spacer

EBI Dbfetch

ID   AB535719; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AB535719;
XX
DT   02-DEC-2009 (Rel. 103, Created)
DT   30-JUL-2013 (Rel. 117, Last updated, Version 3)
XX
DE   Homo sapiens HLA-Cw gene for MHC classI antigen, partial cds, allele: C*
DE   01:35.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Kikkawa E.F., Shigenari A., Sugimoto T., Kato S., Inoko H.;
RT   ;
RL   Submitted (30-NOV-2009) to the INSDC.
RL   Contact:Eri F Kikkawa School of Medicine, Tokai Univ.; Shimokasuya143,
RL   Isehara, Kanagawa 259-1193, Japan
XX
RN   [2]
RA   Kikkawa E.F., Shigenari A., Sugimoto T., Kato S., Inoko H.;
RT   "HLA new allele";
RL   Unpublished.
XX
DR   MD5; 33751bd7fe7c7276f99521b92b527821.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Kanagawa, Isehara"
FT                   /clone="20090681M,20090681CB"
FT                   /cell_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-Cw"
FT                   /allele="C* 01:35"
FT                   /product="MHC classI antigen"
FT                   /db_xref="GOA:D1MYW0"
FT                   /db_xref="IMGT/HLA:C*01:35"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D1MYW0"
FT                   /protein_id="BAI52766.1"
FT                   /translation="SHTLQWMCGCDLGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRA"
XX
SQ   Sequence 276 BP; 50 A; 88 C; 101 G; 37 T; 0 other;
     ggtctcacac cctccagtgg atgtgtggct gcgacctggg gcccgacggg cgcctcctcc        60
     gcgggtatga ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer