spacer

EBI Dbfetch

ID   AB602494; SV 1; linear; genomic DNA; STD; HUM; 233 BP.
XX
AC   AB602494;
XX
DT   23-DEC-2010 (Rel. 107, Created)
DT   23-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class 2 antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-233
RA   Boehme I., Albrecht V.;
RT   ;
RL   Submitted (30-NOV-2010) to the INSDC.
RL   Contact:Irina Boehme DKMS Life Science Lab GmbH; Fiedlerstr. 34, Dresden
RL   01307, Germany
XX
RN   [2]
RA   Albrecht V., Boehme I.;
RT   "Characterisation and Confirmation of new HLA-alleles found by DKMS Life
RT   Science Lab";
RL   Unpublished.
XX
DR   MD5; 61ace1d675b5e60089024166c5a5b68e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..233
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*0227/68CAKR,B*15DFRA/5001,C*0304/0602,
FT                   DRB1*07:01/04XXX"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>233
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class 2 antigen"
FT                   /note="HLA-DRB1 unnamed allele"
FT                   /db_xref="GOA:E5RV99"
FT                   /db_xref="IMGT/HLA:DRB1*04:113"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E5RV99"
FT                   /protein_id="BAJ46508.1"
FT                   /translation="ECHFFNGTERVRFLDRYFYHQEENVRFDSDVGEYRAVTELGRPDA
FT                   EYWNSQKDLLEQKRAAVDTYCRHNYGVGESFT"
FT   exon            <1..>233
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 233 BP; 53 A; 57 C; 84 G; 39 T; 0 other;
     atgagtgtca tttcttcaac gggacggagc gggtgcggtt cctggacaga tacttctatc        60
     accaagagga gaacgtgcgc ttcgacagcg acgtggggga gtaccgggcg gtgacggagc       120
     tggggcggcc tgatgccgag tactggaaca gccagaagga cctcctggag cagaagcggg       180
     ccgcggtgga cacctactgc agacacaact acggggttgg tgagagcttc aca              233
//


spacer
spacer