spacer

EBI Dbfetch

ID   AB677522; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB677522;
XX
DT   26-OCT-2011 (Rel. 110, Created)
DT   26-OCT-2011 (Rel. 110, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds, allele:
DE   HLA-JMDP-R-017.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Shimizu M., Nakajima F.;
RT   ;
RL   Submitted (24-OCT-2011) to the INSDC.
RL   Contact:Marie Shimizu Japanese Red Cross Society, Central Blood Institute;
RL   Tatsumi 2-1-67, Koto-ku, Tokyo 135-8521, Japan E-mail :ma-shimizu@jrc.or.jp
XX
RN   [2]
RA   Shimizu M., Nakajima F.;
RT   "HLA-JMDP-R-017";
RL   Unpublished.
XX
DR   MD5; a1c806eddfddcc7bf4569756c08495fb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*24:02/A*33:03,B*07:02/B*15:01,C*07:02/
FT                   C*14:03,DRB1*01:01/DRB1*JMDP-R-017,JMDP36K118"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-JMDP-R-017"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:G5EM93"
FT                   /db_xref="IMGT/HLA:DRB1*15:69"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:G5EM93"
FT                   /protein_id="BAL04865.1"
FT                   /translation="RFLWQPERECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 54 A; 66 C; 102 G; 48 T; 0 other;
     cacgtttcct gtggcagcct gagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer