spacer

EBI Dbfetch

ID   AB510591; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB510591;
XX
DT   25-DEC-2009 (Rel. 103, Created)
DT   26-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens HLA-DRB4 gene for MHC Class II antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lee E.;
RT   ;
RL   Submitted (29-JUN-2009) to the INSDC.
RL   Contact:Etsuko Lee Tokushima University Hospital, Division of Transfusion
RL   Medicine; 2-50 Kuramoto, Tokushima, Tokushima 770-8503, Japan
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2011.01666.x.
RX   PUBMED; 21410658.
RA   Lee E., Ozaki S., Ishii H., Takimoto T., Matsumoto T.;
RT   "A novel HLA-DRB4 allele, DRB4*01:08, identified by sequence-based typing";
RL   Tissue Antigens 78(2):158-159(2011).
XX
DR   MD5; 7b5bece209cf3a6594c1b0ca644e01b7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Tokushima"
FT                   /sex="female"
FT                   /cell_type="leukocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB4"
FT                   /product="MHC Class II antigen"
FT                   /db_xref="GOA:D1MYB6"
FT                   /db_xref="IMGT/HLA:DRB4*01:08"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D1MYB6"
FT                   /protein_id="BAI60043.1"
FT                   /translation="RFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVKSFTVQRR"
XX
SQ   Sequence 270 BP; 66 A; 62 C; 95 G; 47 T; 0 other;
     cacgtttctt ggagcaggct aagtgtgagt gtcatttcct caatgggacg gagcgagtgt        60
     ggaacctgat cagatacatc tataaccaag aggagtacgc gcgctacaac agtgacctgg       120
     gggagtacca ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ctgcagatac aactacgggg       240
     ttgtgaagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer