spacer

EBI Dbfetch

ID   ABF21292; SV 1; linear; genomic RNA; STD; VRL; 1497 BP.
XX
PA   DQ508906.1
XX
DT   04-MAY-2006 (Rel. 87, Created)
DT   04-MAY-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Influenza A virus (A/Wilson-Smith/1933(H1N1)) nucleocapsid protein
XX
KW   .
XX
OS   Influenza A virus (A/Wilson-Smith/1933(H1N1))
OC   Viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A.
XX
RN   [1]
RP   1-1497
RA   Mbawuike I.N., Zhang Y., Yamada R.E., Nino D., Bui H.-H., Sette A.,
RA   Couch R.B.;
RT   "Complete Genome Sequencing And Analysis Of Selected Influenza Virus
RT   Vaccine Strains Spanning Six Decades (1933-1999)";
RL   Unpublished.
XX
RN   [2]
RP   1-1497
RA   Mbawuike I.N., Zhang Y., Yamada R.E., Nino D., Bui H.-H., Sette A.,
RA   Couch R.B.;
RT   ;
RL   Submitted (21-APR-2006) to the INSDC.
RL   Influenza Research Center, Viral Respiratory Pathogens Research Unit,
RL   Department of Molecular Virology and Microbiology, Baylor College of
RL   Medicine, One Baylor Plaza, Houston, TX 77030, USA
XX
DR   MD5; 7492342131e4f839ff61f821416d6698.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1497
FT                   /organism="Influenza A virus (A/Wilson-Smith/1933(H1N1))"
FT                   /strain="A/Wilson-Smith/1933"
FT                   /serotype="H1N1"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:381518"
FT   CDS             DQ508906.1:1..1497
FT                   /codon_start=1
FT                   /gene="NP"
FT                   /product="nucleocapsid protein"
FT                   /db_xref="GOA:Q1K9H2"
FT                   /db_xref="InterPro:IPR002141"
FT                   /db_xref="PDB:2IQH"
FT                   /db_xref="PDB:3RO5"
FT                   /db_xref="PDB:3TG6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1K9H2"
FT                   /protein_id="ABF21292.1"
FT                   /translation="MATKGTKRSYEQMETDGERQNATEIRASVGKMIDGIGRFYIQMCT
FT                   ELKLSDYEGRLIQNSLTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKW
FT                   RRELILYDKEEIRRIWRQANNGDDATAGLTHMMIWHSNLNDATYQRTRALVRTGMDPRM
FT                   CSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINDRNFWRGENGRRTRIAYERM
FT                   CNILKGKFQTAAQRTMVDQVRESRNPGNAEFEDLIFLARSALILRGSVAHKSCLPACVY
FT                   GSAVASGYDFEREGYSLVGIDPFRLLQNSQVYSLIRPNENPAHKSQLVWMACHSAAFED
FT                   LRVSSFIRGTKVVPRGKLSTRGVQIASNENMETMESSTLELRSRYWAIRTRSGGNTNQQ
FT                   RASSGQISIQPTFSVQRNLPFDRPTIMAAFTGNTEGRTSDMRTEIIRLMESARPEDVSF
FT                   QGRGVFELSDEKATSPIVPSFDMSNEGSYFFGDNAEEYDN"
XX
SQ   Sequence 1497 BP; 483 A; 302 C; 395 G; 317 T; 0 other;
     atggcgacca aaggcaccaa acgatcttac gaacagatgg agactgatgg agaacgccag        60
     aatgccactg aaatcagagc atctgtcgga aaaatgattg atggaattgg acgattctac       120
     atccaaatgt gcaccgaact taaactcagt gattatgagg gacggctgat tcagaacagc       180
     ttaacaatag agagaatggt gctctctgct tttgacgaga ggaggaataa atatctagaa       240
     gaacatccca gtgcggggaa agatcctaag aaaactggag gacctatata caggagagta       300
     gatggaaagt ggaggagaga actcatcctt tatgacaaag aagaaataag acgaatctgg       360
     cgccaagcta ataatggtga cgatgcaacg gctggtctga ctcacatgat gatctggcac       420
     tccaatttga atgatgcaac ttaccagagg acaagagctc ttgttcgcac aggaatggat       480
     cccaggatgt gctcactgat gcagggttca accctcccta ggaggtctgg ggccgcaggt       540
     gctgcagtca aaggagttgg aacaatggtg atggaattga tcagaatgat caaacgtggg       600
     atcaatgatc ggaacttctg gaggggtgag aatggacgga gaacaaggat tgcttatgaa       660
     agaatgtgca acattctcaa agggaaattt caaacagctg cacaaagaac aatggtggat       720
     caagtgagag agagccggaa tccaggaaat gctgagttcg aagatctcat ctttttagca       780
     cggtctgcac tcatattgag agggtcagtt gctcacaagt cctgcctgcc tgcctgtgtg       840
     tatggatctg ccgtagccag tggatacgac tttgaaagag agggatactc tctagtcgga       900
     atagaccctt tcagactgct tcaaaacagc caagtataca gcctaatcag accaaatgag       960
     aatccagcac acaagagtca actggtgtgg atggcatgcc attctgctgc atttgaagat      1020
     ctaagagtat caagcttcat cagagggacg aaagtggtcc caagagggaa gctttccact      1080
     agaggagttc aaattgcttc caatgaaaac atggagacta tggaatcaag tacccttgaa      1140
     ctgagaagca gatactgggc cataaggacc agaagtggag ggaacaccaa tcaacagagg      1200
     gcttcctcgg gccaaatcag catacaacct acgttctcag tacagagaaa tctccctttt      1260
     gacagaccaa ccattatggc agcattcact gggaatacag aggggagaac atctgacatg      1320
     agaaccgaaa tcataaggct gatggaaagt gcaagaccag aagatgtgtc tttccagggg      1380
     cggggagtct tcgagctctc ggacgaaaag gcaacgagcc cgatcgtgcc ctcctttgac      1440
     atgagtaatg aaggatctta tttcttcgga gacaatgcag aggagtacga caattaa         1497
//


spacer
spacer