWEAMGIETGKGSAKIVSKFKN
FT                   SMNNKNGWQKSKRKGTRGYKRE"
FT   gene            510596..511180
FT                   /gene="ps216"
FT                   /locus_tag="L110560"
FT   CDS             510596..511180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps216"
FT                   /locus_tag="L110560"
FT                   /product="prophage ps2 protein 16"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L110560"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04616"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI48"
FT                   /protein_id="AAK04616.1"
FT                   /translation="MNNSYPKSWSRIMTQTIAELNKKKNLTRLDLKRGALALVKGLNVR
FT                   NKKINAESEANYIKAVWDNFQLYEMALSVIGMLTPKEVIETFPIYKRYDGHKYETKDYF
FT                   SVQKSLAAYDLNQPINTVDDKAFEFLWDYDNDDLVEFAVDFMGAMSHINRLEKGKDLFS
FT                   QFLEETQGIKSRVIEINGIEVITFDNDDELD"
FT   gene            511357..511542
FT                   /gene="yfbB"
FT                   /locus_tag="L111351"
FT   CDS             511357..511542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfbB"
FT                   /locus_tag="L111351"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L111351"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04617"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI47"
FT                   /protein_id="AAK04617.1"
FT                   /translation="MAKDKIKNLEIPVAENERNKAVENLLSLKEYFDNQLQSDQETHQA
FT                   IATLGDKLGVLWNADK"
FT   gene            511569..512177
FT                   /gene="ps218"
FT                   /locus_tag="L111521"
FT   CDS             511569..512177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps218"
FT                   /locus_tag="L111521"
FT                   /product="prophage ps2 protein 18"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L111521"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04618"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI46"
FT                   /protein_id="AAK04618.1"
FT                   /translation="MQVKYIEEAKNKLEKQAKPLTQKFDKTNQLISELKNKIEKMENQS
FT                   QNDDIDESLKALSELNNAKQLLETLEKRLTEEQKELDVFWSSQEVDDTIGEALSRADSL
FT                   SNIQQDLLKITLSKDTKKKLKEYNKEVDDQRYRLQESGNYLLEKSNVYSRSPLNNLIGQ
FT                   KNGSHKNNWFFGIVRVMADQYEKELMAFLKSEKIMTDLD"
FT   gene            512186..512776
FT                   /gene="ps219"
FT                   /locus_tag="L112195"
FT   CDS             512186..512776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps219"
FT                   /locus_tag="L112195"
FT                   /product="prophage ps2 protein 19"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages. 36% identical to
FT                   Orf26 of B.subtilis bacteriophage phi-105"
FT                   /db_xref="EnsemblGenomes-Gn:L112195"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04619"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI45"
FT                   /protein_id="AAK04619.1"
FT                   /translation="MTKKTEINFGIDSKLEIRDANKKAGFIGQIAGYAIVFNKPSVPNA
FT                   PFIEYIAPTALDNVDLSDVLALYNHDYANVLGRVDAGTLKLSIDNIGLHFVLDMPDTTV
FT                   GHDVYNNIKAGNLKGMSFGFVVADGGDSWQQGVSKPIRTINQLQTLGEISVVSKPAYDD
FT                   TSINVTRSIKQFEDERTRKYKEKVRAYLDGLSD"
FT   gene            512992..513321
FT                   /gene="ps220"
FT                   /locus_tag="L113001"
FT   CDS             512992..513321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps220"
FT                   /locus_tag="L113001"
FT                   /product="prophage ps2 protein 20"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L113001"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04620"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI44"
FT                   /protein_id="AAK04620.1"
FT                   /translation="MVRYYWGRPQDVVRWYLRGTLYLSAQSRKSYIEKTGAERGNLPRL
FT                   LKLLDNLDELFDSVDTDSIAVLCLRYVELLSVAETTKRTGLLAYQITAKTGKIMKKAKE
FT                   IISKA"
FT   gene            513422..513742
FT                   /gene="ps221"
FT                   /locus_tag="L113377"
FT   CDS             513422..513742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ps221"
FT                   /locus_tag="L113377"
FT                   /product="prophage ps2 protein 21"
FT                   /note="EVIDENCE BY GENEMARK BIO14.03 OTHER CATEGORIES.
FT                   Phage related functions and prophages"
FT                   /db_xref="EnsemblGenomes-Gn:L113377"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04621"
FT                   /db_xref="GOA:Q9CI43"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI43"
FT                   /protein_id="AAK04621.1"
FT                   /translation="MNELEFNIRLYLIGTMKSWTDRIDSTDQLTPQRFIFNAMTELFDS
FT                   LSDDDLELIRLRYMERLTLSEVASRHLLNERTIRNHTNPTIKQVKKIIKQGNELSIKQK
FT                   SP"
FT   gene            complement(514066..514338)
FT                   /gene="yfbG"
FT                   /locus_tag="L114078"
FT   CDS             complement(514066..514338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfbG"
FT                   /locus_tag="L114078"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L114078"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04622"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI42"
FT                   /protein_id="AAK04622.1"
FT                   /translation="MFIFYVFVAALIWAGVSYWLHKNKPLKNAGEVQQVYLIITSISVI
FT                   IIALIILVFLIYMMVSSKSLDNLSWAIICILVIAVAALFFKENKI"
FT   gene            514455..514676
FT                   /gene="yfbH"
FT                   /locus_tag="L114419"
FT   CDS             514455..514676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfbH"
FT                   /locus_tag="L114419"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L114419"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04623"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI41"
FT                   /protein_id="AAK04623.1"
FT                   /translation="MIYFLIKLKNGGSNMKFEGTWLVVIILSIEVLAFGEFEQSNQILL
FT                   IGGISIILSTLFEASTLIRHFIKEQTKV"
FT   gene            514845..515333
FT                   /gene="yfbI"
FT                   /locus_tag="L114740"
FT   CDS             514845..515333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfbI"
FT                   /locus_tag="L114740"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 30%
FT                   identical to a protein from Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L114740"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04624"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI40"
FT                   /protein_id="AAK04624.1"
FT                   /translation="MSKKYYFENVDELVQHLIFKYKELSPLKLQKSLYFLFAFYAGNYQ
FT                   ISEEQGVAESDYDYPKYLFKADFEAWTYGPVIRHVYDKNKKDEYMAKEFNFEGNENSEI
FT                   SKFIDDVSEMIMAKSDFALVDRSHDDKAWKDAIAIGNSSPMSEEVIANEYKELFKNMG"
FT   gene            515299..515865
FT                   /gene="yfbJ"
FT                   /locus_tag="L115302"
FT   CDS             515299..515865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfbJ"
FT                   /locus_tag="L115302"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L115302"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04625"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI39"
FT                   /protein_id="AAK04625.1"
FT                   /translation="MSTKNYSKIWDKSSSEKKYDDKLASNTLLDSNKILETDNKAEIKF
FT                   YSDDSKKSFLEKEDQFTNFLNKNQVEDFKFRMLEFLTKPNSLYNSTSHWHKVDKNKRLK
FT                   HLFSLKLSAEDITKHLDDVHKVHIVDNFGTMTAYRIYLYKNIEKNEYLIFLIDPLHLAI
FT                   PSEETLNDKVYINNRSNTICISDII"
FT   gene            516184..516366
FT                   /gene="yfbK"
FT                   /locus_tag="L116178"
FT   CDS             516184..516366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfbK"
FT                   /locus_tag="L116178"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L116178"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04626"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI38"
FT                   /protein_id="AAK04626.1"
FT                   /translation="MLTTREQYRIMKLLTKHYKSSKITLKILLGRVTVGSSCLPQVILR
FT                   SGFFYIKKALALSQC"
FT   gene            517114..517314
FT                   /gene="cspD"
FT                   /locus_tag="L117090"
FT   CDS             517114..517314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspD"
FT                   /locus_tag="L117090"
FT                   /product="cold shock protein D"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.01 Adaptations and
FT                   atypical conditions. BELONGS TO THE COLD-SHOCK DOMAIN (CSD)
FT                   FAMILY"
FT                   /db_xref="EnsemblGenomes-Gn:L117090"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04627"
FT                   /db_xref="GOA:Q9CI37"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI37"
FT                   /protein_id="AAK04627.1"
FT                   /translation="MANGTVKWFNADKGFGFITSEEGKDLFAHFSAIQSDGFKSLDEGQ
FT                   KVEFDVEEGQRGLQAVNITKA"
FT   gene            complement(517855..518352)
FT                   /gene="yfbM"
FT                   /locus_tag="L117867"
FT   CDS             complement(517855..518352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfbM"
FT                   /locus_tag="L117867"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS
FT                   General"
FT                   /db_xref="EnsemblGenomes-Gn:L117867"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04628"
FT                   /db_xref="GOA:Q9CI36"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI36"
FT                   /protein_id="AAK04628.1"
FT                   /translation="MKVILRKALPDDYEQIAFVHYKAWLETYTGLLPESFLKNRTLESS
FT                   INIFKNNLCSNTVVAIVEGKIIGFCGWGPLRNNSFEENFGEIHGIYLLDSYKKHKIGRK
FT                   MLEFALEKLSTKNYPKVGLWVLSSNENAIHFYKKLGFSDTGIVKEENLGEIITESFFTK
FT                   EI"
FT   gene            518499..519008
FT                   /gene="ogt"
FT                   /locus_tag="L118481"
FT   CDS             518499..519008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /locus_tag="L118481"
FT                   /product="6-O-methylguanine-DNA methyltransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO10.02 DNA replication,
FT                   restriction, modification, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:L118481"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04629"
FT                   /db_xref="GOA:Q9CI35"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI35"
FT                   /protein_id="AAK04629.1"
FT                   /translation="MLTKKNYQSPLGEITLLSDETYLLGVWFKEQKYFAANYDLNQAKE
FT                   DKSLPIINAIDWLDAYFKGENPDLKKIKLKPEVTEFRKKVLKILSDVPYGSLITYKEIS
FT                   NLLQVNEEKKRNMSQAVGGAVGHNPLSIIIPCHRVVGTDGSMTGYAGGLEKKKALLTLE
FT                   QAHLKK"
FT   gene            519022..519582
FT                   /gene="adaA"
FT                   /locus_tag="L0149"
FT   CDS             519022..519582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adaA"
FT                   /locus_tag="L0149"
FT                   /product="methylphosphotriester-DNA alkyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:L0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04630"
FT                   /db_xref="GOA:Q9CI34"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR016220"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI34"
FT                   /protein_id="AAK04630.1"
FT                   /translation="MEITDETWEIIKNNDKNFDNKLWYGVATTKIFCRPSCVSRLPKRE
FT                   NVSIFQAAEQALEEGYRPCKRCRPMDKIIPNEVWVEEIDLLLKNHYDEDLSLEELGQRL
FT                   HGSSSYLRHIYKKIKGLTPQQELTRIRLEQARIRLLKGNEAISEIARDVGMMNTPYFIK
FT                   SFKKRYGLAPNQYRKAYNINSKK"
FT   gene            519676..520485
FT                   /gene="yfcA"
FT                   /locus_tag="L119676"
FT   CDS             519676..520485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfcA"
FT                   /locus_tag="L119676"
FT                   /product="ABC transporter ATP binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS General. There are 60 paralogs in L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L119676"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04631"
FT                   /db_xref="GOA:Q9CI33"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI33"
FT                   /protein_id="AAK04631.1"
FT                   /translation="MKIKNIKKSYGNNQVLNDISFELKAGDKVALLGNNGAGKSTLMNI
FT                   INGNVKASSGKIEYGKMKPTSNNTGYIMQNMTLPPDALVSEVLALFSNDEQSKEYGLKL
FT                   VKEFKMESYLRQRFSNLSGGQKQKLFLVSALQNSPEYFFLDEITTGLDSESRGELFKFL
FT                   SSNLKVKNSTLLLVTHYLEEALQLCDRFIILKDGKIIADLQKSDLIQEEFSFVEFLVEV
FT                   PEFEAYKLKEKQYKLPKELAEQAIIKFNKELVLYQKTYRINLEELLS"
FT   gene            520482..521207
FT                   /gene="yfcB"
FT                   /locus_tag="L120437"
FT   CDS             520482..521207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfcB"
FT                   /locus_tag="L120437"
FT                   /product="ABC transporter permease protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS General"
FT                   /db_xref="EnsemblGenomes-Gn:L120437"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04632"
FT                   /db_xref="GOA:Q9CI32"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI32"
FT                   /protein_id="AAK04632.1"
FT                   /translation="MKFLKYFTFELRLRYRNPSQILFVFIFPLFLMFAFSSSFGKSIPH
FT                   YIENNIASILLYSVLSASLTSLSVQIADHQSGKIYQLFVQRGIKKLFYIIAQIVSFMII
FT                   IFCSTLVILVVAHYAYDYEFPKLSLLILFYLKLYLYSIPFCLLAMIIGLLAKNTATASA
FT                   IAMPLMFLSFFFSGMMIPLAQLSGGIRKIADNFFLTQLLSDLNHTLTSNYTVVPNWSRI
FT                   SLSVGLICLLALLVYRRKA"
FT   gene            521270..521728
FT                   /gene="yfcC"
FT                   /locus_tag="L121252"
FT   CDS             521270..521728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfcC"
FT                   /locus_tag="L121252"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.General"
FT                   /db_xref="EnsemblGenomes-Gn:L121252"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04633"
FT                   /db_xref="GOA:Q9CI31"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI31"
FT                   /protein_id="AAK04633.1"
FT                   /translation="MKLKKQIDPNIEEAEIVIVARRQEEFSAIVKEYHLEDLSSIDNEK
FT                   LYLATNKGFEIVNIREILYLKSEKNYLDFHMTDGVIRVRSPLYFYEKKLALNFIKISRN
FT                   TLVNFEQIRRLETDFVYGVLLYLGNEKLPVSRKYLANINKKLEEGAKK"
FT   gene            521725..522102
FT                   /gene="yfcD"
FT                   /locus_tag="L121731"
FT   CDS             521725..522102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfcD"
FT                   /locus_tag="L121731"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L121731"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04634"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI30"
FT                   /protein_id="AAK04634.1"
FT                   /translation="MKYVISGLKGAFIAIVCGVLLTLYFGGKIDFESMTLILVYGFVQG
FT                   AMSKVIDEYVTIALLEFVSQALASYLLAWGYLLVNTWLFDSSWQHHIWSFTITWLLIFI
FT                   LVYLYSIVRNRKIVKRFNRQK"
FT   gene            522216..523361
FT                   /gene="nifZ"
FT                   /locus_tag="L122222"
FT   CDS             522216..523361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifZ"
FT                   /locus_tag="L122222"
FT                   /product="pyridoxal-phosphate dependent aminotransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.05 ENERGY METABOLISM.
FT                   Electron transport. orthologous to NifZ of B.subtilis.
FT                   Cysteine sulfinate desulfinase/cysteine desulfurase,
FT                   evidenced by COGnitor. There are three paralogs in
FT                   L.lactis, also nifS and yseI."
FT                   /db_xref="EnsemblGenomes-Gn:L122222"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04635"
FT                   /db_xref="GOA:Q9CI29"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI29"
FT                   /protein_id="AAK04635.1"
FT                   /translation="MIYFDNSATTAVNPMVLRTYTDVATKIMGNPSSLHGLGTTATRLL
FT                   EASRRQIAELLGVDSQEIFFTSGGTEGDNWILKGVAFEKRPYGNHIIVSNVEHPAVKNT
FT                   AEWLKTQGFEVDFAPVDGDGFVIVSELEKLIRDETILISIMAVNNEVGTIQPIGEISDL
FT                   LADKPTISFHVDAVQAIGKIPLEAWLTERVDFAVLSAHKFHGPRGVGIVVAKKGKRLTP
FT                   LLHGGGQEHNWRSTTENLAGIAATSKALRLALDDDDFKRQKVRAMKQVILEELEKHRKV
FT                   HVFSKVENFAPNILTFGIRGVRGEVVVHAFEQHEIYISTTSACSSKKNAAAGTLVAMNV
FT                   PSKLATSAVRISLDSTNNMAEVEQFLTVFRQIYQELEKVSG"
FT   gene            523468..524346
FT                   /gene="yfcF"
FT                   /locus_tag="L123471"
FT   CDS             523468..524346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfcF"
FT                   /locus_tag="L123471"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.General"
FT                   /db_xref="EnsemblGenomes-Gn:L123471"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04636"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI28"
FT                   /protein_id="AAK04636.1"
FT                   /translation="MEKRTRDYKKNGSKKMSKQGKVLILALLAFLIFFVGFKIYHSKDV
FT                   QASTIKLVNKSNETYAYSGSKKLTGLQKINGNNYYFDSTTGVMKTGLMTLDGGTVYFSP
FT                   QTGKMVYGLQKINGYYYYFTKKTGKDDVVKAYEAVASQLKSDNSVIEKTISSGMKLVGK
FT                   SPYVYGGGRTDDSVAANEFDCSSFIAQMFRLGGQSLVYQFAASTSLLAQTGEAEDWSDK
FT                   ARGDLLITADDASEDEQHAAIYLGGGFILHDSTSTNGVSISRLNQVINKKVLGTMTWGQ
FT                   LFEPGHVRREV"
FT   gene            complement(524403..526052)
FT                   /gene="yfcG"
FT                   /locus_tag="L124415"
FT   CDS             complement(524403..526052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfcG"
FT                   /locus_tag="L124415"
FT                   /product="peptide-binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.02 TRANSPORT AND BINDING
FT                   proteinS Amino acids, peptides and amines. probably a
FT                   substrate binding protein of an oligopeptide or aminoacid
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:L124415"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04637"
FT                   /db_xref="GOA:Q9CI27"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI27"
FT                   /protein_id="AAK04637.1"
FT                   /translation="MNKSKIFAFSAFSLSAALLLTACGNSVSKSEDSAQEAKYSFASNI
FT                   LTLDTSMAADVNSIDVLLNVDAGLVRWNPKAQVVNNLAKSIDISKDGKTYNVTLRDGLK
FT                   WSNGAKLRAADFVYGWQRTVDPKTGSQYAYALTPVANASEIMTGKKPVDTLGIKAESDT
FT                   KLVITLATPTPYFNKLLTLPAYYPVNEAFVKKMGNKYGTSSDTSLYNGAFKFVKGKNNW
FT                   TGSNETFSIVKNDQFYDAKNVKLSGATYQIVNNPNTAVNLFKSGKLDVANLATPELVSA
FT                   NKKNKDYKALTSPRIDVLEYNQSGKVPELSNLKIRQALNLATNRKNLLEIAAPSFSITN
FT                   TVTPKKLDQAPNGEDFATYAAQPYKYDATKAAELFKEGLKELGKTSITLELEGANDNSF
FT                   AKAAVDYLKGNLEKDLPGLTINEKLVSSAQRQKDAQNNNFQILLTSWGADYNEPSDFLM
FT                   NFVSGSTMNHGLVKNPNFDKAYQAATTAPDVLSADKRYAHYKDAENALYEAANVNPLAT
FT                   ESVSLLLNPKLKGISTYNSAMIFDLRHAEIAK"
FT   gene            complement(526263..527195)
FT                   /gene="cysM"
FT                   /locus_tag="L0088"
FT   CDS             complement(526263..527195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysM"
FT                   /locus_tag="L0088"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="EVIDENCE BY HOMOLOGY BIO01.08 Serine family. there
FT                   is another potential cysteine synthase cysK in the genome"
FT                   /db_xref="EnsemblGenomes-Gn:L0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04638"
FT                   /db_xref="GOA:Q9CI26"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI26"
FT                   /protein_id="AAK04638.1"
FT                   /translation="MTKIYDNITELIGQTPIVKLQHVPAESADVYVKLEAFNPGGSVKD
FT                   RIALAMIRAAEADGHLKPGGTIVEPTSGNTGIGLAFVGSALGYKVVIVMPESFSLERRK
FT                   LIQAYGAQLVLTPASGGMKAAIAKAKELSETEGYFLAMQFENPANPEIHEKTTGAEIID
FT                   AFGPTGLDAFVAGAGTGGTITGVSHALKKANPTIKTYVVEADESAILSGEAAGPHKIQG
FT                   ISAGFIPGNLDTKSYDEIIRVKGDDAILTARHLGGKEGFLVGISSGAAIYAALEVAKKL
FT                   GKGKKVLAIAPDNGERYLSTALYDFESEK"
FT   gene            527413..528498
FT                   /gene="acmD"
FT                   /locus_tag="L127411"
FT   CDS             527413..528498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acmD"
FT                   /locus_tag="L127411"
FT                   /product="N-acetylmuramidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.02 CELL ENVELOPE Murein
FT                   sacculus and peptidoglycan. muramidase needed for cell
FT                   separation and responsible for autolysis"
FT                   /db_xref="EnsemblGenomes-Gn:L127411"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04639"
FT                   /db_xref="GOA:Q9CI25"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI25"
FT                   /protein_id="AAK04639.1"
FT                   /translation="MKQKHKLALGASIVALASLGGIKAQAASVQEIINAAVPVANDYGL
FT                   YPSVMIAQGILESSGGQSALASNYNNIFGVKYTSGTPVYLPTQEYLNGTMTNVVEPFQA
FT                   YSSVYDACVAQAKMLRASSYYSGAWRENTSSYLDATAWLEGRYATDPTYASKLNSVISE
FT                   LGLSVYDQGGEISGGTAVTTSSSASTNSAGTYKVQEGDSLSAIAAQYGTTVDALVSANS
FT                   LENANDIHVGEVLQVAGASTTTTSTNTTSNVSSSSTYTVKSGDSLYSIAEQYGMTVSSL
FT                   MSANGIYDVNSMLQVGQVLQVTVSTSATTSNTTTSNSYTIQNGDSIYSIATANGMTADQ
FT                   LAALNGFGINDMIHPGQTIRI"
FT   gene            complement(528537..529169)
FT                   /gene="yfcI"
FT                   /locus_tag="L128550"
FT   CDS             complement(528537..529169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfcI"
FT                   /locus_tag="L128550"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL"
FT                   /db_xref="EnsemblGenomes-Gn:L128550"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04640"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI24"
FT                   /protein_id="AAK04640.1"
FT                   /translation="MKIEKIVNKIAQENTYLLSNSTSHLIIDPGSDSSALLERLKITDK
FT                   TISAILLTHAHFDHIIGLNELRKHFPDVPIYLHSAEKEWMKNPKLNASFFFLGTAVTGP
FT                   EADYFYEINQFYDIDAFKFQVLETPGHSIGGVSLLFKLENESFVFSGDALFKNAIGRWD
FT                   LPTGNQAQLLKSIREQLFTLDENTQVFPGHGPKTSIGTEKQNNPFFQ"
FT   gene            complement(529170..531164)
FT                   /gene="ponA"
FT                   /locus_tag="L129183"
FT   CDS             complement(529170..531164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ponA"
FT                   /locus_tag="L129183"
FT                   /product="penicillin-binding protein 1A"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.02 CELL ENVELOPE Murein
FT                   sacculus and peptidoglycan"
FT                   /db_xref="EnsemblGenomes-Gn:L129183"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04641"
FT                   /db_xref="GOA:Q9CI23"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI23"
FT                   /protein_id="AAK04641.1"
FT                   /translation="MWTAVKLFLIAFFSLIILALAAGGAVFVYYAKDAPALTLDKLESK
FT                   PSTKVYDSSEKVVATLGAEQRNLVKTDNIPVMLVNAVTSIEDHRFFNTRGIDPIRIAGA
FT                   FVNNLKGGSLNGGSTLDMQLIKLSFFSTDESDQTLSVKIQEAWMALKLDQKWTKEQIFT
FT                   AYVNKVNMANGYYGMGTASQAYYGKDLTQLSIAQLALLAGMPQAPNTYNPYTNPTSAKW
FT                   RRDMVIRAMRRYDKITAEEEKKALATPIDDGLQPLKQSVTIPSYADNFLKQAIAQAKTL
FT                   AGDDILTEGAKIYTTLDTTAQQNLYNIVNTGNYITYPDDTMQVASTVTDVKTGAVIAQI
FT                   GGRNQPSNVTFGFNQAVQTDRDWGSTMKPIVDYGPAFENNIYTSTNNYVSDSPTTYPNG
FT                   TPLKNWDNTYFGSMTVKSALALSRNIPAVKTLINVGLDNSSKFVNGLGITLDPLEYSNA
FT                   ISSNSKNGGASSEKMAAAYAAFSNGGIYTKPYYVSKVVFPDGRTVEYKPDRSRAMQAST
FT                   AYIMTNILQSVLTLPLSESVGSYAAVPGLAAAGKTGTSNYTDSEMDQITEKYGSLPGMV
FT                   SPDENFVGYTPQYSMAVWTGYSNRMTPIYGTSTQIATKVFSSMMTQLTPDPSSVATWTM
FT                   PEGVSQEGTALVKTDSSGQTISQSSANGS"
FT   gene            complement(531232..531873)
FT                   /gene="yfdA"
FT                   /locus_tag="L131245"
FT   CDS             complement(531232..531873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdA"
FT                   /locus_tag="L131245"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.General"
FT                   /db_xref="EnsemblGenomes-Gn:L131245"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04642"
FT                   /db_xref="GOA:Q9CI22"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI22"
FT                   /protein_id="AAK04642.1"
FT                   /translation="MVNYPNGRSRAYSTVPKKKKSLTELSVTKKSTSKTKGMVAFGKRG
FT                   MNFEAEINATNEYYLSRGLAVIHKKPTPIQIVKVDYPQRSRAKITEAYFRQASTTDYSG
FT                   VYKGHYIDFEAKETQQKTVFPLKNFHEHQIVHMSNVLAQGGIAFVLLHFARLNETYLLP
FT                   SSCLITFYYEKGGLKSIPLSHIRENGYKIETNHIPRIPYLEIVNKLCEVQ"
FT   gene            531954..532478
FT                   /gene="yfdB"
FT                   /locus_tag="L131937"
FT   CDS             531954..532478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdB"
FT                   /locus_tag="L131937"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.General"
FT                   /db_xref="EnsemblGenomes-Gn:L131937"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04643"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI21"
FT                   /protein_id="AAK04643.1"
FT                   /translation="MNSLLIMGYTSFDLGIFNEKDIKVSIIKKTIRRKLINFLEEGLRW
FT                   IIFTGNLGFEYWALEVAKELQTDYDFQIGTIFSFETHGQNWNESNQVKLAAFKQVDFVK
FT                   YAFETYESPSQFRQYNDFILENTEGAFVFYDEENETKLKYMVEKMKQNTNYEVYLLDFE
FT                   DLQETFEEMNE"
FT   gene            532638..533024
FT                   /gene="yfdC"
FT                   /locus_tag="L132585"
FT   CDS             532638..533024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdC"
FT                   /locus_tag="L132585"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   there are seven paralogs in L.lactis"
FT                   /db_xref="EnsemblGenomes-Gn:L132585"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04644"
FT                   /db_xref="GOA:Q9CI20"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023731"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI20"
FT                   /protein_id="AAK04644.1"
FT                   /translation="MIDLYLSPSCTSCRKARAWLQSHKVPFVEHNILTQPMTTNDLRHI
FT                   LTKTENGTEDIISTRSKVFQKLAVDVDNLTINELLDLVTEFPNLLRRPIITDSKHLQIG
FT                   FNEDEIRAFLPREYRRAEMLSTID"
FT   gene            533116..533397
FT                   /gene="yfdD"
FT                   /locus_tag="L133111"
FT   CDS             533116..533397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdD"
FT                   /locus_tag="L133111"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   44% identical to YktA protein of Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:L133111"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04645"
FT                   /db_xref="InterPro:IPR007920"
FT                   /db_xref="InterPro:IPR023324"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI19"
FT                   /protein_id="AAK04645.1"
FT                   /translation="MKENYNYPLDLSWSTTEMTEVLSFFNQVEKFYESKVEKEVFLESY
FT                   NAFKKIVPSKMQEKQLGRDFELSSGYSLYHAVKEVKASGKRFVSADKA"
FT   gene            533375..534142
FT                   /gene="yfdE"
FT                   /locus_tag="L133367"
FT   CDS             533375..534142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdE"
FT                   /locus_tag="L133367"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved. similar to myo-inositol monophosphatases from
FT                   different species"
FT                   /db_xref="EnsemblGenomes-Gn:L133367"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04646"
FT                   /db_xref="GOA:Q9CI18"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI18"
FT                   /protein_id="AAK04646.1"
FT                   /translation="MSVLTRLELAKDWVRDAGNFLKENIAAPLEITEKTRYDDLVTNFD
FT                   KEVQEQIVANILHHFPEDKILAEEDEEKIKFDSEIPHLWVLDPIDGTTNFIVQKDNFAV
FT                   MLAYYEYGVGKFGLILDVMKDKLYWCDSHKAFCNQKELELKERPLAQSLLGVNSYMYRS
FT                   NSGGLLDLSHQTLGVRIIGSAGISYGQLLEGKIIGYFSSLQPWDYAAGSIIAERIGYVT
FT                   LTISGESPHFNCRERVFTAPSYLISEIQKYIKK"
FT   gene            534233..535516
FT                   /gene="murA2"
FT                   /locus_tag="L134243"
FT   CDS             534233..535516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA2"
FT                   /locus_tag="L134243"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.02 Murein sacculus and
FT                   peptidoglycan. CELL WALL FORMATION. ADDS ENOLPYRUVYL TO
FT                   UDP-N-ACETYLGLUCOSAMINE. FIRST COMMITTED STEP IN
FT                   PEPTIDOGLYCAN BIOSYNTHESIS. There is another homologous
FT                   gene murA1"
FT                   /db_xref="EnsemblGenomes-Gn:L134243"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04647"
FT                   /db_xref="GOA:Q9CI17"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI17"
FT                   /protein_id="AAK04647.1"
FT                   /translation="MMDKIIVKGGQTKLQGEVEIEGAKNAVLPLLAATLLASEGEVVLT
FT                   NVPILSDVFMMNNLVNHLGTAISFDQEAKKIIAKSNSEIKTTAPYEYVSKMRASIVVMG
FT                   PILARNGQARVSMPGGCSIGSRPIDLHLRGFEQMGATITQNAGYIEAKADKLKGAHIYL
FT                   DFPSVGATQNLILAATLADGTTTLENAAREPEIVDLANLLNKMGANVKGAGTDTIIIKG
FT                   VEKMHGANHSVVQDRIEAGTFMVAAAMTQGDVLIKDAIAEHNRPLISKLSEMGVNFIQE
FT                   ESGLRVVGPEKLKATSVKTLPHPGFPTDMQSQMTAAQAVAVGESVMVETVFENRFQHLK
FT                   EMRRIGLEVDITRNTALIQGNSNLQGAAVKSTDLRASAALILLGLVAKGQTTVRRLSHL
FT                   DRGYYKFHEKLKALGADIIRVEDEDGEG"
FT   gene            535516..535710
FT                   /gene="yfdG"
FT                   /locus_tag="L135490"
FT   CDS             535516..535710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdG"
FT                   /locus_tag="L135490"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L135490"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04648"
FT                   /db_xref="InterPro:IPR024596"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI16"
FT                   /protein_id="AAK04648.1"
FT                   /translation="MFKKTIKFLGLRLSIIIIFVIVLLVLAAVLGLMVGYGFLGGGNPS
FT                   NVFNHNLWKEVMDKLSPAK"
FT   gene            535867..537150
FT                   /gene="tig"
FT                   /locus_tag="L0336"
FT   CDS             535867..537150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="L0336"
FT                   /product="trigger factor"
FT                   /note="EVIDENCE BY HOMOLOGY BIO04.05 protein and peptide
FT                   secretion. INVOLVED IN protein EXPORT. ACTS AS A CHAPERONE
FT                   BY MAINTAINING THE NEWLY SYNTHESIZED protein IN AN OPEN
FT                   CONFORMATION. SIMILARITY: TO FKBP-TYPE PPIASES"
FT                   /db_xref="EnsemblGenomes-Gn:L0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04649"
FT                   /db_xref="GOA:Q9CI15"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI15"
FT                   /protein_id="AAK04649.1"
FT                   /translation="MTVSFEKTSDTKGTLSFSIDQETIKTGLDKAFNKVKANISVPGFR
FT                   KGKISRQMFNKMYGEEALFEEALNAVLPTAYDAAVKEAGIEPVAQPKIDVAKMEKGSDW
FT                   ELTAEVVVKPTVSLGDYKDLTVEVEATKEVSDEEVETRLTNSQNNLAELVVKETAAENG
FT                   DTVVIDFVGSVDGVEFEGGKGSNHSLELGSGQFIPGFEEQLVGTKAGETVEVKVTFPEN
FT                   YQAEDLAGKEALFVTTVNEVKAKELPELDDELAKDIDEEVETLDELKAKFRKELEESKA
FT                   EAYNDAVETAAIEAAVANAEIKEIPEEMIHEEVHRAMNEFLGGMQQQGISPEMYFQITG
FT                   TSEDDLHKQYEADADKRVRTNLVIEAIAAAENFTTSDEEVKAEIEDLAGQYNMPVEQVE
FT                   KLLPVDMLKHDIAMKKAVEVIATTAKVK"
FT   gene            544010..545923
FT                   /gene="dnaG"
FT                   /locus_tag="L0269"
FT   CDS             544010..545923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="L0269"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="EVIDENCE BY HOMOLOGY BIO10.02 DNA replication,
FT                   restriction, modification, recombination, and repair.
FT                   polymerase that synthesizes small RNA primers for Okazaki
FT                   fragments on both template strands at replication forks
FT                   during chromosomal DNA synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:L0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04650"
FT                   /db_xref="GOA:Q04505"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04505"
FT                   /protein_id="AAK04650.1"
FT                   /translation="MVSLDTEVVNDLKSKVNIADLISQYVALSRTGKNYIGLCPFHGEK
FT                   TPSFNVNAEKGFYHCFGCGRSGDAIEFLKEYNQVGFVDAVKELADFAGVTLNISDDREE
FT                   KNNPNAPLFEINNQAARLYNILLMSTELGERARKYLEERGITDDVIKRFNIGLAPEEND
FT                   FIFKNLSNKFDEEIMAKSGLFHFSNNNVFDAFTNRIMFPITNEYGHTIGFSGRKWQEND
FT                   DSKAKYINTSATTIFDKSYELWNLDKAKPTISKQHEVYLMEGFMDVIAAYKAGINNVVA
FT                   SMGTALTEKHIRRLKQMAKKFVLVYDGDSAGQNAIYKAIDLIGESAVQIVKVPEGLDPD
FT                   EYSKNYGLKGLSALMETGRIQPIEFLIDYLRPENLANLQTQLDFIEQISPMIAKLPSIT
FT                   AQDAYIRKLVEILPDFEYNQVEQAVNLRRENMTITDHPVSNLDASSLTESFTDENDYSS
FT                   LESVMPVDFEEAYYENNVKTQQTYRRSESAQVVQPSVQVPKLSRSEKAEEMLLHRMIYH
FT                   SSVLKKFSQDENFRFVHKRYQDLFDKILLEAMVYEQIDESHLASELSDEERSLFYQIIS
FT                   LDLPDTASSQEIKDLVSIFSNEMEQIKFEELIQQLATAEKAGNKERVLELTLQIINQKK
FT                   KL"
FT   gene            546000..547343
FT                   /gene="rpoD"
FT                   /locus_tag="L0139"
FT   CDS             546000..547343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="L0139"
FT                   /product="major RNA polymerase sigma factor"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:7503808 BIO11.02 RNA
FT                   synthesis, modification, and DNA transcription. putative
FT                   start codon is different to the previously reported,
FT                   suggesting processing of the preprotein"
FT                   /db_xref="EnsemblGenomes-Gn:L0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04651"
FT                   /db_xref="GOA:Q04506"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04506"
FT                   /protein_id="AAK04651.1"
FT                   /translation="MAANKKRISQISKETGVQNRVLVEKAQEIGLLVKSHSSSVGPGEE
FT                   RRLLEALNVKPVVVEKMDSPKTLARVEVKENGDTFNVKAYEKAVKSYITKRKPLGEALD
FT                   EEIMDELSVKFGIVDDALEDLFKQIQDAGISIVDKDGNPSPLALVTDEIEKEEVSDTAM
FT                   DEIVTNVRIDDPVRMYLKEIGRYPLISLDEETKLAEAIIAGGEGAEFAKQMLAEANLRL
FT                   VVSIAKRYSGRGMQFLDLIQEGNMGLMKAVDKFDHTKGFKFSTYATWWIRQAITRAIAD
FT                   QARTIRIPVHMVETINKLIRVQRNLLQELGRDPSPEEIGKELHMAPDKVREVLKIAQEP
FT                   VSLETPIGEEDDSHLGDFIEDDVIESPVDYTNRILLREQLDEVMDTLTDREENVLRMRF
FT                   GLDDGRMHTLEDVGKQFKVTRERIRQIEAKAIKKLRHPRRSKPLRDFM"
FT   gene            547458..548201
FT                   /gene="yfeA"
FT                   /locus_tag="L147423"
FT   CDS             547458..548201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeA"
FT                   /locus_tag="L147423"
FT                   /product="transcription regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General. There are eight paralogs in L.lactis. Belongs to
FT                   RpiR family of transcription regulators."
FT                   /db_xref="EnsemblGenomes-Gn:L147423"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04652"
FT                   /db_xref="GOA:Q9CI12"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI12"
FT                   /protein_id="AAK04652.1"
FT                   /translation="MNHLTSVEIYIWNYLEENKAKIIQMTVAQIAESAHVSPSSIIRTL
FT                   KKKNFSGFSEYKNMEKQKLNRHDWIYGLTKDANQVVSENIEELLMTVRLLESENLAKVV
FT                   ENIFHAASVVIISRGLSVRIADSFARDLQFLDVKAVSLYQDNMQAYLEKLPRNTFVIGL
FT                   SLSGETDLIVATAQKAKRDGKKVLAITGNYKSRLVEQSDLLLLAYQKNLSGKILVDYNN
FT                   MLPLELIIHLLIQLYKQYKEYGAIV"
FT   gene            548432..549733
FT                   /gene="glpT"
FT                   /locus_tag="L148346"
FT   CDS             548432..549733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="L148346"
FT                   /product="glycerol-3-phosphatase transporter"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.04 TRANSPORT AND BINDING
FT                   proteinS Carbohydrates, organic alcohols and acids.
FT                   (X71493) hexose phosphate transportLactococcus lactis"
FT                   /db_xref="EnsemblGenomes-Gn:L148346"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04653"
FT                   /db_xref="GOA:Q9CI11"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI11"
FT                   /protein_id="AAK04653.1"
FT                   /translation="MYKMWQTRVLISTAFVYIGYYIIRLIFTVQQNDISKAYGFSMGQI
FT                   GTILSMFGIGYGISKLIMGTLADRANPNRYVATGLIVSAIINALYGTTQSFGMIVFLML
FT                   LNSVMQGMGAAACQRLVGLWFGRKAKGSIMARGTAFSIWSSAHNAGAFMCVAVINLSAF
FT                   FFGASLQWSFWTASIVSIVIAIIVLFLGSDRPTTKGLPTIEEYSGDKVVIKDGEIVEGD
FT                   VSNDNVFKIFFEYIVKNKLVWAVILTSLSIYVVRYGIMSWIPNYLVNIKGFDNSTAKWL
FT                   TGIFELAAVPGVIIIGFITDLLKGRRAIMVLVSLIAMLACLITYFAATNHTLIIIVLLI
FT                   MGTFIYAPATIVGLMVNEAVPKFANGMSTGTMGFCQYIIGEVTATLVIGWLVQAYGWSA
FT                   GNIIVYIFAGIAILASIYILVHQNRLYKKIDDAG"
FT   gene            550016..550354
FT                   /gene="yffA"
FT                   /locus_tag="L150017"
FT   CDS             550016..550354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yffA"
FT                   /locus_tag="L150017"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L150017"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04654"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI10"
FT                   /protein_id="AAK04654.1"
FT                   /translation="MTTTVYFEKNGGIDIELRGARKVLSLRKHIKIDPENLESVQLVSD
FT                   MKKPKFYKKVAGTNAWYYGGWFRENGENEFWDVRNNERVLVITTKNFKYKKLYIEVGPD
FT                   FRLNPSKL"
FT   gene            550405..552651
FT                   /gene="clpE"
FT                   /locus_tag="L0221"
FT   CDS             550405..552651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpE"
FT                   /locus_tag="L0221"
FT                   /product="ATP-dependent protease ATP-binding subunit"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:10094684 BIO14.01
FT                   Adaptations and atypical conditions. BELONGS TO THE CLPC
FT                   SUBFAMILY"
FT                   /db_xref="EnsemblGenomes-Gn:L0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04655"
FT                   /db_xref="GOA:Q9CI09"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI09"
FT                   /protein_id="AAK04655.1"
FT                   /translation="MLCQNCNINEATIHLYTSVNGQKKQIDLCQNCYQIMKSGGQEALF
FT                   GAGNASNGNSDEPFNPFNDIFSALHGQDFNGAASTQTPPTQTGGRGPRGPQNPRAKQPK
FT                   GMLEEFGINITESARRGEIDPVIGRDEEIKRVIEILNRRTKNNPVLIGEPGVGKTAVVE
FT                   GLAQKIVDGDVPQKLQNKEVIRLDVVSLVQGTGIRGQFEERMQKLMDEIRKRNDVIMFI
FT                   DEIHEIVGAGSAGDGNMDAGNILKPALARGELQLVGATTLNEYRIIEKDAALERRMQPV
FT                   KVDEPSVDETITILRGIQARYEDYHHVKYTDEAIEAAAHLSNRYIQDRFLPDKAIDLLD
FT                   ESGSKKNLTLKFVDPEDINRRIADAETKKNEATQAEDFEKAAHFRDQITKLRELQNHEV
FT                   SDDEIPVITEKDIEQIVEQKTHIPVGDLKEKEQTQLINLADDLKAHVIGQDEAVDKIAK
FT                   AIRRSRVGLGKPNRPIGSFLFVGPTGVGKTELAKQLAKELFGSSESMIRFDMSEYMEKH
FT                   SVAKLIGAPPGYVGYEEAGQLTERVRRNPYSLILLDEIEKAHPDVMHMFLQILEDGRLT
FT                   DAQGRTVSFKDSLIIMTSNAGTGKVEASVGFGAAREGRTKSVLGQLGDFFSPEFMNRFD
FT                   GIIEFSALSKENLLKIVDLMLDEVNEQIGRNDIHLSVTQAAKEKLVDLGYNPAMGARPL
FT                   RRTIQENIEDSIADFYIEHPEYKELVADLIDDKIVISNQAQETAETTDEEVPAE"
FT   gene            complement(553073..553543)
FT                   /gene="yffB"
FT                   /locus_tag="L153086"
FT   CDS             complement(553073..553543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yffB"
FT                   /locus_tag="L153086"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L153086"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04656"
FT                   /db_xref="GOA:Q48660"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48660"
FT                   /protein_id="AAK04656.1"
FT                   /translation="MKLSSGWEQSVYVLLILARLPENRTMSSIALANRLKVSPSYLKKI
FT                   IKSLVDEGLLRSTPGKNGGFSLNKELHDISFYDVFLAIEGRGRIFQSQGLLQNFIGSES
FT                   GKAKRCAITSALDEIENTLVRTLSNVSLAQVADETQYNYNLGYLDEWIDEMD"
FT   gene            553716..554729
FT                   /gene="gapA"
FT                   /locus_tag="L0004"
FT   CDS             553716..554729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapA"
FT                   /locus_tag="L0004"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:7773380 BIO06.09
FT                   Glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:L0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04657"
FT                   /db_xref="GOA:P52987"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52987"
FT                   /protein_id="AAK04657.1"
FT                   /translation="MVVKVGINGFGRIGRLALRRIQEVEGVEVAHINDLTDPAMLAHLL
FT                   KYDTTQGRFKGTVEVKEDGFDVNGKFVKVTAERNPEDIQWADSGVEIVLEATGFFATKE
FT                   KAEKHLHPGGAKKVLITAPGGNDVKTVVFNTNHTILDGTETVISAGSCTTNSLAPMADA
FT                   LNKNFGVKGGTMTTVHSYTGDQMTLDGPHRGGDFRRARAAAENIVPASSGAAKAIGLVL
FT                   PELSGLMKGHAQRVSTPTGSITELVTVLEKHVTVDEINEAMKAAADESFGYNVDEIVSS
FT                   DIIGMAYGSLFDATLTEVTDLKDGGQLVKTAAWYDNEMSFTAQLIRTLEYFAKIAK"
FT   gene            complement(554872..555507)
FT                   /gene="def"
FT                   /locus_tag="L154885"
FT   CDS             complement(554872..555507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="L154885"
FT                   /product="polypeptide deformylase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.04 protein modification"
FT                   /db_xref="EnsemblGenomes-Gn:L154885"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04658"
FT                   /db_xref="GOA:Q48661"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48661"
FT                   /protein_id="AAK04658.1"
FT                   /translation="MNRDEIQANLIKASHMISMDDIIREGYPTLREVANDVTLPLSDED
FT                   IILGEKMLQFLHNSQDPVMAEKMGLRGGVGLAANQLGLLKKVIAVLIPNEPEVDEDGNE
FT                   IPPKEAYKMREIMYNAKVVSHSVQDAAVEGGEGCLSVDREVPGYVVRHARVTVEYYNKE
FT                   GEKKKIRLKDFPAICVQHEIDHTNGVMFYDHINMNDPWEIKDGMIIVK"
FT   gene            555661..556116
FT                   /gene="yffD"
FT                   /locus_tag="L155602"
FT   CDS             555661..556116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yffD"
FT                   /locus_tag="L155602"
FT                   /product="diadenosine 5',5'''-P1,P4-tetraphosphate
FT                   hydrolase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO10.02 DNA replication,
FT                   restriction, modification, recombination, and repair. 44%
FT                   identical to invasion protein of H.pylori"
FT                   /db_xref="EnsemblGenomes-Gn:L155602"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04659"
FT                   /db_xref="GOA:Q9CI07"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI07"
FT                   /protein_id="AAK04659.1"
FT                   /translation="MKEYRQNVAAIILNKENKIWLGKRADGMSWGFPQGGIEAGEKPET
FT                   AIIRELSEEIGTKEFEIIGQYPGTLKYDFPKEMKFPTWTYAGQEQHYFLVRLHEEAKIN
FT                   LESHPEEIEFSTYQFLGLSEIRKMDFGFKNDVYHQALDYFSKIIEKN"
FT   gene            556127..558205
FT                   /gene="uvrB"
FT                   /locus_tag="L0257"
FT   CDS             556127..558205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="L0257"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:L0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04660"
FT                   /db_xref="GOA:Q9CI06"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI06"
FT                   /protein_id="AAK04660.1"
FT                   /translation="MAIERITDNKFELVSKYEPAGDQGEAIAELVDNIENGEKAQILRG
FT                   ATGTGKTYTMSQVIARTGKPTLVMAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQP
FT                   EAYVPSSDTYIEKDSSVNDEIDKLRHSATSSLLERNDVIVVASVSCIYGLGSPKEYQDS
FT                   VVSLRPGQEISRDQLLNDLVGIQFERNDIDFQRGCFRVRGDVVEVFPASRDEHAFRVEF
FT                   FGDEIDRIREIEVLTGQVLGEVDHLAIFPATHFMTNDDRMEESIAKIEAELEEQLKVFR
FT                   SEGKLLEAQRLEQRTNYDIEMLREMGYCNGVENYSRHMDGREEGEPPYTLLDFFPDDFM
FT                   IMIDESHMTMGQVKGMYNGDRARKEMLCNYGFRLPSALDNRPLKREEFESHVHQIVYVS
FT                   ATPGDYEMEQTDTIVEQIIRPTGLLDPVVEVRPMMGQIDDLVGEIHKRAEKNERVFVTT
FT                   LTKKMSEDLTAYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV
FT                   PEVSLVAILDADKEGFLRNERGLIQTIGRAARNSEGHVILYSDMAKALDENDPVDKEIL
FT                   DSGYYTEYEGQKYKITRSMKHAMDETARRREIQMAYNEEHGITPQTIKKEIRDLIAITK
FT                   KTDSGEIEEVDASAMTKKERKALVKKLEKEMQQAASALDFEGAAQLRDMVLELRAMD"
FT   gene            558401..559210
FT                   /gene="gltS"
FT                   /locus_tag="L158343"
FT   CDS             558401..559210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltS"
FT                   /locus_tag="L158343"
FT                   /product="glutamate or arginine ABC transporter substrate
FT                   binding protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.02 TRANSPORT AND BINDING
FT                   proteinS Amino acids, peptides and amines"
FT                   /db_xref="EnsemblGenomes-Gn:L158343"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04661"
FT                   /db_xref="GOA:Q9CI05"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI05"
FT                   /protein_id="AAK04661.1"
FT                   /translation="MKKLALGMVGLAAVATLAACGNGKSATNQVDKVKKAGVLKVALSP
FT                   DYPPFEFQIIKDGKNTVVGSDVDLANAIGKKLGVKVKIESMDFNNVLASLNTGKADIAI
FT                   SGISKEPSREKSVNFSDVYYTASNYLVVKKSDLSKYRSVDDFKGKKVAAQKGSTQEGIV
FT                   TSQFKGATEIALPQIGDEINEVKGGQVQGAVIENLIAKSYVAANSDLAIANVDVKTPKD
FT                   SYGSAVALPKGSDELTKVVNSVIKEELKNGQINKDIQKNYTLSENNK"
FT   gene            559225..560343
FT                   /gene="argE"
FT                   /locus_tag="L0115"
FT   CDS             559225..560343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="L0115"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="EVIDENCE BY HOMOLOGY BIO01.05 Glutamate family.
FT                   FIFTH STEP IN ARGININE BIOSYNTHESIS"
FT                   /db_xref="EnsemblGenomes-Gn:L0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04662"
FT                   /db_xref="GOA:Q9CI04"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI04"
FT                   /protein_id="AAK04662.1"
FT                   /translation="MEKAVDLLKSLVNIPSSSGNEEEILIFLEKWFIEKQFDFVIRKET
FT                   FVAGQIKAKGKKEPKKEAIILTGHVDTVVSGHLADWKFSPTDARVEEGKLFGLGASDMK
FT                   GGDVGNLLAAASFIGKDLSQDIWVVGTANEELDGKGSEDFARYFSENWSYDSACCIIAE
FT                   PTDLEKIYIGQRGNHFMKLHFSGKAGHASVQEHFQQSALGAVTYFLENIEQIVEDLKIY
FT                   KNSQLGLPTFVVTSILSGDENSPNKTADFAELVVDCRLTPELEEVFEQVMSELAVQYHF
FT                   THEDIVTPVLSTLTDNQAPFIQLLTNLSGAKTTAASGSNEQGFFENVGIRTVVFGPGQH
FT                   EQCHIANESIILEKLEEHIEILQSFIKKMQES"
FT   gene            complement(560411..560866)
FT                   /gene="fabZ1"
FT                   /locus_tag="L160425"
FT   CDS             complement(560411..560866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ1"
FT                   /locus_tag="L160425"
FT                   /product="hydroxymyristoyl-acyl carrier protein
FT                   dehydratase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO07.01 FATTY ACID AND
FT                   PHOSPHOLIPID METABOLISM"
FT                   /db_xref="EnsemblGenomes-Gn:L160425"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04663"
FT                   /db_xref="GOA:Q9CI03"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CI03"
FT                   /protein_id="AAK04663.1"
FT                   /translation="MTKKYAMTATEVMEVIPNRYPIMFIDYVDEISENKIVATKNVTIN
FT                   EEVFNGHFPGNPTFPGVLILESLAQAGSILILKKEEFQGKMAYIGGIDKAKFRQKVTPG
FT                   DVMKLEFEITKFRGKVGTADAAAYVDGKKVTTCQFTFIVDEAAEQTN"
FT   gene            561142..561894
FT                   /gene="fabI"
FT                   /locus_tag="L161132"
FT   CDS             561142..561894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="L161132"
FT                   /product="NADH-dependent enoyl-ACP reductase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO07.01 FATTY ACID AND
FT                   PHOSPHOLIPID METABOLISM"
FT                   /db_xref="EnsemblGenomes-Gn:L161132"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04664"
FT                   /db_xref="GOA:Q9CI02"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI02"
FT                   /protein_id="AAK04664.1"
FT                   /translation="MFLEGKKIVIMGVANNKSIAWGCAKAMKDQGATLIYTYQNERMEK
FT                   QLAKLAEPEDLLIECDVTSDESIRRAFGTIEARVGKIDGLVHAIAYSKKEELGGNVTDI
FT                   SRDGYALAQDISAYSLLAVAKAAKPLLKKGSGIVTLTYMGSVRAIPNYNVMGIAKAALE
FT                   STVRYLAAEMAHVGVHVNGISAGAIKTLAVSGVSGYKDLIKESDSRTADGVGVTIDDVG
FT                   QTAAFLVSPLASGVIGDIVYVDKGVHLT"
FT   gene            562156..562563
FT                   /gene="yfgC"
FT                   /locus_tag="L162152"
FT   CDS             562156..562563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfgC"
FT                   /locus_tag="L162152"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L162152"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04665"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI01"
FT                   /protein_id="AAK04665.1"
FT                   /translation="MKLMKKTLVTLAVTLGISGALSPAVNAATKTTNASISVLNIITMA
FT                   DRVYFQYNGKAISTATAFQSAHSFTPTNWVTQNGISLINKNGSWGRIYQGKYTVGSGIN
FT                   AGKFGHVGVSFNKYIRTTILGNGQWTYSTFN"
FT   gene            562632..563272
FT                   /gene="yfgE"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS. General. probably there is a frameshift mutation
FT                   in this gene. There are 60 paralogs in L.lactis."
FT   gene            563253..564173
FT                   /gene="yfgF"
FT                   /locus_tag="L163255"
FT   CDS             563253..564173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfgF"
FT                   /locus_tag="L163255"
FT                   /product="ABC transporter permease protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.01 TRANSPORT AND BINDING
FT                   proteinS. General"
FT                   /db_xref="EnsemblGenomes-Gn:L163255"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04666"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CI00"
FT                   /protein_id="AAK04666.1"
FT                   /translation="MKVTLIKELFYLTKSKIYLVISGIIIGLLILGTFQASLNLKGAES
FT                   LFVEDKQSDINFQKNIHKDYSISNNGNQSILNNATRYDYEQLNQANQAISFVGFPQFIF
FT                   KSYGMTIISLLAGFFGVLVANYDYKFGTFKRRLGQQSWKIILLGKSVGLVVSLIVMYLL
FT                   IFSLAACSGEILHLFFKSENAGEYGQSLYPLINSDSFYLLFFSFMIGLALAMMCFALTL
FT                   ASKRANLIGSAFMIYLFILPNTGCFDWSNMTLNIFAPFGNHLGVPPLSMTQISPLFILV
FT                   LFVTYLLIILTGGMLIFFKHTRYNI"
FT   gene            complement(564298..565221)
FT                   /gene="yfgG"
FT                   /locus_tag="L164312"
FT   CDS             complement(564298..565221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfgG"
FT                   /locus_tag="L164312"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved. lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:L164312"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04667"
FT                   /db_xref="GOA:Q9CHZ9"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CHZ9"
FT                   /protein_id="AAK04667.1"
FT                   /translation="MTAGLLFLSGCVQTHVVDGVRVPTEAATHGITYNFLVRPMSAFVD
FT                   LFANNLHMGYGWGIIFVTLIIRFLILPLGLNQAYKSTYMQEKMAYLAPVFAPLQERLKK
FT                   AQTPEEKMAAQQALMAAQKDNGINMLSSIGCLPMLIQWPFFIALYNAAAYTTGISSSTF
FT                   YGIPLGHPSVVLVIISGVLYFIQTWISTLSMTPEQKKSGMAMLIMSPAMIVVFSFMSPA
FT                   GVALYWAVGGFVIVIQQIIITFIMKPRMRRRIDEEFTKNPPKINNEGLKDVTPTSVQEN
FT                   FKEITSERNEKERKSGGRNAGKQNRK"
FT   gene            complement(565435..566193)
FT                   /gene="yfgH"
FT                   /locus_tag="L165449"
FT   CDS             complement(565435..566193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfgH"
FT                   /locus_tag="L165449"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L165449"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04668"
FT                   /db_xref="GOA:Q9CHZ8"
FT                   /db_xref="InterPro:IPR005002"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHZ8"
FT                   /protein_id="AAK04668.1"
FT                   /translation="MKKILSFDIDNTLNEPKMPIFPEMAELLATLSQKYIIAPISGQKY
FT                   DQFLIQIINNLPESANLDNFHLFVAQGTQYYAHKDGEWKQVFNYALTDEQANAIMGALE
FT                   KAAKELGHWDESVLAPGDEINENRESMIAYSAIGQKAGVEAKQAWDPDMTKRNEIAKLA
FT                   SQYAPEFEFEVAGTTTINGFVPGQNKEFGMNHLMEELNVTKEEILYFGDMTQPGGNDYP
FT                   VVQMGIETITVRDWKETAAILKAIIAMEEA"
FT   gene            complement(566288..566878)
FT                   /gene="yfgL"
FT                   /locus_tag="L166479"
FT   CDS             complement(566288..566878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfgL"
FT                   /locus_tag="L166479"
FT                   /product="hypothetical membrane protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   30% identical to several membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:L166479"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04669"
FT                   /db_xref="GOA:Q9CHZ7"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHZ7"
FT                   /protein_id="AAK04669.1"
FT                   /translation="MKKSKASDVAILSIFIAIMVVVQLLSQIIYSVWPLPIVPTLLHIP
FT                   VIIGSIVLGVRKGAFLGLVMGLISVINSTIVTLPSSFMFSPLQPVPGTNHGSIWALVIA
FT                   IVPRVLVGILPALVYRLAQNRFGAGLAAFVGTATNTLLVLSFIFLFFHDVTKQTFGALL
FT                   ASIITGNSIAEVIIAVILTMAIVPALSKARGNS"
FT   gene            complement(566895..567431)
FT                   /gene="dfpA"
FT                   /locus_tag="L166912"
FT   CDS             complement(566895..567431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfpA"
FT                   /locus_tag="L166912"
FT                   /product="pantothenate metabolism flavoprotein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO02.07 Pantothenate.
FT                   flavoprotein, probably involved in pantothenate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:L166912"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04670"
FT                   /db_xref="GOA:Q9CHZ6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR011847"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHZ6"
FT                   /protein_id="AAK04670.1"
FT                   /translation="MTKITLAVTGSIAAYKAADLTSLLTKEGHDVTVLMTKSATQFITP
FT                   LTLQVLSKNKVHLDIMDEERPELVNHIDLAKNTELFLVAPATADTISRLAQGRADDIVT
FT                   SVALALEPSVPKYFAPAMNTKMYQHPLTQKNIEILKKIDYNMIQPKKSLLACGDFGEGA
FT                   LADLPDILSDLKNSL"
FT   gene            complement(567424..568119)
FT                   /gene="dfpB"
FT                   /locus_tag="L167675"
FT   CDS             complement(567424..568119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfpB"
FT                   /locus_tag="L167675"
FT                   /product="flavoprotein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO02.07 BIOSYNTHESIS OF
FT                   COFACTORS, PROSTHETIC GROUPS, AND CARRIERS. Pantothenate.
FT                   Apparently the middle part of the protein. Probably
FT                   involved in pantothenate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:L167675"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04671"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR011848"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHZ5"
FT                   /protein_id="AAK04671.1"
FT                   /translation="MKVLITSGGTTEPIDNVRGISNFATGSLGKVTAENFLNAGHEVYL
FT                   LAGLQAKLPEFTDRLTYIPIEGTHDLYEQMKNLVPDMDVVIHSMAVSDYRPIYMTGLEN
FT                   FTDKFSKEELLNFRPEKVGKISSKSDYQIMLLEKTPKIISYIKEWNPNVLLFGFKLLVG
FT                   VEKSELLSVAREKLLTNHADFILANDLENIHGNDHQAFLVSKNHEITLKTKAEIADRLL
FT                   KTSEELKND"
FT   gene            complement(568265..568450)
FT                   /gene="xylH"
FT                   /locus_tag="L168282"
FT   CDS             complement(568265..568450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylH"
FT                   /locus_tag="L168282"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO05.06 CENTRAL INTERMEDIARY
FT                   METABOLISM. Other"
FT                   /db_xref="EnsemblGenomes-Gn:L168282"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04672"
FT                   /db_xref="GOA:Q9CHZ4"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CHZ4"
FT                   /protein_id="AAK04672.1"
FT                   /translation="MPYVHVELFEGRTVEQKAIIAKEITESISKHAGAPTSAIHVIFND
FT                   LPEGMLYQGGEMKKKK"
FT   gene            568648..570975
FT                   /gene="yfgQ"
FT                   /locus_tag="L168650"
FT   CDS             568648..570975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfgQ"
FT                   /locus_tag="L168650"
FT                   /product="cation-transporting ATPase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.05 TRANSPORT AND BINDING
FT                   proteinS. Cations"
FT                   /db_xref="EnsemblGenomes-Gn:L168650"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04673"
FT                   /db_xref="GOA:Q9CHZ3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHZ3"
FT                   /protein_id="AAK04673.1"
FT                   /translation="MSLKGLTSFEVEERIRQGKINKNIDETDRPVWEIVKRNTFTFFNL
FT                   IFAVIAILISLVQAWNQLIFLPIIVINTIVGIYQEIKAKRYLDQMTLLHAPQSTVIRNG
FT                   QQEKIASDDLVEEDIIILKTGNQIVADARIVEGSIFVNESLLTGEADEIEKNVDNKLLS
FT                   GSFVVSGEAKVILEKVGKDSYISKLTEQAKLVDHGEDSEMLRALNKLLKWVSFIILPIA
FT                   VILFTQNYFVNHNTLQTSVVAMVAAVIGMIPEGLYLLTTIALTLSSVKLARNQVLLHNM
FT                   KSIESLARVDVLCVDKTGTITEPRMSVEQVFVSPSSNISEAKFMSLLSDYISANTDDND
FT                   TMKAIREFMLAKGDLQNKMTGVKKIIPFSSKVKYSAVCFENESYLLGAPEIVLGKTYEK
FT                   VSSEINHLLEEGFRVLVLAGTKEKIYDQLNLGAYALGYVVLANPIRENAKSTFNYFAEQ
FT                   GVNIKVISGDNPQTVSAVAKRAGITGAERFIDANLLKTKEDLDQAVESYTVFGRVTPDQ
FT                   KRRLVQALKRKDHTVAMTGDGVNDILAMKSADCSIAMASGSDAATQVAQVVLLDSDFGH
FT                   MTQVVTEGRRVVNNVQRSAILFLVKNLFSIILAIISAIFVFTYPLQASQLSLISLFTIG
FT                   IPGFLLSLEENDKRIEKDFIKNVILKALPASLTEITAVLGVVIAGAAFKLTASEISTSA
FT                   VILLAVVGFMILTKISAPLNRFKMGIIIFNIVGIIISGFMFNSLFSISKISLDSFVLVA
FT                   LLSLFSESLFRNFDSLLKKFFK"
FT   gene            570988..571431
FT                   /gene="yfhA"
FT                   /locus_tag="L170990"
FT   CDS             570988..571431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhA"
FT                   /locus_tag="L170990"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   paralogous to yafE"
FT                   /db_xref="EnsemblGenomes-Gn:L170990"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04674"
FT                   /db_xref="GOA:Q9CHZ2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHZ2"
FT                   /protein_id="AAK04674.1"
FT                   /translation="MKEINKDMRNKELIEELISLWENSVKETHSFLSVKEIEDIKQYVP
FT                   QALKAIEHLIVEFDDNEKPIAFMGIVGEKLEMLFISPNRMKKGLGRKLLEEAIKNYSVN
FT                   ELVVNEQNPQAKGFYEHLGFKVYKRNPIDEQGNQYPILFMHLG"
FT   gene            571538..572470
FT                   /gene="yfhB"
FT                   /locus_tag="L171552"
FT   CDS             571538..572470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhB"
FT                   /locus_tag="L171552"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   there are three paralogs in L.lactis. Membrane protein."
FT                   /db_xref="EnsemblGenomes-Gn:L171552"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04675"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHZ1"
FT                   /protein_id="AAK04675.1"
FT                   /translation="MAFLIISLIIMLIGLLRLKINKRSIIGGIFLASGLILSLASLFFE
FT                   LLNLIYLYLPSGDFATLIIAYGILPLIFLLVCGYFIFNSKTMRTKEGKSATAKLSALFG
FT                   LNLLIAFPALFMLFTFSTKTIPQIIWYILLYILLIDIILCFLFAAYILYSWMSQMIPLQ
FT                   KKIDYIIILGSGVRSEEVPPLLKSRLDKGIEYYQKNPTAKFVVSGGQGADEPVSEAFAM
FT                   RKYLHSQNIPNHQILFEDKFTTTYENMLFSKRIINEDWSDKEMPPSIIFSTNNYHVLRG
FT                   SLYAQRVKLKAQGVGGTHSTLFLTYGLNS"
FT   gene            572714..573307
FT                   /gene="yfhC"
FT                   /locus_tag="L172704"
FT   CDS             572714..573307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhC"
FT                   /locus_tag="L172704"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L172704"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04676"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHZ0"
FT                   /protein_id="AAK04676.1"
FT                   /translation="MKKILIALIIIVPIAITGFLGYDFFKKNFAHVHGIIMYSDNKDEA
FT                   DTILENNKKYIDKSLTVEGKYSSKSDVLVLNTQAANKLINEKVFNNVTKKGDKFKFKTV
FT                   ENLSAEPALWTGKEDKTITDDKGQSVKPKSTKYIVLGEYSATSKLLILNDEDYQKFDAK
FT                   AKFVSVIKEKRDADKVLKSYITSGSIPSQIFPYK"
FT   gene            573505..573987
FT                   /gene="crtK"
FT                   /locus_tag="L173469"
FT   CDS             573505..573987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtK"
FT                   /locus_tag="L173469"
FT                   /product="carotenoid biosynthetic protein CrtK"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.05 OTHER"
FT                   /db_xref="EnsemblGenomes-Gn:L173469"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04677"
FT                   /db_xref="GOA:Q9CHY9"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHY9"
FT                   /protein_id="AAK04677.1"
FT                   /translation="MTSKKLKALGQLILFIVGIELIGGLSGLLAGDIKGIYNNLKLPPL
FT                   APPDYLFGIVWPVLYALIAISAYLIFYKLKTQRSEGQNALFYFGIQLILNFIWSIIFFK
FT                   GYFWLGVIIILLLDFIVYLCIIKFSKINKWSAFLLIPYFIWIIFATYLSISVAILN"
FT   gene            574106..574507
FT                   /gene="yfhF"
FT                   /locus_tag="L174076"
FT   CDS             574106..574507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhF"
FT                   /locus_tag="L174076"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L174076"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04678"
FT                   /db_xref="InterPro:IPR018687"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHY8"
FT                   /protein_id="AAK04678.1"
FT                   /translation="MNFIKPFIISGVIFLILDICWLFFANKKIYQPNIGNLMGDFKVIP
FT                   AIIFYIIYLGALTFFVLMPGLEKNSITYVLLSGALLGLVCYSTYDLTNLASIKDWSLMV
FT                   TIIDIIWGTFVSSLSASLSFLVITKFMEG"
FT   gene            574511..576307
FT                   /gene="yfhG"
FT                   /locus_tag="L174523"
FT   CDS             574511..576307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhG"
FT                   /locus_tag="L174523"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:L174523"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04679"
FT                   /db_xref="GOA:Q9CHY7"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHY7"
FT                   /protein_id="AAK04679.1"
FT                   /translation="MEKVKSEDRLLESIIAGAQKVINGKDELNKINVFPVADGDTGSNL
FT                   ASLMQTIIDNLSNNNYSTNLLFDEVASAALIGARGNSGIIFAQYLNAVSDYYSVYETNL
FT                   EILVLAFNRAVKSAYDSLIEPKEGTILSVMKRWAEVLLITFKESTSFEKALLEAKGEAW
FT                   KALKETQFQMSILKKNKLVDSGAKGFYYFISGFTDAYCGEKVSKIQEGLIPSIKELNTE
FT                   DIKEHFISEAPKNRYCSEFIIKEPLKQEKDLKESLRRWGDSLVIAGNKKQIKIHIHTNH
FT                   PENILALLEKTGTIIYQKVDDMQLQYEISQNRKSSIAIVTDSVADLSADFILENQIFVL
FT                   PLNVSVGEQAFLDKLTINPQIFSEKYNKNLKMTTSQPSIQSVDSLFSFLEGKYEHIIVI
FT                   SVSSKLSGTYQLLNQRITAKKSLENRVHLIDSKLNSVAQGLLVKQVAKLISEERSIESV
FT                   LNETEKITDRIFIYVVVEDLSPMINSGRIPKILGETAQKLSMHPIISLDKRGNGKLIGA
FT                   SFSQNKSMDKILKKINLLSKEGQIEELALTHVLSEESALKINELLKEKTTKNCEIIDSS
FT                   AAIGISAGIGSLAIAGLLKEVK"
FT   gene            576304..577077
FT                   /gene="yfhH"
FT                   /locus_tag="L176238"
FT   CDS             576304..577077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhH"
FT                   /locus_tag="L176238"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L176238"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04680"
FT                   /db_xref="GOA:Q9CHY6"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHY6"
FT                   /protein_id="AAK04680.1"
FT                   /translation="MNYIAVLVTLLLYFICWFLIATSKKNYGLIDIAWGGGFVLTAVVS
FT                   YLFSPRITIQNSLILVLVILWGVRLAIHLGRRNWNKPEDYRYTNMRKRWGNNFPKLKAF
FT                   LTVFMVQYLLLIIISLPIIQVNSNVNSQFYWWQILGIIIWIFGFIFEVFGDRQLEVFKK
FT                   LPQNKGKLLTSGLWSLTRHPNYFGESMCWWGIFLISLTTLSTLWLVISPLLITSLLLFV
FT                   SGVPILEKKYKNREDFKEYAKTTPKFVPFIGKKGL"
FT   gene            577224..577586
FT                   /gene="yfhI"
FT                   /locus_tag="L177221"
FT   CDS             577224..577586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhI"
FT                   /locus_tag="L177221"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 39%
FT                   identical to a protein from Enterococcus faecalis."
FT                   /db_xref="EnsemblGenomes-Gn:L177221"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04681"
FT                   /db_xref="InterPro:IPR006542"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHY5"
FT                   /protein_id="AAK04681.1"
FT                   /translation="MKKVLVGLLAIMVMIIASGYTYYKMNYGGESYYVQILVNGEREET
FT                   TADDHTPMVIYHYKLDSFNSKGDKKLVKFMASHNLRNQAYLELTYNKHKGVTNWNEVQE
FT                   KEIPKPALKELQSLEN"
FT   gene            577706..578074
FT                   /gene="yfhJ"
FT                   /locus_tag="L177700"
FT   CDS             577706..578074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhJ"
FT                   /locus_tag="L177700"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 33%
FT                   identical to a protein from Enterococcus faecalis and
FT                   Staphilococcus aureus."
FT                   /db_xref="EnsemblGenomes-Gn:L177700"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04682"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHY4"
FT                   /protein_id="AAK04682.1"
FT                   /translation="MAFNICVNLYVKEVEKEVDFFRSIGFLEIERHKMENSDSVVISPL
FT                   SDGNAFLQIWDIEFIKKVSPEVANDKPSLLFTVYNIEEMNEKLKKITPTTSDLMDANGK
FT                   KAFNFQSPSGNYYAFMEI"
FT   gene            578303..578587
FT                   /gene="yfhK"
FT                   /locus_tag="L178303"
FT   CDS             578303..578587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhK"
FT                   /locus_tag="L178303"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL.General"
FT                   /db_xref="EnsemblGenomes-Gn:L178303"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04683"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHY3"
FT                   /protein_id="AAK04683.1"
FT                   /translation="MIIVNAKFYIKEDKKSQFLKEIEGLISASKKDEGCLEYSLYESTD
FT                   NQLEFVMIENWESQEAIEKHNTNPLLLAFAKNLSTYSSKKPVLQIAETK"
FT   gene            complement(578890..579588)
FT                   /gene="yfhL"
FT                   /locus_tag="L178908"
FT   CDS             complement(578890..579588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhL"
FT                   /locus_tag="L178908"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:L178908"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04684"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHY2"
FT                   /protein_id="AAK04684.1"
FT                   /translation="MEYQLSSTSMAPLVEISLDNNEEIQIESGAMVYHNAAVKLEGKMN
FT                   SNGKGGLRGALKALGRSITSGESFFITKASAIGANGKISLAPASLGSIKEILVGKEQWN
FT                   LNTGAFLVSEGGVHYIMERQKLDGALFGGTGGLFVMKTQGSGKMLISGYGDIVEIALDG
FT                   TEDFVVDNQHVLAWTESLSYSIEVASGTFGFKTGEGLVNKFRGKGKILIQSRNVEALAQ
FT                   SIIPFIPSKG"
FT   gene            complement(579746..580126)
FT                   /gene="yfiA"
FT                   /locus_tag="L179764"
FT   CDS             complement(579746..580126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiA"
FT                   /locus_tag="L179764"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General"
FT                   /db_xref="EnsemblGenomes-Gn:L179764"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04685"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHY1"
FT                   /protein_id="AAK04685.1"
FT                   /translation="MQQVKIRRIKMSVDRSYSSYEVIRAYQDRGMMKWGSFATGELTEA
FT                   QNAFVKEQNSDKILQPLSHHIILHLLNQSFTNQVQVKIKYQSKVKITEVFGFVSEFINN
FT                   QVRIKSTDKIHLISIEKIINIS"
FT   gene            complement(580086..581552)
FT                   /gene="umuC"
FT                   /locus_tag="L180104"
FT   CDS             complement(580086..581552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umuC"
FT                   /locus_tag="L180104"
FT                   /product="SOS responce UmuC protein"
FT                   /note="EVIDENCE EXPERIMENTAL PMID:9097419 BIO10.02 DNA
FT                   replication, restriction, modification, recombination, and
FT                   repair. involved in UV protection and mutagenesis. May
FT                   modify DNA replication machinery to allow bypass through a
FT                   damaged template"
FT                   /db_xref="EnsemblGenomes-Gn:L180104"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04686"
FT                   /db_xref="GOA:Q9CHY0"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHY0"
FT                   /protein_id="AAK04686.1"
FT                   /translation="MDKHKLNNFFDYSLEPRRAILFEDVKSNYASIECVQRNLNPLTTS
FT                   LCVMSRADNTKGLTLASSPTFKKVFGMKNISRASDLPFIIETRKFNFPQWYRTHTDIYG
FT                   QRTEPTLQHVAFIESWAKRTWLVPPQMQLYVDYKIKVTEILTNYTSIEEIHSYSIDESF
FT                   LDITESLNFFYPDIRNRYEQMNLITLDLQREILDKLGLYVTVGMGDNPLLAKLAMDNYA
FT                   KHNQNMRALIRYEDVPSKLWTLPKMTDFWGIGKRTEKRLNKLGISSIKELTNADPLLLK
FT                   QKLGTIGLQHFFHANGIDESNVREKYIPKSSSFSNSQILPRDYHKQKEIELVIKEMAEN
FT                   LAIGLRKGGRMASNLSLYVGAAASSEHSSIKISRNIEATQNTKELQDLAILLFREKYQG
FT                   GAVRQIGISGNQLSDNSVKQLSLFETVEENQFNEKQESLQKAIDEIREKFDFLSIQKAS
FT                   SLSEGSRVIYRNKLIGGHAASQNKEDKDVS"
FT   gene            complement(582008..582541)
FT                   /gene="yfiC"
FT                   /locus_tag="L182026"
FT   CDS             complement(582008..582541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiC"
FT                   /locus_tag="L182026"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 23%
FT                   identical to a protein from Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L182026"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04687"
FT                   /db_xref="GOA:Q9CHX9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHX9"
FT                   /protein_id="AAK04687.1"
FT                   /translation="MKYFVRLATEQDKPAVAKFYDNSLPLIDEKQTSWIKNIYPSIDTA
FT                   LKAIDLSQLFVCYDSNDIVSGTVILNNQSDKEYENITWSTPELDPNQILIIHTLVIDPK
FT                   KLNQGIASAMINFIKDFGKSNSMVTIRLDTNFKNTPAQKLYEKHQFVFRGRTNLKSFDN
FT                   KGWDDCVFYEFCLK"
FT   gene            582842..583351
FT                   /gene="yfiD"
FT                   /locus_tag="L182797"
FT   CDS             582842..583351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiD"
FT                   /locus_tag="L182797"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L182797"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04688"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHX8"
FT                   /protein_id="AAK04688.1"
FT                   /translation="MKIKKIIIAATTFAIVFSTCIGIKSLADNYWTGHGEIQTINNNID
FT                   TLSNRVKSKNQVISDLNQTIANLKSSVDSQSSQVNSLQTQLTQANVDKQNEINAKINEI
FT                   NTKIAEGNQKVADKQKEVDTANQTISQLNQQLNDLRQKSGQDNDQALREVQDTRAKSDQ
FT                   AVKDAQ"
FT   gene            complement(583404..583835)
FT                   /gene="rmaJ"
FT                   /locus_tag="L583407"
FT   CDS             complement(583404..583835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmaJ"
FT                   /locus_tag="L583407"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.08 MarR-family
FT                   regulators. belongs to the MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:L583407"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04689"
FT                   /db_xref="GOA:Q9CHX7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHX7"
FT                   /protein_id="AAK04689.1"
FT                   /translation="MTDNILSKELCFQLYIASKEIIKKYNSYLNRYSLTYTGFIAMLAI
FT                   ENKMTINKLGEELSLDSGTLSPLLKRLEAKGYIVRKRSDKDERSVELFLTDKGAQVKKE
FT                   LPSISLEIGDSLVSCNENINYDLLLSQLLTLNKSLKTEI"
FT   gene            583936..584349
FT                   /gene="yfiE"
FT                   /locus_tag="L183902"
FT   CDS             583936..584349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiE"
FT                   /locus_tag="L183902"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved. there are three paralogs in L.lactis"
FT                   /db_xref="EnsemblGenomes-Gn:L183902"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04690"
FT                   /db_xref="GOA:Q9CHX6"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHX6"
FT                   /protein_id="AAK04690.1"
FT                   /translation="MKKIFSTKMINIGGRNGEVHSPDKSFNLDIVAPGRKVEGATNPEQ
FT                   LFAAGYSACFNSALDYIKKSKNIEGESTIEVTVSLYNLSQNEIPDVVLGVDITGHIEGV
FT                   GTEETEELLKLTHKTCPYSRATQGNIEVTIKAI"
FT   gene            584876..585445
FT                   /gene="yfiG"
FT                   /locus_tag="L184871"
FT   CDS             584876..585445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiG"
FT                   /locus_tag="L184871"
FT                   /product="thymidine kinase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO08.05 Salvage of nucleosides
FT                   and nucleotides"
FT                   /db_xref="EnsemblGenomes-Gn:L184871"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04691"
FT                   /db_xref="GOA:Q9CHX5"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR020634"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CHX5"
FT                   /protein_id="AAK04691.1"
FT                   /translation="MAQLYFKYGTMNSGKSIEILKVAHNYEEQGKPVLLMTSSLDTRAG
FT                   VGTVASRIGMKAEAVAIDEEMSVFDYVNSLPAKPFCVLIDEAQFLNKKHVYDFARVVDE
FT                   LNVPVMAFGLKNDFRNELFEGSKYLLLLADKIEEIKTICWYCSKKATMVIRTIDGKPVY
FT                   EGEQLQIGGNETYIPVCRKHYFKPEI"
FT   gene            585501..585944
FT                   /gene="yfiH"
FT                   /locus_tag="L185472"
FT   CDS             585501..585944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiH"
FT                   /locus_tag="L185472"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L185472"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04692"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHX4"
FT                   /protein_id="AAK04692.1"
FT                   /translation="MFYHFKGTITGEDYQRILGQMTKRMMLVFSGIMLIFLVINLFMSK
FT                   GQWLWPVVSALLVLVLGNLFLHWQLKSRFLKNFKPQELDMYVTEEQIKAQMNVRNVEIF
FT                   SDRVHFFQGRNQVMIFKKDMLQDLTQWDSFVNMAKNLPLQTKK"
FT   gene            585962..587035
FT                   /gene="prfA"
FT                   /locus_tag="L0373"
FT   CDS             585962..587035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="L0373"
FT                   /product="peptide chain release factor 1"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.07 Translation factors.
FT                   directs the termination of translation in responce to the
FT                   termination codons UAG and UAA"
FT                   /db_xref="EnsemblGenomes-Gn:L0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04693"
FT                   /db_xref="GOA:Q9CHX3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CHX3"
FT                   /protein_id="AAK04693.1"
FT                   /translation="MFDQLESIVGRYEELGELLSDPEVVSDTKRFMELSREEADLRDKV
FT                   ATYNEYKKVLETISDSEEMLGEGGLDDDMKEMLKEELSSAKSQKELLEEEIKILLLPKD
FT                   PNDGKNIILEIRGAAGGDEAALFAGDLLNMYQHFSESQGWKFEIMEANITGIGGYKEVS
FT                   ALISGPSVYSKLKYESGAHRVQRVPVTETQGRVHTSTATVLVMPEVEEFEMTIDQKDLR
FT                   VDIYHASGAGGQNVNKVATAVRMVHLPTGIKVEMQEERTQQKNRDKAIKLLNTKVFDYY
FT                   QQIELDKQNAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDSILSGKMDEVI
FT                   DALIVYDQTKKLEELNK"
FT   gene            587035..587562
FT                   /gene="yfiI"
FT                   /locus_tag="L187045"
FT   CDS             587035..587562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiI"
FT                   /locus_tag="L187045"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 BIO16.01 UNKNOWN.
FT                   General. homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L187045"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04694"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHX2"
FT                   /protein_id="AAK04694.1"
FT                   /translation="MDFEFEGFVIREVGHENRKMQTSKKVNNVSTDVTIFKVKGFDLSF
FT                   DLLYCRGENGDVWVVAEKIESLSKHLHRAQRTRMSIENYKEKQYCRLWQEVKKDEDWSR
FT                   TKKSLPLSELGKYSKNPLRQSFSELGAKLGTLEELVSETNQNRKQYALLFPAQEVKIPL
FT                   CAYLLTRISPLI"
FT   gene            587730..588380
FT                   /gene="yfiJ"
FT                   /locus_tag="L187716"
FT   CDS             587730..588380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiJ"
FT                   /locus_tag="L187716"
FT                   /product="NADPH-flavin oxidoreductase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.05 Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:L187716"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04695"
FT                   /db_xref="GOA:Q9CHX1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHX1"
FT                   /protein_id="AAK04695.1"
FT                   /translation="MIKAAQSGASSNFLQAYSIIEIADNDLRRELAKISGSDDYVNQTG
FT                   VFYIFVADWYRQAQILQTENKDVKALQNMEALTVAIVDTTIAAQNMAIAAESMGLGICY
FT                   IGGIRNDIDKVADLLDLPELTVPLFGLTIGMPKTRNEVKPRLPRANILSVNAYNRVTVS
FT                   DLQAYNEQTSDYYANRSHHQKSTDWTQEMSNFLTKPRREDVAKFLKKQGFTLN"
FT   gene            588486..589298
FT                   /gene="hemK"
FT                   /locus_tag="L188472"
FT   CDS             588486..589298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="L188472"
FT                   /product="protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="EVIDENCE BY HOMOLOGY BIO02.03 Heme and porphyrin.
FT                   THOUGHT TO BE INVOLVED IN THE OXIDATION OF
FT                   PROTOPORPHYRINOGEN INTO PROTOPORPHYRIN IX"
FT                   /db_xref="EnsemblGenomes-Gn:L188472"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04696"
FT                   /db_xref="GOA:Q9CHX0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CHX0"
FT                   /protein_id="AAK04696.1"
FT                   /translation="MLWIEAVRTLSADLEDPFELEFVWRNLHELNKLSWLNLMREKITD
FT                   QELKLLTEVSKRLHQNEPPQYIVGWAEFRDLKLKVDERVLIPRPETEELVEMILAENEK
FT                   DSLKILDIGTGSGAIAISLAQARENWSVKASDISKEALTLAAENAEINQANLEFIQSDV
FT                   LDKITDSFDIIVSNPPYIAFDETYEMDNSVIKYEPDLALFAENQGLAIYQKIADQAVNH
FT                   LTDNGKIYLEIGYKQGQAVQAIFQEKFTDKLVSIHQDIFGKDRMISVK"
FT   gene            589332..589796
FT                   /gene="yfiL"
FT                   /locus_tag="L189315"
FT   CDS             589332..589796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiL"
FT                   /locus_tag="L189315"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   Probably an acetyltransferase. There are three paralogs in
FT                   L.lactis."
FT                   /db_xref="EnsemblGenomes-Gn:L189315"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04697"
FT                   /db_xref="GOA:Q9CHW9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHW9"
FT                   /protein_id="AAK04697.1"
FT                   /translation="MNSLIFEQVFQQKEDFLPILLLADDGPHLENYLENGDLFTLSLKN
FT                   GKTVACAVVIKKQKNTFEIENFAVETSFQGQGFGQQMMKQLITYLKENLAADELILGTD
FT                   DVSNNVAFYEKCGFTITHKISNYFLDNCDHPIFEGKVQLKDKIYLRKKLK"
FT   gene            589901..590713
FT                   /gene="yfjA"
FT                   /locus_tag="L189883"
FT   CDS             589901..590713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjA"
FT                   /locus_tag="L189883"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:L189883"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04698"
FT                   /db_xref="GOA:Q9CHW8"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHW8"
FT                   /protein_id="AAK04698.1"
FT                   /translation="MKFVQGGLNNFANELEKVEGGFYGIIGLLFRRPYKVPDDLKNIRE
FT                   NLFIEAKTLQKELDKQSEKENNNKNRLSARAIKALKSGQLAILPTETVYGLFADAMNEE
FT                   AVQKLYSVKGRPTERALNMNISSFEDILKYSINQPVYLQKIVEAFLPGPLTIILEASKD
FT                   VPEWIHIGKSTVGFRMPNIAVTQKIIKEVGVLVGPSANLSGSKSPSFFADLSPEILENA
FT                   AVAVQDDSIYGLDTTIIDLTQEKPKLLRQGAVTKEELLKKVPELGQIE"
FT   gene            590943..592190
FT                   /gene="glyA"
FT                   /locus_tag="L0082"
FT   CDS             590943..592190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="L0082"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="EVIDENCE BY HOMOLOGY BIO01.08 Serine family"
FT                   /db_xref="EnsemblGenomes-Gn:L0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04699"
FT                   /db_xref="GOA:Q9CHW7"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CHW7"
FT                   /protein_id="AAK04699.1"
FT                   /translation="MIFDKEDFESFDPELWAAIHAEEIRQQQNIELIASENIVSKAVMA
FT                   AQGSVLTNKYAEGYPGKRYYGGTEAVDVVENLAIERAKELFGAKFANVQPHSGSQANAA
FT                   AYMALIQPGDTVLGMDLNAGGHLTHGASVNFSGKTYHFVPYGVNSETELLDYDEILKIA
FT                   KQVQPKLIVAGASAYSRLIDFAKFREIADSVGAKLMVDMAHIAGLVATGAHPNPLPYAD
FT                   VVTTTTHKTLRGPRGGMILTNDEALAKKINSAIFPGTQGGPLEHVIAAKAVAFKEALDP
FT                   EFTTYIEQVIKNTQAMAEEFAKVEGLRLIAGGSDNHLLNLKVLDLGINGKEAQDLLDSV
FT                   HITLNKEAIPDETLSPFKTSGVRIGAAAITSRGFKEVEAKKVAQLVSEALVNHDNQEKL
FT                   AEVRKAALELTRQFPL"
FT   gene            592351..592953
FT                   /gene="yfjB"
FT                   /locus_tag="L192354"
FT   CDS             592351..592953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjB"
FT                   /locus_tag="L192354"
FT                   /product="transposon-related protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO14.04 Transposon related
FT                   functions. 35% identical to Orf14 of E.faecalis transposon
FT                   Tn916"
FT                   /db_xref="EnsemblGenomes-Gn:L192354"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04700"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHW6"
FT                   /protein_id="AAK04700.1"
FT                   /translation="MFKKLIGLIVLILLVFSGFYVYRMHENVKDVMSYEAEVEKSLKAQ
FT                   GLSGDTKLALAIIYTETKGKQVDIMQSSESLNGTTNTFSTEQESIKQGISNLSKVLEYA
FT                   SQKKVDAWAGVQAYNYGKAYVDYIAAHGGKNTIALSKDYSRDVVAPSLGNTTGETYYHL
FT                   TLDSLIYNKGKLYSNGGNIFYAKEVEWNMLLLDLLNW"
FT   gene            593080..594177
FT                   /gene="serC"
FT                   /locus_tag="L0083"
FT   CDS             593080..594177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="L0083"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /note="EVIDENCE BY HOMOLOGY BIO01.08 Serine family"
FT                   /db_xref="EnsemblGenomes-Gn:L0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04701"
FT                   /db_xref="GOA:Q9CHW5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR003248"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CHW5"
FT                   /protein_id="AAK04701.1"
FT                   /translation="MIYNFGAGPSVLPKEVLKKVQEELLDFEKSGMSVMEISHRSKAFQ
FT                   KVIDEAENDLRDLMSIPQNYKILFLQGGASSQFSMVPMNLAIGKKAYYNISGAFGEKAY
FT                   DEAVKLSHFLDLMAISLGSTKKDNYNHLLKIDKSKIDEKNGAYLHLTTNNTIEGTSIFP
FT                   ENLPEFASLPLVADMSSNILAVDYDVSKFGLIYAGAQKNLGIAGLTIVIIREDLLNEAE
FT                   SLSSMMDYQILVENGSMYNTPPTFAIYVAGLVFKWVKAQGGVKKLEEMNQRKAQLLYDL
FT                   IDQSDFYQNPIKNKDERSICNVVFTSPSQELDELFTQKAEEKGFKSLKGHRSVGGMRAS
FT                   IYNAFPLEGVVELVKFMKEFEEGYK"
FT   gene            594174..595370
FT                   /gene="serA"
FT                   /locus_tag="L0084"
FT   CDS             594174..595370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="L0084"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="EVIDENCE BY HOMOLOGY BIO01.08 Serine family.
FT                   homology only to N-terminal part of SerA from other
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:L0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04702"
FT                   /db_xref="GOA:Q9CHW4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHW4"
FT                   /protein_id="AAK04702.1"
FT                   /translation="MTYHIKTIGNNIDQIALDEIGEGFLVNQVSEAESDAFICRAQPFH
FT                   DYEFSKALLAIGRAGAGFNNIPIEKCASKGIVVFNAPGGNANAVKELVLSMMIFGTRNL
FT                   KPANKWLTGQKGDDNTIDGAVEHGKKAFSGSEISGKTLGVIGLGNIGSKVANDAQRLGM
FT                   RVIGYDPYLSIEHAWNLSHHVKRVNDLAEIFEKADYITVHTPATDETTKMLNWKNLSKC
FT                   KKGVILLNYARDEITDKEAVLKAIDEGIVRFFGTDFGSEKFYHHPQVFLTPHLGGSTAE
FT                   ASLNCTRMALDSVQTYLKTGEIINSVNFPRVLQELNTPYRVTLINKNVPNVVAQISLAV
FT                   AAENINIANIVNRGQGDYAYTLLDLDEKDEGKLAALVSRFEAADNIIRVRLIENQSLV"
FT   gene            595394..596044
FT                   /gene="serB"
FT                   /locus_tag="L0085"
FT   CDS             595394..596044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="L0085"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="EVIDENCE BY HOMOLOGY BIO01.08 Serine family"
FT                   /db_xref="EnsemblGenomes-Gn:L0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04703"
FT                   /db_xref="GOA:Q9CHW3"
FT                   /db_xref="InterPro:IPR004469"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHW3"
FT                   /protein_id="AAK04703.1"
FT                   /translation="MAAKGLLVMDVDSTLIEEEVIDLLGEKAGMGDKISEITAAAMSGE
FT                   IDFKESLRERVALLSGLPTTIFDDVYKEIHLTKGATGLIETLHAKGWKVGLVSGGFHEI
FT                   VDKIARDLKIDYVFANRLSVENGHLTGKTHGTVVDKDFKVDRLKQWANENKLNLSEVIA
FT                   VGDGANDIPMLNTAGIGIAFCAKPAVKAAVSYHIDKRNLLTVLEFVDKLADKE"
FT   gene            complement(596163..596456)
FT                   /gene="yfjC"
FT                   /locus_tag="L196178"
FT   CDS             complement(596163..596456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjC"
FT                   /locus_tag="L196178"
FT                   /product="acylphosphate phosphohydrolase"
FT                   /EC_number="3.6.1.7"
FT                   /note="EVIDENCE BY HOMOLOGY BIO03.01 Membranes,
FT                   lipoproteins, and porins"
FT                   /db_xref="EnsemblGenomes-Gn:L196178"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04704"
FT                   /db_xref="GOA:Q9CHW2"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CHW2"
FT                   /protein_id="AAK04704.1"
FT                   /translation="MFKVKMIVSGRVQGVGFRYFVIISARELGILGRVWNNDDGTVEIL
FT                   AQTEDEKKLEEFTAIVRGEKSSKGRLSPFAKVTDVKSSPANFPDFTDFNIKY"
FT   gene            596779..597537
FT                   /gene="yfjD"
FT                   /locus_tag="L196779"
FT   CDS             596779..597537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjD"
FT                   /locus_tag="L196779"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO11.02 RNA synthesis,
FT                   modification, and DNA transcription"
FT                   /db_xref="EnsemblGenomes-Gn:L196779"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04705"
FT                   /db_xref="GOA:Q9CHW1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHW1"
FT                   /protein_id="AAK04705.1"
FT                   /translation="MEIISSKDNKKIKEARKLLTKKYRKNSYLIEGFHLLEEALKAGRS
FT                   IKQIFVEENKLTKLTEMIGSEKLLTDLSVNLVSKEVLKSLADSESPQGLIAEVTKIEEV
FT                   IDFSAAKFLLLENVQDPGNVGTMIRTADAAGFSAVILLGETADIYSPKVMRSMQGSNFH
FT                   LPLVRMAKEDCFAQLKKAGISILTTTLSANSVSYKIINEPHFALIMGNEGAGVSDEAVK
FT                   AADKLVHIDMPGQAESLNVAVAAGILMFSL"
FT   gene            complement(597682..598095)
FT                   /gene="yfjE"
FT                   /locus_tag="L197697"
FT   CDS             complement(597682..598095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjE"
FT                   /locus_tag="L197697"
FT                   /product="flavodoxin"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.05 Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:L197697"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04706"
FT                   /db_xref="GOA:Q9CHW0"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHW0"
FT                   /protein_id="AAK04706.1"
FT                   /translation="MTGNTEACADIVADKLEELGFEVELDECSSVDADEMADADLCIVG
FT                   TYTYGDGELPDEIVDFYEELAEVDLSGKIYGCFGSGDTFYDDFCICVDMFEAQFEKTGA
FT                   TKGAELVRVDLSPEDEDEAHLEAFAETLAAHFN"
FT   gene            complement(598274..599779)
FT                   /gene="yfjF"
FT                   /locus_tag="L198289"
FT   CDS             complement(598274..599779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjF"
FT                   /locus_tag="L198289"
FT                   /product="membrane-bound transport protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.08 TRANSPORT AND BINDING
FT                   proteinS. Multidrug resistance. similar to many multidrug
FT                   resistance transporters"
FT                   /db_xref="EnsemblGenomes-Gn:L198289"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04707"
FT                   /db_xref="GOA:Q9CHV9"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHV9"
FT                   /protein_id="AAK04707.1"
FT                   /translation="MAKSKKNEKEKLPKELTRNAWILVVGAIAPMLDSTMVNIAINKLQ
FT                   SDLHTSLDMIQWAITGYVLALAVAVPVCGYVVNHIDGKKVMQWSLLSFGLFSFLSGIAW
FT                   NIDSFIIFRAVQGFSAGFITLLMTTLLMQITPPDKLGQLMAVVSTPIILGPIIGPVLGG
FT                   AIVSGANWHWIFYINIPVVIIAVLLNHFYLSSFKPFNPKAKLDWFGTLLLAGGSVGLIY
FT                   GMMKGSTNAKNFFNSQMITFVIIGLALFVIYGIYNRIRKNNTVLPLRFFKSKNFTAANI
FT                   GIFLAGIASNGPMLLLPLFFQNTKGFTAVEAGLMLIPQGLGMMVTRPLIGKMIDRMGAR
FT                   PVVLVSLAISLLGTLPFIFVHENTNLIWLGLVLFVRGMGIGGLQMPMMTDIFIGLDKQD
FT                   IPGASVGQRIIQNVGSSFGSAVISAVVTAVVTSEIAGQMTTKLHQLAAMHTNLTPTVIA
FT                   KAKTSVEKAVTLNGYQLGFLVSSIVLIVIAIPAMFLSQKKVNK"
FT   gene            599993..600295
FT                   /gene="yfjG"
FT                   /locus_tag="L199942"
FT   CDS             599993..600295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjG"
FT                   /locus_tag="L199942"
FT                   /product="transcriptional regulator"
FT                   /note="EVIDENCE BY HOMOLOGY BIO09.01 REGULATORY FUNCTIONS.
FT                   General. similar to tetR-family transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:L199942"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04708"
FT                   /db_xref="GOA:Q9CHV8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHV8"
FT                   /protein_id="AAK04708.1"
FT                   /translation="MFEEKEKKSPNHSRRRGDELKKAIYKAAVHILENEGYEKVTFQNV
FT                   AKEAKTTRSVLYRYWDDVFDLIFEAVRFNISQNPEWRGNVIDQEINSGSLRTRFN"
FT   gene            600267..600620
FT                   /gene="yfjH"
FT                   /locus_tag="L200264"
FT   CDS             600267..600620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjH"
FT                   /locus_tag="L200264"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L200264"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04709"
FT                   /db_xref="GOA:Q9CHV7"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHV7"
FT                   /protein_id="AAK04709.1"
FT                   /translation="MGACGQDLIELLTFMRENFKLYPKGFLAFVSFMQSQGKNVLESTV
FT                   GNVLPSNLIIMERLLARAQERGEAREKIGQTAKLLPFQMTRYHMLLEGQSMNDKQINEL
FT                   VDEVLLPIYIKNT"
FT   gene            600904..601758
FT                   /gene="pepM"
FT                   /locus_tag="L883"
FT   CDS             600904..601758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepM"
FT                   /locus_tag="L883"
FT                   /product="mathionine aminopeptidase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.02 Degradation of
FT                   proteins, peptides, and glycopeptides"
FT                   /db_xref="EnsemblGenomes-Gn:L883"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04710"
FT                   /db_xref="GOA:Q9CHV6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHV6"
FT                   /protein_id="AAK04710.1"
FT                   /translation="MITLKSQREIEQMERSSKILADIHIGLRELIKPGIDMWEIEEYVR
FT                   KVCKEKNVLPLQIGVDEGNYNPFPYATCCCLNDEVAHAFPRHQILKDGDLIKVDMVLGL
FT                   VEDGSVDVSKLNFDDAESMVKYQEEFRGGVADSCWAYAVGQVSDEVKNLMDVTRECLYL
FT                   GIEQAKVGNRIGDIGAAIQEYAESRGYGVVRDLVGHGVGPTMHEEPMVPHYGRAGRGLR
FT                   LREGMVLTIEPMINTGGWEIDHDGERGYVTLDGSLSCQYEHQFVITKDGPVILTSQGEE
FT                   RTY"
FT   gene            601790..602683
FT                   /gene="ygaB"
FT                   /locus_tag="L1778"
FT   CDS             601790..602683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaB"
FT                   /locus_tag="L1778"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   probably tRNA-processing ribonuclease, evidenced by
FT                   COGnitor."
FT                   /db_xref="EnsemblGenomes-Gn:L1778"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04711"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHV5"
FT                   /protein_id="AAK04711.1"
FT                   /translation="MKKVIQKIAELTTTFMTFFKSSEMSLSSIAVAYYLLLAIFPLGLI
FT                   VGNILPFLHINTTALLSFLSEQLPSDVYKGIEPVINNLLNQRNTGLLSLSVLAGFWTFS
FT                   RALSALQMSMNKAYEVFNHRDFIVSRIIGLAAGFAILLFLYFSIVLSTFGQLILEQVHR
FT                   LFPFDDHLYRTLHNMTLPAIAVATFLSLMMLYFILPNVKIRKLRYTMPGTIFSTFVLVF
FT                   LTNWIAKYVSFALQRLDDLKLIGSLVVFALMIWFIFIARVLIIGAILNAVYQKTKVGKI
FT                   ETRRGEIVEFIKEIRK"
FT   gene            complement(602814..603260)
FT                   /gene="ygaC"
FT                   /locus_tag="L2829"
FT   CDS             complement(602814..603260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaC"
FT                   /locus_tag="L2829"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L2829"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04712"
FT                   /db_xref="GOA:Q9CHV4"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHV4"
FT                   /protein_id="AAK04712.1"
FT                   /translation="MKKLMNLFKSETVRYLIFGVLATAVYAFVKWLTWQAWHSGWGSET
FT                   AAQASSIIFAFFTNKLFVFKHESSNLLRDFINFTSGRIVLLLLSIFINWWFIDQHPDIL
FT                   MNLFGLSKNNMVAALNLVVQVLIIVINYLYSKFFVFKKDKNLTE"
FT   gene            603398..604129
FT                   /gene="ygaD"
FT                   /locus_tag="L3407"
FT   CDS             603398..604129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaD"
FT                   /locus_tag="L3407"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L3407"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04713"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHV3"
FT                   /protein_id="AAK04713.1"
FT                   /translation="MNQMMKKVVILLLISGLVLVTPHAFATAGGFRGGGNRSTRTGGNF
FT                   GGGNTNSHYSNTGSNSYTSNSSTSRMGSRYNRGRIWKWLIVLAGLGFYFIRNRVKLPFK
FT                   KRGYFQEKTLNDSALEAEIEAIFLKVQDAWDKHDLRALSESYGDNLYEKHEKILQKMSD
FT                   KGQINHTRSVVLDGIMRYKEVKDNQFEVDLYFVAIDYLVSVNSGQIIAGNTQERRAFKQ
FT                   RWTFSGQKGALRVEKMKEFKI"
FT   gene            604161..604436
FT                   /gene="ygaE"
FT                   /locus_tag="L4152"
FT   CDS             604161..604436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaE"
FT                   /locus_tag="L4152"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 33%
FT                   identical to a protein from Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L4152"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04714"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHV2"
FT                   /protein_id="AAK04714.1"
FT                   /translation="MILYLLVLLAVWNLIVFVFYAVDKYKAQHHLWRIPEKVLLAQALL
FT                   GGGTGAILAGHLCHHKTRKWYFNFSWYVGLLVDAGLIFLIIKFFAK"
FT   gene            604542..604718
FT                   /gene="ygaF"
FT                   /locus_tag="L4536"
FT   CDS             604542..604718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaF"
FT                   /locus_tag="L4536"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L4536"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04715"
FT                   /db_xref="InterPro:IPR021690"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHV1"
FT                   /protein_id="AAK04715.1"
FT                   /translation="MPKQRFYSFMIGTVLEAWIFSWSFLSASWFLATFFGFLLVRRIFL
FT                   AYRLDKFIRDMKM"
FT   gene            604822..605751
FT                   /gene="ptsK"
FT                   /locus_tag="L4822"
FT   CDS             604822..605751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsK"
FT                   /locus_tag="L4822"
FT                   /product="Hpr(Ser) kinase"
FT                   /db_xref="EnsemblGenomes-Gn:L4822"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04716"
FT                   /db_xref="GOA:Q9CHV0"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CHV0"
FT                   /protein_id="AAK04716.1"
FT                   /translation="MAVSVQDLLDKIHFHVIYSTETALQKEITTSEIMRPGLEMAGYFD
FT                   YFTPERIQLFGMKEWSYMMTVVGDNRYDLLKKVMAKETPVVIVARNLEIPSEMVAAAKK
FT                   SDIVLLQSREATSRLNSVLTSFLDERLAERTTVHGVLMDIFGVGVLIQGASGIGKSETG
FT                   LELVKRGHRLVADDRVDVFQRDAFTLSGEPAEILRNMIEIRGVGIIDVMSLFGAGAVKD
FT                   STDIDMAIYLEYYDKEKAFDRLGNAPTIVEFSDVEVPQTRIPVKTGRNVSVIVEAAVMN
FT                   FRAKQMGFDATKTFEDRLTDLISHNKES"
FT   gene            605815..606600
FT                   /gene="lgt"
FT                   /locus_tag="L5776"
FT   CDS             605815..606600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="L5776"
FT                   /product="prolipoprotein diacylglycerol transferase"
FT                   /db_xref="EnsemblGenomes-Gn:L5776"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04717"
FT                   /db_xref="GOA:Q9CHU9"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CHU9"
FT                   /protein_id="AAK04717.1"
FT                   /translation="MNNLFPFLALNKIALQLGPLAIHWYAIFIVGGAALAVWLACKEAP
FT                   KRNIKTDDIIDFVLFAFPLGIVGARLYYVIFQWSYYSQHPSQIIAMWDGGGAIYGSLIA
FT                   GAIVLFVFSYYRMIHPLDLLDITIPGVFLAQAMGRWGNFVNQEAYGKIVSNLDWLPAFI
FT                   RNQMFIDGHYRMPTFLFESIGTLSGFILVMVFRHRIKGLKRGDIFSFYLVWYGAVRFIV
FT                   EGMRTDSLMLGPARVSQWLSVLLVIVGLVLFIYRRMKKN"
FT   gene            606768..607187
FT                   /gene="ygaI"
FT                   /locus_tag="L6768"
FT   CDS             606768..607187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaI"
FT                   /locus_tag="L6768"
FT                   /product="conserved hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.02 HYPOTHETICAL.
FT                   Conserved. 35% identical to a tropomyosin-related protein
FT                   STRP from Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:L6768"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04718"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHU8"
FT                   /protein_id="AAK04718.1"
FT                   /translation="MGNIALLIIAIAFAVLVVFLVIVLHKVSKVVEEANRTVKLVSSDV
FT                   DVLLHQADGIMTKANTLLDDVNGKVATIDPLFTAVADLSESVSDINASSRKLVTRLNRG
FT                   STKRKTTSASAVVLAKTAKKFFVKKDKTEAGVKVN"
FT   gene            607217..607780
FT                   /gene="ygaJ"
FT                   /locus_tag="L7226"
FT   CDS             607217..607780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaJ"
FT                   /locus_tag="L7226"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General.
FT                   homologs not detected in Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L7226"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04719"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHU7"
FT                   /protein_id="AAK04719.1"
FT                   /translation="MSKKTGFLVGALVGAAAALFLAPKKGSELREGAGKIYDDLKENPQ
FT                   ETLTGMRDTALDFSAEKFNDIKEKFDSGEISADKAKEFLLSKRDLIMEKVDSGELSKDS
FT                   VVDFFNDTKDAVVEKINSMKDSGEELFDENESDISEEAAEVVAKFRDAKDEVKEDIDTE
FT                   SLAEEAKKIADKAKELTNFPDEKE"
FT   gene            607913..609331
FT                   /gene="gnd"
FT                   /locus_tag="L0046"
FT   CDS             607913..609331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="L0046"
FT                   /product="decarboxylating 6-phosphogluconate dehydrogenase"
FT                   /EC_number="1.1.1.44"
FT                   /note="EVIDENCE BY HOMOLOGY BIO06.10 Pentose phosphate
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:L0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04720"
FT                   /db_xref="GOA:Q9CHU6"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012284"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CHU6"
FT                   /protein_id="AAK04720.1"
FT                   /translation="MAQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVYKE
FT                   HQDKNLVLTKTLEEFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDKGDILIDGGNTH
FT                   FPDTMRRNAELADSGINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKA
FT                   PQDGKPCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESYDLLKRVLGLSNAEIQAIFEE
FT                   WNEGELDSYLIEITKEVLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPL
FT                   ITESVFARYISTYKDERVKASKVLSGPAVNFSGDKKEVIEKIRKALYFSKIMSYAQGFA
FT                   QLRKASEEFDWDLPYGTIAQIWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDIT
FT                   KRYQEAVRDVVSLAVQAGIPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERT
FT                   DKAGIFHYDWYTED"
FT   gene            609512..611524
FT                   /gene="kupA"
FT                   /locus_tag="L9458"
FT   CDS             609512..611524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kupA"
FT                   /locus_tag="L9458"
FT                   /product="potassium uptake protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.05 TRANSPORT AND BINDING
FT                   proteinS. Cations"
FT                   /db_xref="EnsemblGenomes-Gn:L9458"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04721"
FT                   /db_xref="GOA:Q9CHU5"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CHU5"
FT                   /protein_id="AAK04721.1"
FT                   /translation="MGYESNRSFNKATGAGFIIAMGIVYGDIGTSPLYTMESIVQGQGG
FT                   LERISETSIIGALSLIIWTLTLITTVKYVWIALKADNNHEGGIFSLFTLVRKYAKWLII
FT                   PAMIGGAALLSDGALTPAVTVTSAIEGLRSIPAFHEAFGQQQLPIVIITLAILAVLFLI
FT                   QRFGTSIVGKVFGPVMFIWFSFLGITGLINLFGDFSVLQAINPYWAIHLLLSPENKAGI
FT                   FVLGSVFLATTGAEALYSDLGHVGRGNIHVSWPFVKVCIILSYCGQGAWLLQNRGKSLG
FT                   DINPFFAVLPQNLIIFSVILATLAAIIASQALISGSFTLVSEAIRLKLLPRLRIFYPGE
FT                   TFGQLYIPAVNLGLWLAASFIVVYFQSSAHMEAAYGLAITVTMLMTTTLLTVYLSHYQK
FT                   VKKVLVGLFFTVFIFIEGLFFAASAVKFMHGGYVVVIIAAMILFVMAIWHKSDQLFYKY
FT                   LNSSNLNDYKEQMDKLRKDETYDLYHTNVVYLTAKMDKEWIDRSILYSILDKRPKKAKV
FT                   YWFVKVNVTDEPYTSEYEVDMLGTDFIVCVNLYLGFHMRQEIPRYLRTIVTNLMESGRL
FT                   PQQNQTYSITPGRKVGDFRFIILEEKLINARQMPGFERFVLQTKEQIKKITASPARWFG
FT                   LHFSEVTVETVPLVLSDVKNLEIHERISEENQGES"
FT   gene            611749..613764
FT                   /gene="kupB"
FT                   /locus_tag="L11749"
FT   CDS             611749..613764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kupB"
FT                   /locus_tag="L11749"
FT                   /product="potassium uptake protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO13.05 TRANSPORT AND BINDING
FT                   proteinS. Cations"
FT                   /db_xref="EnsemblGenomes-Gn:L11749"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04722"
FT                   /db_xref="GOA:Q9CHU4"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CHU4"
FT                   /protein_id="AAK04722.1"
FT                   /translation="MGQVHLHNRSFNKATSAGFLIALGIVYGDIGTSPLYAMQAIVRGQ
FT                   GGLANLSESFILGAVSLVIWTLTLITTVKYVLIALKADNHHEGGIFSLFTLVRRMRKWL
FT                   IIPAMIGGATLLADGALTPAVTVTSAIEGLRGVTHVYSNQTAVMVTTLIILAFLFLIQR
FT                   FGASLVGRLFGPIMFIWFGFLGVSGLINSFLDLSILKAINPYYAIHLLFSPENKAGFFI
FT                   LGSIFLVTTGAEALYSDLGHVGRGNIYVSWPFVKICIILSYCGQGAWLLAHRGEHIEKL
FT                   NPFFAVLPDNMVIYVVILSTLAAIIASQALISGSFTLVSEAIRLKLLPLFKIYYPGQTL
FT                   GQLYIPAVNFALWVTTSFFVLYFKTSEHMEAAYSLAITITMLMTTTLLTYFLIQKGTPK
FT                   IAIAIISIGLFCIEGSFFAASLVQFINGAYIVVLIALAIIFVMFIWNKSHKIVMKYIKS
FT                   LNINEYKNQLNALRHDESYDLYQTNVVYLTSKMDHEWIDRSILYSILDKRPKRAECYWF
FT                   VNVKVTDEPYTSEYKVDMMDTDFIVRVNLYLGFRMRQEVPRYLRTIVTDLMESGRLPRQ
FT                   HQHYSITPGRKVGDFRFVVVEEKLMNARQMPGFERFVLQTKAQIKRITASPIRWFGLQF
FT                   SEVTVETVPLVLSDVRNLEIHERLEQVDEAEASATH"
FT   gene            614196..614861
FT                   /gene="ygbB"
FT                   /locus_tag="L14190"
FT   CDS             614196..614861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygbB"
FT                   /locus_tag="L14190"
FT                   /product="hypothetical protein"
FT                   /note="EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL. General.
FT                   there are five paralogs in L.lactis. 30% identical to YqfU
FT                   of B.subtilis."
FT                   /db_xref="EnsemblGenomes-Gn:L14190"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04723"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHU3"
FT                   /protein_id="AAK04723.1"
FT                   /translation="MTIIGVKIDKKFMRDLLILILGVGLYVLSVQLFVIPNRLASNGVA
FT                   GFSVLMDFVFGINPALTFFLVNVPLFIFGGRSLPRRILLLSIPGALAMSGWLMIYEALG
FT                   VTGFQFSHVIFAGIFDGLLSGFGAGLVIISEGTFGGSILLSRILEEQWNFKIDKVLFMV
FT                   DVVVLSVSLLTFLSLPNFAVTLLSCYIFSKMTLIVGREDYRKSLMNRGKRIYQKVFAA"
FT   gene            614999..615883
FT                   /gene="miaA"
FT                   /locus_tag="L15012"
FT   CDS             614999..615883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="L15012"
FT                   /product="tRNA isopentenyltransferase"
FT                   /note="EVIDENCE BY HOMOLOGY BIO12.06 tRNA modification.
FT                   BIOSYNTHESIS OF THE MODIFIED BASE ISOPENTENYLADENOSINE IN
FT                   tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:L15012"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04724"
FT                   /db_xref="GOA:Q9CHU2"
FT                   /db_xref="InterPro:IPR002627"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CHU2"
FT                   /protein_id="AAK04724.1"
FT                   /translation="MKNNKVLVVVGPTAVGKTALGIDLAIKFNGEIISGDSQQVYQGLD
FT                   IGTAKVTMAEQAQVPHHLIDVRKWTENFSVHDFVIEANQLIKEILDQGKVPIIVGGTGL
FT                   YIQSLIEGYHLGGQENHEEMMKLREELSLLSDEELFAKVIKINPDISELNRRRAIRFLE
FT                   LQTFGSQDENLGSDYDFLLIGLNADRKVLYDRINQRVDQMMREGLLDEARTLYEQAPEV
FT                   QAAKGIGYKEFFPYFSGDISLEEAVELVKRNSRRYAKRQLTWFKNRMSVEFEDVFSKNY
FT                   PEPIFDKVTQFLN"
FT   gene            615966..616634
FT                   /gene="ygbD"
FT                   /locus_tag="L15964"
FT   CDS             615966..616634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygbD"
FT                   /locus_tag="L15964"
FT                   /product="unknown protein"
FT                   /note="EVIDENCE BY GENEMARK BIO16.01 UNKNOWN. General. 48%
FT                   identical to a protein from Streptococci."
FT                   /db_xref="EnsemblGenomes-Gn:L15964"
FT                   /db_xref="EnsemblGenomes-Tr:AAK04725"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CHU1"
FT                   /protein_id="AAK04725.1"
FT                   /translation="MTDKKWIDLG