Dbfetch

ID   AB763379; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB763379;
XX
DT   22-NOV-2012 (Rel. 114, Created)
DT   22-NOV-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds, allele:
DE   HLA-JMDP-R-022.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Shimizu M., Nakajima F.;
RT   ;
RL   Submitted (19-NOV-2012) to the INSDC.
RL   Contact:Marie Shimizu Japanese Red Cross Society, Central Blood Institute;
RL   Tatsumi 2-1-67, Koto-ku, Tokyo 135-8521, Japan E-mail :ma-shimizu@jrc.or.jp
RL   Fax    :81-3-5534-7519
XX
RN   [2]
RA   Shimizu M.;
RT   "HLA-JMDP-R-022";
RL   Unpublished.
XX
DR   MD5; e0649485675a9d56e7516a1d7f3645aa.
DR   IMGT/HLA; DRB1*04:05:16; HLA08957.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*02:01/A*24:02,B*51:01/B*59:01,C*01:02/
FT                   C*15:02,DRB1*JMDP-R-022/DRB1*12:01,JMDP36K0186"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-JMDP-R-022"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:K7ZN81"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:K7ZN81"
FT                   /protein_id="BAM67055.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 60 A; 66 C; 97 G; 47 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggaatacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//