Dbfetch

ID   AB720880; SV 1; linear; genomic DNA; STD; HUM; 2155 BP.
XX
AC   AB720880;
XX
DT   22-MAY-2012 (Rel. 112, Created)
DT   30-JUL-2013 (Rel. 117, Last updated, Version 2)
XX
DE   Homo sapiens HLA-B gene for MHC classI antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2155
RA   Kikkawa E., Ohgiya D., Murayama H., Machida S., Onizuka M., Inoko H.;
RT   ;
RL   Submitted (15-MAY-2012) to the INSDC.
RL   Contact:Eri Kikkawa Tokai University School of Medicine, Basic Medical
RL   Science and Molecular Medicine, Department of Hematology and Oncology;
RL   Shimokasuya 143, Isehara, Kanagawa 259-1193, Japan
XX
RN   [2]
RA   Kikkawa E., Ohgiya D., Murayama H., Machida S., Onizuka M., Inoko H.;
RT   "New allele of HLA-B";
RL   Unpublished.
XX
DR   MD5; 1483189129def92798caa97581124a18.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2155
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Kanagawa, Isehara"
FT                   /collection_date="Mar-2012"
FT                   /sex="man"
FT                   /clone="Maru-B"
FT                   /db_xref="taxon:9606"
FT   CDS             join(85..157,287..556,801..1076,1652..1927,2021..>2137)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /product="MHC classI antigen"
FT                   /note="B*40:02 variant"
FT                   /db_xref="GOA:I4DCY7"
FT                   /db_xref="IMGT/HLA:B*40:214"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:I4DCY7"
FT                   /protein_id="BAM15777.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEEEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSS"
XX
SQ   Sequence 2155 BP; 407 A; 663 C; 708 G; 377 T; 0 other;
     agagaagcca atcagtgtcg ccggggtccc agttctaaag tccccacgca cccacccgga        60
     ctcagaatct cctcagacgc cgagatgcgg gtcacggcgc cccgaaccct cctcctgctg       120
     ctctgggggg cagtggccct gaccgagacc tgggctggtg agtgcggggt cggcagggaa       180
     atggcctctg tggggaggag cgaggggacc gcaggcgggg gcgcaggacc cggggagccg       240
     cgccgggagg agggtcgggc gggtctcagc ccctcctcgc ccccaggctc ccactccatg       300
     aggtatttcc acacctccgt gtcccggccc ggccgcgggg agccccgctt catcaccgtg       360
     ggctacgtgg acgacacgct gttcgtgagg ttcgacagcg acgccacgag tccgaggaag       420
     gagccgcggg cgccatggat agaggaggag gggccggagt attgggaccg ggagacacag       480
     atctccaaga ccaacacaca gacttaccga gagagcctgc ggaacctgcg cggctactac       540
     aaccagagcg aggccggtga gtgaccccgg cccggggcgc aggtcacgac tccccatccc       600
     ccacgtacgg cccgggtcgc cccgagtctc cgggtccgag atccgccccc gaggccgcgg       660
     gacccgccca gaccctcgac cggcgagagc cccaggcgcg tttacccggt ttcattttca       720
     gttgaggcca aaatccccgc gggttggtcg gggcggggcg gggctcgggg ggacggggct       780
     gaccgcgggg gcggggccag ggtctcacac cctccagagc atgtacggct gcgacgtggg       840
     gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca aggattacat       900
     cgccctgaac gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca       960
     gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcgagtg      1020
     cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgggtac      1080
     caggggcagt ggggagcctt ccccatctcc tataggtcgc cggggatggc ctcccacgag      1140
     aagaggagga aaatgggatc agcgctagaa tgtcgccctc ccttgaatgg agaatggcat      1200
     gagttttcct gagtttcctc tgagggcccc ctcttctctc taggacaatt aagggatgac      1260
     gtctctgagg aaatggaggg gaagacagtc cctagaatac tgatcagggg tcccctttga      1320
     cccctgcagc agccttggga accgtgactt ttcctctcag gccttgttct ctgcctcaca      1380
     ctcagtgtgt ttggggctct gattccagca cttctgagtc actttacctc cactcagatc      1440
     aggagcagaa gtccctgttc cccgctcaga gactcgaact ttccaatgaa taggagatta      1500
     tcccaggtgc ctgcgtccag gctggtgtct gggttctgtg ccccttcccc accccaggtg      1560
     tcctgtccat tctcaggctg gtcacatggg tggtcctagg gtgtcccatg agagatgcaa      1620
     agcgcctgaa ttttctgact cttcccatca gaccccccaa agacacacgt gacccaccac      1680
     cccatctctg accatgaggc caccctgagg tgctgggccc tgggcttcta ccctgcggag      1740
     atcacactga cctggcagcg ggatggcgag gaccaaactc aggacactga gcttgtggag      1800
     accagaccag caggagatag aaccttccag aagtgggcag ctgtggtggt gccttctgga      1860
     gaagagcaga gatacacatg ccatgtacag catgaggggc tgccgaagcc cctcaccctg      1920
     agatggggta aggaggggga tgaggggtca tatctcttct cagggaaagc aggagccctt      1980
     cagcagggtc agggcccctc atcttccctt cctttcccag agccgtcttc ccagtccacc      2040
     gtccccatcg tgggcattgt tgctggcctg gctgtcctag cagttgtggt catcggagct      2100
     gtggtcgctg ctgtgatgtg taggaggaag agctcaggta gggaaggggt gaggg           2155
//