spacer

EBI Dbfetch

ID   AB512680; SV 2; linear; genomic DNA; STD; HUM; 1012 BP.
XX
AC   AB512680;
XX
DT   17-JUL-2009 (Rel. 101, Created)
DT   01-DEC-2009 (Rel. 103, Last updated, Version 2)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, partial cds, allele:
DE   HLA-B*JMDP-B-002.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1012
RA   Nakajima F., Tadokoro K.;
RT   ;
RL   Submitted (14-JUL-2009) to the INSDC.
RL   Contact:Fumiaki Nakajima Japanese Red Cross Society, Central Blood
RL   Institute; Tatsumi 2-1-67, Koto-ku, Tokyo 135-8521, Japan
XX
RN   [2]
RA   Nakajima F., Tadokoro K.;
RT   "HLA-JMDP-B-002";
RL   Unpublished.
XX
DR   MD5; 279f56d377382eaeb198880c775ddcc6.
DR   Ensembl-Gn; ENSG00000234745; homo_sapiens.
DR   Ensembl-Tr; ENST00000412585; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1012
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*2601/3101,B*JMDP-B-002/5101,DRB1*0101/0901,
FT                   JMDP01K046"
FT                   /db_xref="taxon:9606"
FT   CDS             1..>1012
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*JMDP-B-002"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C6L830"
FT                   /db_xref="IMGT/HLA:B*07:02:19"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C6L830"
FT                   /protein_id="BAH85285.2"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSS"
XX
SQ   Sequence 1012 BP; 201 A; 316 C; 338 G; 157 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca cctccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat ctcagtgggc tacgtggacg acacccagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc tacaaggccc aggcacagac tgaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     agcatgtacg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca tgaccagtac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagcgg       540
     agagcctacc tggagggcga gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gacaagctgg agcgcgctga ccccccaaag acacacgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggtttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagccg       900
     tcttcccagt ccaccgtccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga ggaagagttc ag              1012
//


spacer
spacer