spacer

EBI Dbfetch

ID   AB679918; SV 1; linear; genomic DNA; STD; HUM; 3354 BP.
XX
AC   AB679918;
XX
DT   12-NOV-2012 (Rel. 114, Created)
DT   12-NOV-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, complete cds, allele:
DE   HLA-C*07:02:01:05.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3354
RA   Suzuki S., Shiina T.;
RT   ;
RL   Submitted (09-NOV-2011) to the INSDC.
RL   Contact:Shingo Suzuki Tokai University School of Medicine, Department of
RL   Molecular Life Science; 143 Shimokasuya, Isehara-shi, Kanagawa 2591193,
RL   Japan
XX
RN   [2]
RA   Suzuki S., Ozaki Y., Kikkawa E., Shigenari A., Oka A., Mitunaga S.,
RA   Shiina T., Inoko H.;
RT   "Development of the Super high resolution Single molecule - Sequence Based
RT   Typing (SS-SBT) method for HLA class I genes";
RL   Unpublished.
XX
DR   MD5; 00709b8f2f15aa3aa482a992d1d87b60.
DR   Ensembl-Gn; ENSG00000204525; homo_sapiens.
DR   Ensembl-Tr; ENST00000376228; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3354
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(281..353,484..753,1004..1279,1867..2142,2267..2386,
FT                   2827..2859,2967..3014,3179..3183)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07:02:01:05"
FT                   /product="MHC class I antigen"
FT                   /note="glycoprotein; major histocompatibility complex class
FT                   I; human leukocyte antigen"
FT                   /db_xref="GOA:Q6R739"
FT                   /db_xref="IMGT/HLA:C*07:02:01:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6R739"
FT                   /protein_id="BAM66326.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQAACSNSAQGSDESLITCKA"
XX
SQ   Sequence 3354 BP; 620 A; 992 C; 1043 G; 699 T; 0 other;
     gatcaggacg aagtcccagg tcccgggcgg ggctctcagg gtctcaggct ccaagggccg        60
     tgtctgcatt ggggaggcgc cgcgttgggg attctccact cccctgagtt tcacttctcc       120
     caacctgcgt cgggtccttc ttcctgaata ctcatgacgc gtccccaatt cccactccca       180
     ttgggtgtcg ggttctagag aagccaatca gcgtctccgc agtcccggtt ctaaagtccc       240
     cagtcaccca cccggactca cattctcccc agaggccgag atgcgggtca tggcgccccg       300
     agccctcctc ctgctgctct cgggaggcct ggccctgacc gagacctggg cctgtgagtg       360
     cggggttggg agggaagcgg cctctgcgga gaggagcgag gggccctccc ggcgagggcg       420
     caggacccgg ggagccgcgc agggaggtgg gtcgggcggg tctcagcccc tcctcgcccc       480
     caggctccca ctccatgagg tatttcgaca ccgccgtgtc ccggcccggc cgcggagagc       540
     cccgcttcat ctcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg       600
     ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg ccggagtatt       660
     gggaccggga gacacagaag tacaagcgcc aggcacaggc tgaccgagtg agcctgcgga       720
     acctgcgcgg ctactacaac cagagcgagg acggtgagtg accccggccc ggggcgcagg       780
     tcacgacccc tccccatccc ccacggacgg cccgggtcgc ctagagtctc cccgtctgag       840
     atccacccca aggtggatct gcggaacccg cccagaccct cgaccggaga gagccccagt       900
     cgcctttacc cggtttcatt ttcggtttag gccaaaatcc ccgcgggttg gtcggggcgg       960
     ggcggggctc gggggactgg gctgaccgcg ggggcggggc cagggtctca caccctccag      1020
     aggatgtctg gctgcgacct ggggcccgac gggcgcctcc tccgcgggta tgaccagtcc      1080
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg      1140
     gacaccgcgg ctcagatcac ccagcgcaag ttggaggcgg cccgtgcggc ggagcagctg      1200
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag      1260
     gagacgctgc agcgcgcagg taccaggggc agtggggagc cttccccatc tcctatagat      1320
     ctcccgggat ggcctcccac gaggagggga ggaaaatggg atcagcactg gaatatcgcc      1380
     ctcccttgaa tggagaatgg catgagtttt cctgagtttc ctctgagggc cccctctgct      1440
     ctctaggaca attaagggat gaagtctctg aggaaatgga ggggaagaca gtccctggaa      1500
     tactgatcag gggtctcctt tgaccacttt gaccactgca gcagctgtgg tcaggctgct      1560
     gacctttctc tcaggccttg ttctctgcct cacactcaat gtgtctgaag gtttgattcc      1620
     agcttttctg agtcctgcag cctccactca ggtcaggacc agaagtcgct gttcctccct      1680
     cagagactag aactttccaa tgaataggag attatcccag gtgcctgtgt ccaggctggc      1740
     gtctgggttc tgtgccgcct tccccacccc aggtgtcctg tccattctca ggatggtcac      1800
     atgggcgctg ctggagtgtc ccaagagaga tgcaaagtgt ctgaattttc tgactcttcc      1860
     cgtcagaacc cccaaagaca cacgtgaccc accaccccct ctctgaccat gaggccaccc      1920
     tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg      1980
     gggaggacca gacccaggac accgagcttg tggagaccag gccagcagga gatggaacct      2040
     tccagaagtg ggcagctgtg gtggtgcctt ctggacaaga gcagagatac acgtgccata      2100
     tgcagcacga ggggctgcaa gagcccctca ccctgagctg gggtaaggag gggaatgggg      2160
     ggtcacatct cttatcagag aaagcagaag tccttctgga gcccttcagc cgggtcaggg      2220
     ctgaggcttg ggggtcaggg cccctcacct tctcctcctt tcccagagcc atcttcccag      2280
     cccaccatcc ccatcatggg catcgttgct ggcctggctg tcctggttgt cctagctgtc      2340
     cttggagctg tggtcaccgc tatgatgtgt aggaggaaga gctcaggtag ggaaggggtg      2400
     aagagcgggg tctgggtttt cttgtcccac tgggagtttc aagccccagg tagaagtgtg      2460
     ccccgccttg ttactggaag caccatccac acatgggcca tcccagcctg ggaccctgtg      2520
     tgccagcact tactcttttg tgaagcacat gtgacaatga aggacggatg tatcaccttg      2580
     atgattatgg tgttggggtc ctgattccag cattcatgag tcaggggaag gtccctgcta      2640
     aggacagacc ttaggagggc agttggtcca gaacccacaa ctgctttccc catgtttcct      2700
     gatcctgccc tgggtctgca gtcgtagttc tggaaacttc tcttgggtcc aagactagga      2760
     ggttccccta agatcacatg gccctgcctc ctcccagtcc cctcataggg cattttcttc      2820
     ccacaggtgg aaaaggaggg agctgctctc aggctgcgtg taagtgatgg cggcgggcgt      2880
     gtggaggagc tcacctactc cataattcct cttgtcccac atctcctgcg ggctctgacc      2940
     aggtcttttt ttttgttcta ccccaggcag caacagtgcc cagggctctg atgagtctct      3000
     catcacttgt aaaggtgaga ttctggggag ctgaagtggt cgggggtggg gcagagggaa      3060
     aaggcctggg taatggggat tctttgattg ggacgtttcg agtgtgtggt gggccgttca      3120
     gagtgtcatc gcttaccatg actgacctga atttgttcat gactattgtg ttctgtagcc      3180
     tgagacagct gcctgtgtgg gactgagatg caggatttct tcacacctct cctttgtgac      3240
     ttcaagagcc tctggcatct ctttctgcaa aggcacctga atgtgtctgc gttcctgtta      3300
     gcataatgtg aggaggtgga gagacagccc acccccgtgt ccaccgtgac ccct            3354
//


spacer
spacer