Dbfetch

ID   AB720029; SV 1; linear; genomic DNA; STD; HUM; 1712 BP.
XX
AC   AB720029;
XX
DT   13-MAY-2012 (Rel. 112, Created)
DT   30-JUL-2013 (Rel. 117, Last updated, Version 2)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1712
RA   Kikkawa E., Shigenari A., Sugimoto T., Tuchida F., Nakashioya C., Sato K.,
RA   Kato S., Inoko H.;
RT   ;
RL   Submitted (10-MAY-2012) to the INSDC.
RL   Contact:Eri Kikkawa Tokai University School of Medicine, Basic Medical
RL   Science and Molecular Medicine; Shimokasuya 143, Isehara, Kanagawa
RL   259-1193, Japan
XX
RN   [2]
RA   Kikkawa E., Shigenari A., Sugimoto T., Tuchida F., Nakashioya C., Sato K.,
RA   Kato S., Inoko H.;
RT   "New allele of HLA-B";
RL   Unpublished.
XX
DR   MD5; 64575d281341126e130b3b99f2dbc57c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1712
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Kanagawa"
FT                   /collection_date="2010"
FT                   /clone="20101587CB, 20101587M"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(224..296,425..694,941..>1216)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-B*39:01:01 variant"
FT                   /db_xref="IMGT/HLA:B*39:01:14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:I2FK81"
FT                   /protein_id="BAM15566.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRA"
XX
SQ   Sequence 1712 BP; 309 A; 551 C; 547 G; 305 T; 0 other;
     gtctgcaatg gggaggcgca gcgttgggga ttccccactc ccctgagttt cacttcttct        60
     cccaacttgt gtcgggtcct tcttccagga tactcgtgac gcatccccac ttcccactcc       120
     cattgggtgt cggatatcta gagaagccaa tcagcgtcgc cggggtccca gttctaaagt       180
     ccccacgcac ccacccggac tcagagtctc ctcagacgcc gagatgctgg tcatggcgcc       240
     ccgaaccgtc ctcctgctgc tctcggcggc cctggccctg accgagacct gggccggtga       300
     gtgcgggtcg ggagggaaat ggcctctgcc gggaggagcg aggggaccgc aggcgggggc       360
     gcaggacctg aggagccgcg ccgggaggag ggtcgggcgg gtctcagccc ctcctcgccc       420
     ccaggctccc actccatgag gtatttctac acctccgtgt cccggcccgg ccgcggggag       480
     ccccgcttca tctcagtggg ctacgtggac gacacccagt tcgtgaggtt cgacagcgac       540
     gccgcgagtc cgagagagga gccgcgggcg ccgtggatag agcaggaggg gccggaatat       600
     tgggaccgga acacacagat ctgcaagacc aacacacaga ctgaccgaga gagcctgcgg       660
     aacctgcgcg gctactacaa ccagagcgag gccggtgagt gaccccggcc cggggcgcag       720
     gtcacgactc cccatccccc acgtacggcc cgggtcgccc cgagtctccg ggtccgagat       780
     ccgcctccct gaggccgcgg gacccgccca gaccctcgac cggcgagagc cccaggcgcg       840
     tttacccggt ttcattttca gttgaggcca aaatccccgc gggttggtcg gggcggggcg       900
     gggctcgggg ggacggggct gaccgcgggg ccggggccag ggtctcacac cctccagagg       960
     atgtacggct gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagttcgcc      1020
     tacgacggca aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac      1080
     accgcggctc agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga      1140
     acctacctgg agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag      1200
     acgctgcagc gcgcgggtac caggggcagt ggggagcctt ccccatctcc tataggtcgc      1260
     cggggatggc ctccaacgag aagaagagga aaatgggatc agcgctagaa tgtcgccctc      1320
     ccttgaatgg agaatggcat gagttttcct gagtttcctc tgagggcccc ctcttctctc      1380
     taggacaatt aagggatgac gtctctgagg aaatggaggg gaagacagtc cctagaatac      1440
     tgatcagggg tcccctttga cccctgcagc agccttggga accatgactt ttcctctcag      1500
     gccttgttct ctgcctcaca ctcagtgtgt ttggggctct gattccagca cttctgagtc      1560
     actttacctc cactcagatc aggagcagaa gtctctgttc cccgctcaga gactcgaact      1620
     ttccaatgaa tagattatcc caggtgcctg cgtccaggct ggtgtctggg ttctgtgccc      1680
     cttccccacc ccaggtgtcc tgtccattct ca                                    1712
//