spacer

EBI Dbfetch

ID   AB598356; SV 1; linear; genomic DNA; STD; HUM; 1412 BP.
XX
AC   AB598356;
XX
DT   10-NOV-2010 (Rel. 106, Created)
DT   10-NOV-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, partial cds, allele:
DE   HLA-B*JMDP-B-023.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1412
RA   Nakajima F., Shimizu M.;
RT   ;
RL   Submitted (02-NOV-2010) to the INSDC.
RL   Contact:Fumiaki Nakajima Japanese Red Cross Society, Central Blood
RL   Institute; Tatsumi 2-1-67, Koto-ku, Tokyo 135-8521, Japan E-mail
RL   :h-nakajima@bs.jrc.or.jp
XX
RN   [2]
RA   Nakajima F., Tadokoro K.;
RT   "HLA-B*JMDP-B-023";
RL   Unpublished.
XX
DR   MD5; b15fbd2fc0967cae81c38671969dd300.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1412
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*24:02/26:02,B*JMDP-B-023/40:06,C*07:02/08:01,
FT                   DRB1*01:01/09:01,JMDP36K076"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..73,174..443,544..819,920..1195,1296..>1412)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*JMDP-B-023"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:E3WH40"
FT                   /db_xref="IMGT/HLA:B*07:124"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E3WH40"
FT                   /protein_id="BAJ25768.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREVEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSS"
FT   gap             74..173
FT                   /estimated_length=unknown
FT   gap             444..543
FT                   /estimated_length=unknown
FT   gap             820..919
FT                   /estimated_length=unknown
FT   gap             1196..1295
FT                   /estimated_length=unknown
XX
SQ   Sequence 1412 BP; 202 A; 314 C; 338 G; 158 T; 400 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca cctccgtgtc ccggcccggc cgcggggagc cccgcttcat       240
     ctcagtgggc tacgtggacg acacccagtt cgtgaggttc gacagcgacg ccgcgagtcc       300
     gagagaggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt gggaccggaa       360
     cacacagatc tacaaggccc aggcacagac tgaccgagag agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag agcatgtacg gctgcgacgt ggggccggac gggcgcctcc       600
     tccgcgggca tgaccagtac gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcctg gaccgccgcg gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgaggt ggagcagcgg agagcctacc tggagggcga gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gacaagctgg agcgcgctgn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna ccccccaaag acacacgtga cccaccaccc catctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggtttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca      1080
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagccg tcttcccagt ccaccgtccc      1320
     catcgtgggc attgttgctg gcctggctgt cctagcagtt gtggtcatcg gagctgtggt      1380
     cgctgctgtg atgtgtagga ggaagagttc ag                                    1412
//


spacer
spacer