spacer

EBI Dbfetch

ID   AB542913; SV 1; linear; genomic DNA; STD; HUM; 474 BP.
XX
AC   AB542913;
XX
DT   23-JAN-2010 (Rel. 103, Created)
DT   23-JAN-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-474
RA   Maruya E., Matsushita M.;
RT   ;
RL   Submitted (20-JAN-2010) to the INSDC.
RL   Contact:Masaki Matsushita Wakunaga Pharmaceutical Co., Ltd., BioBusiness
RL   Development; 1624 Shimokotachi Koda-cho, Akitakata, Hiroshima 739-1195,
RL   Japan URL    :http://www.wakunaga.co.jp
XX
RN   [2]
RA   Maruya E., Matsushita M.;
RT   "Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds";
RL   Unpublished.
XX
DR   MD5; 956f4e4e09add70b2807804ca0942c17.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..474
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..179
FT                   /gene="HLA-DRB1"
FT                   /number=1
FT   exon            180..449
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <180..>449
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D2KZY2"
FT                   /db_xref="IMGT/HLA:DRB1*12:21"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D2KZY2"
FT                   /protein_id="BAI67119.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDFLEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   intron          450..>474
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 474 BP; 80 A; 126 C; 179 G; 89 T; 0 other;
     ccgttcgcct caggaagacg gaggatgagc tcctgggctg caggtggtgg gcgttgcggg        60
     tggggccggt taaggttccc agtgcctgca ccccacccag ggagccccgg atggtggcgt       120
     cgctgtcagt gtcttctcag gaggccacct gtgtgactgg atcgttcgtg tccccacagc       180
     acgtttcttg gagtactcta cgggtgagtg ttatttcttc aatgggacgg agcgggtgcg       240
     gttactggag agacacttcc ataaccagga ggagctcctg cgcttcgaca gcgacgtggg       300
     ggagtaccgg gcggtgacgg agctggggcg gcctgtcgcc gagtcctgga acagccagaa       360
     ggacttcctg gaagacaggc gcgccgcggt ggacacctat tgcagacaca actacggggc       420
     tgtggagagc ttcacagtgc agcggcgagg tgagcgcggc gcggggcggg gcct             474
//


spacer
spacer