Dbfetch

ID   AB546194; SV 1; linear; genomic DNA; STD; HUM; 507 BP.
XX
AC   AB546194;
XX
DT   03-MAR-2010 (Rel. 104, Created)
DT   16-DEC-2012 (Rel. 115, Last updated, Version 2)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-507
RA   Yasunami M.;
RT   ;
RL   Submitted (08-FEB-2010) to the INSDC.
RL   Contact:Michio Yasunami Nagasaki University, Institute of Tropical
RL   Medicine; 1-12-4 Sakamoto, Nagasaki 852-8523, Japan
XX
RN   [2]
RX   DOI; 10.1016/j.humimm.2011.06.007.
RX   PUBMED; 21756958.
RA   Yamazaki A., Yasunami M., Ofori M., Horie H., Kikuchi M., Helegbe G.,
RA   Takaki A., Ishii K., Omar A.H., Akanmori B.D., Hirayama K.;
RT   "Human leukocyte antigen class I polymorphisms influence the mild clinical
RT   manifestation of Plasmodium falciparum infection in Ghanaian children";
RL   Hum. Immunol. 72(10):881-888(2011).
XX
DR   MD5; 4ad82a4f88141e2e7084f5da58fb185a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..507
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Ghana"
FT                   /isolation_source="peripheral blood leukocytes"
FT                   /db_xref="taxon:9606"
FT   intron          <1..206
FT                   /number=1
FT   exon            207..476
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <207..>476
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /allele="new DRB1*03"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D3KYL3"
FT                   /db_xref="IMGT/HLA:DRB1*03:53"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D3KYL3"
FT                   /protein_id="BAI78056.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRPV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRR"
FT   intron          477..>507
FT                   /number=2
XX
SQ   Sequence 507 BP; 86 A; 142 C; 187 G; 92 T; 0 other;
     ggttttcccg cctggtcccc caggccccct ttcgcctcag gaagacagag gaggagcccc        60
     tgggctgctg gtggtgggcg ttgcggcggg ggccggttaa ggttcccagt gcccgcaccc       120
     cacccaggga gccccggatg gcggcgtcac tgtcagtgtc ttctcaggag gccgcctgtg       180
     tgactggatc gttcgtgtcc ccacagcacg tttcttggag tactctacgt ctgagtgtca       240
     tttcttcaat gggacggagc gggtgcggtt cctggagaga tacttccata accaggagga       300
     gaacgtgcgc ttcgacagcg acgtggggga gtaccggccg gtgacggagc tggggcggcc       360
     tgatgccgag tactggaaca gccagaagga cctcctggag cagaagcggg gccgggtgga       420
     caactactgc agacacaact acggggttgg tgagagcttc acagtgcagc ggcgaggtga       480
     gcgcggcgcg gggcggggcc tgagtcc                                           507
//