spacer

EBI Dbfetch

ID   AB573009; SV 1; linear; genomic DNA; STD; HUM; 1696 BP.
XX
AC   AB573009;
XX
DT   28-JUL-2010 (Rel. 105, Created)
DT   28-JUL-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, partial cds, allele:
DE   HLA-C*JMDP-C-006.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1696
RA   Nakajima F., Tadokoro K.;
RT   ;
RL   Submitted (23-JUL-2010) to the INSDC.
RL   Contact:Fumiaki Nakajima Japanese Red Cross Society, Central Blood
RL   Institute; Tatsumi 2-1-67, Koto-ku, Tokyo 135-8521, Japan
XX
RN   [2]
RA   Nakajima F., Tadokoro K.;
RT   "HLA-C*JMDP-C-006";
RL   Unpublished.
XX
DR   MD5; 4bfe203b54f4250d786bd992f3333251.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1696
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*26:03/31:01,B*15:01/40:02,C*03:03/JMDP-C-006,
FT                   DRB1*04:10/08:02,JMDP36K087"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,174..443,544..819,920..1195,1296..1415,
FT                   1516..1548,1649..>1696)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*JMDP-C-006"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:E1CJE7"
FT                   /db_xref="IMGT/HLA:C*15:43"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E1CJE7"
FT                   /protein_id="BAJ12119.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQLAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACK"
FT   gap             74..173
FT                   /estimated_length=unknown
FT   gap             444..543
FT                   /estimated_length=unknown
FT   gap             820..919
FT                   /estimated_length=unknown
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   gap             1416..1515
FT                   /estimated_length=unknown
FT   gap             1549..1648
FT                   /estimated_length=unknown
XX
SQ   Sequence 1696 BP; 214 A; 331 C; 377 G; 174 T; 600 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgctgtgtc ccggcccggc cgcggggagc cccacttcat       240
     cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagtcc       300
     gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg ccggagtatt gggaccggga       360
     gacacagaag tacaagcgcc aggcacagac tgaccgagtg agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca catcatccag aggatgtatg gctgcgacct ggggcccgac gggcgcctcc       600
     tccgcgggca tgaccagtta gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcctg gaccgccgcg gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgaggc ggagcagctg agagcctacc tggagggcac gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna acacccaaag acacacgtga cccaccatcc cgtctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagtggg atggggagga ccaaactcag gacactgagc ttgtggagac caggccagca      1080
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacgtgcc atgtgcagca cgaggggctg ccggagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagccg tcttcccagc ccaccatccc      1320
     catcgtgggc atcgttgctg gcctggctgt cctggctgtc ctagctgtcc taggagctgt      1380
     ggtggctgtt gtgatgtgta ggaggaagag ctcagnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnngtgga aaaggaggga gctgctctca ggctgcgtnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnnnnncc agcaacagtg cccagggctc tgatgagtct      1680
     ctcatcgctt gtaaag                                                      1696
//


spacer
spacer