spacer

EBI Dbfetch

ID   AB677520; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB677520;
XX
DT   26-OCT-2011 (Rel. 110, Created)
DT   26-OCT-2011 (Rel. 110, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds, allele:
DE   HLA-JMDP-R-015.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Shimizu M., Nakajima F.;
RT   ;
RL   Submitted (24-OCT-2011) to the INSDC.
RL   Contact:Marie Shimizu Japanese Red Cross Society, Central Blood Institute;
RL   Tatsumi 2-1-67, Koto-ku, Tokyo 135-8521, Japan E-mail :ma-shimizu@jrc.or.jp
XX
RN   [2]
RA   Shimizu M., Nakajima F.;
RT   "HLA-JMDP-R-015";
RL   Unpublished.
XX
DR   MD5; 49bf76e8e5874d4ef59233e1f7546ac9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*24:02/A*31:01,B*52:01/B*56:01,C*04:01/
FT                   C*12:02,DRB1*JMDP-R-015/DRB1*15:02,JMDP01K087"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-JMDP-R-015"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:G5EM91"
FT                   /db_xref="IMGT/HLA:DRB1*09:17"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:G5EM91"
FT                   /protein_id="BAL04863.1"
FT                   /translation="RFLKQDKFECHFFNGTERVRYLHGGIYNQEENVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDFLERRRAEVDTVCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 59 A; 61 C; 103 G; 47 T; 0 other;
     cacgtttctt gaagcaggat aagtttgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggtatctgca cggaggcatc tataaccaag aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacttcct ggagcggagg cgggccgagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagaggcgag                                        270
//


spacer
spacer