Dbfetch

ID   AB710180; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB710180;
XX
DT   10-JUL-2012 (Rel. 113, Created)
DT   09-APR-2014 (Rel. 120, Last updated, Version 2)
XX
DE   Homo sapiens HLA-DQB1 gene for MHC class II antigen, partial cds, exon 2.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Oka S., Furukawa H., Tohma S.;
RT   ;
RL   Submitted (03-APR-2012) to the INSDC.
RL   Contact:Hiroshi Furukawa Sagamihara Hospital, National Hospital
RL   Organization, Clinical Research Center for Allergy and Rheumatology; 18-1
RL   Sakuradai, Minami-ku, Sagamihara 252-0392, Japan
XX
RN   [2]
RC   DOI:10.1111/j.1399-0039.2012.01921.x
RX   DOI; 10.1111/j.1399-0039.2012.01921.x.
RX   PUBMED; 22762268.
RA   Oka S., Furukawa H., Kashiwase K., Tsuchiya N., Tohma S.;
RT   "Identification of a novel HLA allele, HLA-DQB1*06:51, in a Japanese
RT   rheumatoid arthritis patient";
RL   Tissue Antigens 80(4):386-387(2012).
XX
DR   MD5; 9a04ca8f30584ef057f0eaa58e417b98.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06:51"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:I7H3Z5"
FT                   /db_xref="IMGT/HLA:DQB1*06:51:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I7H3Z5"
FT                   /protein_id="BAM28991.1"
FT                   /translation="DFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKDILERTRAELDTVCRHNYEVAFRGILQRR"
XX
SQ   Sequence 270 BP; 60 A; 67 C; 97 G; 46 T; 0 other;
     aggatttcgt gttccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtgac cagatacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtaccg cgcggtgacg ccgcaggggc ggcctgacgc cgagtactgg aacagccaga       180
     aggacatcct ggagaggacc cgagcggagt tggacacggt gtgcagacac aactacgagg       240
     tggcgttccg cgggatcttg cagaggagag                                        270
//