spacer

EBI Dbfetch

ID   AB735460; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   AB735460;
XX
DT   15-JUL-2012 (Rel. 113, Created)
DT   15-JUL-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, partial cds, allele:
DE   HLA-JMDP-C-020.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RA   Shimizu M., Nakajima F., Tadokoro K.;
RT   ;
RL   Submitted (12-JUL-2012) to the INSDC.
RL   Contact:Marie Shimizu Japanese Red Cross Society, Central Blood Institute;
RL   Tatsumi 2-1-67, Koto-ku, Tokyo 135-8521, Japan E-mail :ma-shimizu@jrc.or.jp
XX
RN   [2]
RA   Shimizu M., Nakajima F., Tadokoro K.;
RT   "HLA-JMDP-C-020";
RL   Unpublished.
XX
DR   MD5; 48bd14f305dad1cc600dec3a0925b997.
DR   IMGT/HLA; C*07:265; HLA08418.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*24:02/A*26:01,B*07:02/B*51:01,C*JMDP-C-020/
FT                   C*15:02,DRB1*01:01/DRB1*15:01,JMDP01K0136"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-JMDP-C-020"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:I7GYF8"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:I7GYF8"
FT                   /protein_id="BAM29372.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAAREAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSW"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   gap             647..746
FT                   /estimated_length=unknown
XX
SQ   Sequence 1022 BP; 168 A; 260 C; 284 G; 110 T; 200 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtctggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagttg       540
     gaggcggccc gtgaggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcagnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaacc cccaaagaca cacgtgaccc accaccccct       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gggaggacca gacccaggac accgagcttg tggagaccag       900
     gccagcagga gatggaacct tccagaagtg ggcagctgtg gtggtgcctt ctggacaaga       960
     gcagagatac acgtgccata tgcagcacga ggggctgcaa gagcccctca ccctgagctg      1020
     gg                                                                     1022
//


spacer
spacer