spacer

EBI Dbfetch

ID   AB746911; SV 1; linear; genomic DNA; STD; HUM; 3155 BP.
XX
AC   AB746911;
XX
DT   02-MAY-2013 (Rel. 116, Created)
DT   25-APR-2014 (Rel. 120, Last updated, Version 2)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, complete cds, allele:
DE   HLA-B*39:01.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3155
RA   Miyazono T., Michino J.;
RT   ;
RL   Submitted (06-SEP-2012) to the INSDC.
RL   Contact:Takayoshi Miyazono Graduate School of Medicine and Pharmaceutical
RL   Science, Toyama University, Department of Gastroenterology and Hematology;
RL   2630 Sugitani, Toyama-shi, Toyama 930-0194, Japan URL   
RL   :http://www.hosp.u-toyama.ac.jp/guide/index.html
XX
RN   [2]
RC   DOI:10.1111/tan.12175
RX   DOI; 10.1111/tan.12175.
RX   PUBMED; 24032727.
RA   Miyazono T., Shiina T., Michino J., Yasumura S., Sugiyama T.;
RT   "A novel HLA-B allele, HLA-B*39:01:16, identified by super high-resolution
RT   single-molecule sequence-based typing in a Japanese individual";
RL   Tissue Antigens 82(3):205-206(2013).
XX
DR   MD5; cb333cf3f06cf66b86f11654c941690f.
DR   IMGT/HLA; B*39:01:16; HLA09085.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3155
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(285..357,486..755,1002..1277,1850..2125,2219..2335,
FT                   2777..2809,2916..2959)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39:01"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q549W0"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q549W0"
FT                   /protein_id="BAN17709.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 3155 BP; 590 A; 921 C; 996 G; 648 T; 0 other;
     gatcaggacg aagtcccagg tcccggacgg ggctctcagg gtctcaggct ccgagggccg        60
     cgtctgcaat ggggaggcgc agcgttgggg attccccact cccctgagtt tcacttcttc       120
     tcccaacttg tgtcgggtcc ttcttccagg atactcgtga cgcatcccca cttcccactc       180
     ccattgggtg tcggatatct agagaagcca atcagcgtcg ccggggtccc agttctaaag       240
     tccccacgca cccacccgga ctcagagtct cctcagacgc cgagatgctg gtcatggcgc       300
     cccgaaccgt cctcctgctg ctctcggcgg ccctggccct gaccgagacc tgggccggtg       360
     agtgcgggtc gggagggaaa tggcctctgc cgggaggagc gaggggaccg caggcggggg       420
     cgcaggacct gaggagccgc gccgggagga gggtcgggcg ggtctcagcc cctcctcgcc       480
     cccaggctcc cactccatga ggtatttcta cacctccgtg tcccggcccg gccgcgggga       540
     gccccgcttc atctcagtgg gctacgtgga cgacacgcag ttcgtgaggt tcgacagcga       600
     cgccgcgagt ccgagagagg agccgcgggc gccgtggata gagcaggagg ggccggaata       660
     ttgggaccgg aacacacaga tctgcaagac caacacacag actgaccgag agagcctgcg       720
     gaacctgcgc ggctactaca accagagcga ggccggtgag tgaccccggc ccggggcgca       780
     ggtcacgact ccccatcccc cacgtacggc ccgggtcgcc ccgagtctcc gggtccgaga       840
     tccgcctccc tgaggccgcg ggacccgccc agaccctcga ccggcgagag ccccaggcgc       900
     gtttacccgg tttcattttc agttgaggcc aaaatccccg cgggttggtc ggggcggggc       960
     ggggctcggg gggacggggc tgaccgcggg gccggggcca gggtctcaca ccctccagag      1020
     gatgtacggc tgcgacgtgg ggccggacgg gcgcctcctc cgcgggcata accagtttgc      1080
     ctacgacggc aaggattaca tcgccctgaa cgaggacctg agctcctgga ccgcggcgga      1140
     caccgcggct cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagctgag      1200
     aacctacctg gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga      1260
     gacgctgcag cgcgcgggta ccaggggcag tggggagcct tccccatctc ctataggtcg      1320
     ccggggatgg cctccaacga gaagaagagg aaaatgggat cagcgctaga atgtcgccct      1380
     cccttgaatg gagaatggca tgagttttcc tgagtttcct ctgagggccc cctcttctct      1440
     ctaggacaat taagggatga cgtctctgag gaaatggagg ggaagacagt ccctagaata      1500
     ctgatcaggg gtcccctttg acccctgcag cagccttggg aaccatgact tttcctctca      1560
     ggccttgttc tctgcctcac actcagtgtg tttggggctc tgattccagc acttctgagt      1620
     cactttacct ccactcagat caggagcaga agtctctgtt ccccgctcag agactcgaac      1680
     tttccaatga atagattatc ccaggtgcct gcgtccaggc tggtgtctgg gttctgtgcc      1740
     ccttccccac cccaggtgtc ctgtccattc tcaggctggt cacatgggtg gtcctagggt      1800
     gtcccatgag agatgcaaag cgcctgaatt ttctgactct tcccatcaga ccccccaaag      1860
     acacatgtga cccaccaccc catctctgac catgaggcca ccctgaggtg ctgggccctg      1920
     ggcttctacc ctgcggagat cacactgacc tggcagcggg atggcgagga ccaaactcag      1980
     gacaccgagc ttgtggagac cagaccagca ggagacagaa ccttccagaa gtgggcagct      2040
     gtggtggtgc cttctggaga agagcagaga tacacatgcc atgtacagca tgaggggctg      2100
     ccgaagcccc tcaccctgag atggggtaag gagggggatg aggggtcata tctcttctca      2160
     gggaaagcag gagcccttca gcagggtcag ggcccctcat cttcccctcc tttcccagag      2220
     ccatcttccc agtccaccgt ccccatcgtg ggcattgttg ctggcctggc tgtcctagca      2280
     gttgtggtca tcggagctgt ggtcgctgct gtgatgtgta ggaggaagag ctcaggtagg      2340
     gaaggggtga ggggtggggt ctgggttttc ttgtcccact gggggtttca agccccaggt      2400
     agaagtgttc cctgcatcat tactgggaag cagcatgcac acaggggcta acgcagcctg      2460
     ggaccctgtg tgccagcact tactcttttg tgcagcacat gtgacaatga aggacggatg      2520
     tatcaccttg atggttgtgg tgttggggtc ctgattccag cattcatgag tcaggggaag      2580
     gtccctgcta aggacagacc ttaggagggc agttggtcca ggacccacac ttgctttcct      2640
     cgtgtttcct gatcctgccc tgggtctgta gtcatacttc tggaaattcc ttttgggtcc      2700
     aagactagga ggttcctcta agatctcatg gccctgcttc ctcccagtcc cctcacagga      2760
     cattttcttc ccacaggtgg aaaaggaggg agctactctc aggctgcgtg taagtggtgg      2820
     gggtgggagt gtggaggagc tcacccaccc cataattcct cctgtcccac gtctcctgtg      2880
     ggctctgacc aggtcctgtt tttgttctac tccagccagc gacagtgccc agggctctga      2940
     tgtgtctctc acagcttgaa aaggtgagat tcttggggtc tagagtgggc gggggggcgg      3000
     ggagggggca gaggggaaag gcctgggtaa tggagattct ttgattggga tgtttcgcgt      3060
     gtgtgatggg ctgttcagag tgtcatcact taccatgact aaccagaatt tgttcatgac      3120
     tgttgttttc tgtagcctga gacagctgtc ttgtg                                 3155
//


spacer
spacer