spacer

EBI Dbfetch

ID   AB677523; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB677523;
XX
DT   26-OCT-2011 (Rel. 110, Created)
DT   26-OCT-2011 (Rel. 110, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds, allele:
DE   HLA-JMDP-R-018.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Shimizu M., Nakajima F.;
RT   ;
RL   Submitted (24-OCT-2011) to the INSDC.
RL   Contact:Marie Shimizu Japanese Red Cross Society, Central Blood Institute;
RL   Tatsumi 2-1-67, Koto-ku, Tokyo 135-8521, Japan E-mail :ma-shimizu@jrc.or.jp
XX
RN   [2]
RA   Shimizu M., Nakajima F.;
RT   "HLA-JMDP-R-018";
RL   Unpublished.
XX
DR   MD5; ce412da89a8ae0dec9a89d6105f9c3a5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*02:06/A*24:02,B*40:01/B*51:01,C*03:04/
FT                   C*14:02,DRB1*11:01/DRB1*JMDP-R-018 ,JMDP36K0130"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-JMDP-R-018"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:G5EM94"
FT                   /db_xref="IMGT/HLA:DRB1*14:44:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:G5EM94"
FT                   /protein_id="BAL04866.1"
FT                   /translation="RFLEYSTSECQFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 55 A; 63 C; 100 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcaattctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc tgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttggtgagag cttcacggtg cagcggcgag                                        270
//


spacer
spacer