spacer

EBI Dbfetch

ID   AB485772; SV 1; linear; genomic DNA; STD; HUM; 642 BP.
XX
AC   AB485772;
XX
DT   27-FEB-2009 (Rel. 100, Created)
DT   27-FEB-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, partial cds, allele:
DE   HLA-A*1101.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-642
RA   Maruya E., Matsushita M., Ogawa T., Saji H.;
RT   ;
RL   Submitted (23-FEB-2009) to the INSDC.
RL   Contact:Etsuko Maruya HLA Laboratory, NPO, Research; Kawabata-Marutamachi,
RL   Sakyoku, Kyoto, Kyoto 606-8396, Japan URL    :http://hla.or.jp/
XX
RN   [2]
RA   Maruya E., Matsushita M., Ogawa T., Saji H., Ounuma T., Futagami T.,
RA   Kojima H., Tujino T., Hayashi K., Kusunoki Y., Toshida T., Maekawajiri S.;
RT   "HLA-A*1101 related new allele, A*1101V";
RL   Unpublished.
XX
DR   MD5; e75313e20d21840f7e34a3d71430ce1e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..642
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Tokyo"
FT                   /sex="female"
FT                   /haplotype="A*1101V-B*6701-DRB1*1501"
FT                   /clone="5"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>642)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1101"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B9X247"
FT                   /db_xref="IMGT/HLA:A*11:43"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B9X247"
FT                   /protein_id="BAH23561.1"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQR"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 642 BP; 110 A; 163 C; 196 G; 73 T; 100 other;
     gctcccactc catgaggtat ttcaccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagata atgtatggct gcgacgtggg gccggacggg       420
     cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agatcaccaa gcgcaagtgg       540
     gaggcggccc atgcggcgga gcagcagaga gcctacctgg agggccggtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gc                          642
//


spacer
spacer