spacer

EBI Dbfetch

ID   AB535717; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB535717;
XX
DT   02-DEC-2009 (Rel. 103, Created)
DT   30-JUL-2013 (Rel. 117, Last updated, Version 3)
XX
DE   Homo sapiens HLA-A gene for MHC classI antigen, partial cds, allele:
DE   A*02:244.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Kikkawa E.F., Shigenari A., Sugimoto T., Kato S., Inoko H.;
RT   ;
RL   Submitted (30-NOV-2009) to the INSDC.
RL   Contact:Eri F Kikkawa School of Medicine, Tokai Univ.; Shimokasuya143,
RL   Isehara, Kanagawa 259-1193, Japan
XX
RN   [2]
RA   Kikkawa E.F., Shigenari A., Sugimoto T., Kato S., Inoko H.;
RT   "HLA new allele";
RL   Unpublished.
XX
DR   MD5; 0b5c2dc896aa39f8c29d70e16dd5abfb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Kanagawa, Isehara"
FT                   /clone="20080212seq"
FT                   /cell_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-A"
FT                   /allele="A*02:244"
FT                   /product="MHC classI antigen"
FT                   /db_xref="GOA:D1MYV8"
FT                   /db_xref="IMGT/HLA:A*02:244"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:D1MYV8"
FT                   /protein_id="BAI52764.1"
FT                   /translation="SHSMRYFYTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEA"
XX
SQ   Sequence 270 BP; 53 A; 82 C; 96 G; 39 T; 0 other;
     gctctcactc catgaggtat ttctacacct ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggaaagtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer