spacer

EBI Dbfetch

ID   AB479514; SV 1; circular; genomic DNA; STD; PRO; 3932 BP.
XX
AC   AB479514;
XX
DT   10-FEB-2009 (Rel. 99, Created)
DT   10-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Onion yellows phytoplasma plasmid pOYM DNA, complete sequence.
XX
KW   .
XX
OS   Onion yellows phytoplasma
OC   Bacteria; Tenericutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae;
OC   Candidatus Phytoplasma; Candidatus Phytoplasma asteris.
OG   Plasmid pOYM
XX
RN   [1]
RP   1-3932
RA   Namba S., Oshima K., Yamaji Y., Kakizawa S., Ishii Y.;
RT   ;
RL   Submitted (02-FEB-2009) to the INSDC.
RL   Contact:Shigetou Namba The University of Tokyo, Guraduate School of
RL   Agricultural and Life Sciences; Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657,
RL   Japan
XX
RN   [2]
RA   Nishigawa H., Oshima K., Kakizawa S., Jung H., Kuboyama T., Miyata S.,
RA   Ugaki M., Namba S.;
RT   "Evidence of intermolecular recombination between extrachromosomal DNAs in
RT   phytoplasma: a trigger for the biological diversity of phytoplasma?";
RL   Microbiology 148:1389-1396(2002).
XX
RN   [3]
RX   DOI; 10.1016/S0378-1119(02)00975-7.
RX   PUBMED; 12426107.
RA   Nishigawa H., Oshima K., Kakizawa S., Jung H., Kuboyama T., Miyata S.,
RA   Ugaki M., Namba S.;
RT   "A plasmid from a non-insect-transmissible line of a phytoplasma lacks two
RT   open reading frames that exist in the plasmid from the wild-type line";
RL   Gene 298(2):195-201(2002).
XX
RN   [4]
RA   Nishigawa H., Oshima K., Miyata S., Ugaki M., Namba S.;
RT   "Complete set of extrachromosomal DNAs from three pathogenic lines of onion
RT   yellows phytoplasma and use of PCR to differentiate each line";
RL   J. Gen. Plant Pathol. 69:194-198(2003).
XX
DR   MD5; 191f139fcb84b3ca1e636a218afcd20f.
DR   EuropePMC; PMC3154185; 21711564.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3932
FT                   /organism="Onion yellows phytoplasma"
FT                   /plasmid="pOYM"
FT                   /strain="OY"
FT                   /mol_type="genomic DNA"
FT                   /note="OY-M"
FT                   /db_xref="taxon:100379"
FT   CDS             1..1134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /product="replication protein"
FT                   /note="ORF5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9A9P3"
FT                   /protein_id="BAH22371.1"
FT                   /translation="MKLRICELVINKTLITKTKIETILETKKKAIQNYAYILHDKDIYQ
FT                   NEKEAQLNGKKVGDIKAPHWHIYLRFNYSQDTKHISQWFNTQENFVSKIKGRFSDALMY
FT                   MIHANRLDKHQYDEKEVVSNFDWKSEAQQDIFNRKYKMDARLKDILLKIHSGEIKEYNI
FT                   NDNINILENNIYATAIEKAFKFRIRDLKKKVRQMECIFITGLSGSGKSTLAKKIAEDKN
FT                   YEAYISSGSNDILDDYCGEECIILDDLRSNCLGLSDLLKMLDNNTASSVKSRYKNKVLE
FT                   CQLIIITTVKSIDDFFEDIFRKDESIIQLKRRCKLHIKIDSKYIYYSVWNPIEMKYDLI
FT                   EKKPNNLLNDFQIKSLSKKEAKDYIKSISNIDLDKDC"
FT   CDS             1397..1891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF1"
FT                   /db_xref="UniProtKB/TrEMBL:B9A9P4"
FT                   /protein_id="BAH22372.1"
FT                   /translation="MQNLNLNISAFIDKINDYAIYIITFLKTTFNNIIAIRNVDFSLVN
FT                   IPNSFGIIWHFILSILYILIFITILVFMGSIFSIFKQIIKWAIYKPIKLFVLGLYYFIL
FT                   LLKYLFTPKSKLKQPIKTNNLNQYDLNKLQRKINDLEYKLNLQKRQNVIKPVENKYQKR
FT                   G"
FT   CDS             1895..2425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF2"
FT                   /db_xref="InterPro:IPR021348"
FT                   /db_xref="UniProtKB/TrEMBL:B9A9P5"
FT                   /protein_id="BAH22373.1"
FT                   /translation="MQTNNQKKLKNKIFIIWGLFITGVILVFLIILLLAMNKPQPKTDN
FT                   QNQPTLTSKTNPQQEQEIYNEILNKIKNEVDELTTEKEIVYRIDGKNIHYIKILDSQTK
FT                   KEIKRINYHDDGKTIFYIETFDSQTGQKIKEDTYKDNGKNIHYSIEYNPITGTKIKMTY
FT                   YNLDGTIKETKTF"
FT   CDS             2428..2892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q59JM4"
FT                   /protein_id="BAH22374.1"
FT                   /translation="MNKKRKIILIMWTIFIAIILLILLFLLGLRLPKFIKSNQPKTENQ
FT                   AKTQSQYQIQYIHDTNKINNIIKSLIKLKQLKESKKQKQQLKPQTEKQEQEQEQYQFDW
FT                   NSNYDNDDNKLVKDIAVVTLATGAAVISCVVLAPIFASVGPIAAPLALLA"
FT   CDS             2916..3230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /product="single-stranded DNA binding protein"
FT                   /note="ORF4"
FT                   /db_xref="GOA:B9A9P7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B9A9P7"
FT                   /protein_id="BAH22375.1"
FT                   /translation="MLNKVQLIGNITHDLEQQYINTNEGKIPKVNFQLAVNNKDTTQFI
FT                   PCVVFRNQADNMFMYLHKGSKVYLEGTLSIEKYINNESENKTSTKVIVQRVIFLDNKNQ
FT                   "
XX
SQ   Sequence 3932 BP; 1624 A; 457 C; 497 G; 1354 T; 0 other;
     atgaaattac gaatatgcga acttgttatt aataaaactt taattactaa aactaaaata        60
     gaaactattt tagaaactaa aaaaaaagct attcaaaatt atgcctatat tttgcatgat       120
     aaagatattt atcaaaatga aaaagaggct caattgaatg gtaaaaaagt aggagatata       180
     aaagctcctc attggcatat atatttaaga tttaattatt cacaagatac taaacatata       240
     tctcaatggt ttaataccca agaaaacttt gtatctaaaa ttaaaggtag atttagtgat       300
     gccttaatgt atatgattca tgctaatcgc ttagataaac atcaatatga tgaaaaagaa       360
     gtagttagta attttgattg gaaaagcgaa gctcaacaag atatttttaa tagaaaatat       420
     aaaatggatg ctcgcttaaa agatatttta cttaaaatac attcaggaga aattaaagaa       480
     tacaatataa atgataatat taatattcta gaaaataata tatatgctac tgcaatagaa       540
     aaagcattta agtttagaat tagagattta aaaaagaaag ttagacaaat ggaatgtatt       600
     tttataactg gtttaagtgg ttcaggtaaa tctactttag ccaaaaaaat agccgaagat       660
     aaaaattatg aggcttatat ttcatcaggt agtaatgata ttttagacga ttattgcggt       720
     gaggaatgta ttattttaga tgacctacgt tctaattgtt taggtttgtc tgatttatta       780
     aagatgttag ataataatac tgcctccagt gttaagagtc gttataaaaa taaagtttta       840
     gaatgtcaat taattattat tactaccgtt aaaagtattg atgatttctt tgaagatatt       900
     tttagaaaag atgaaagcat tattcaatta aaacgtcgtt gtaaattaca tattaaaata       960
     gattcaaaat atatttatta tagtgtttgg aatccaattg aaatgaagta tgatttaata      1020
     gaaaaaaaac ctaataattt attaaatgat tttcaaataa aatccttatc aaaaaaagaa      1080
     gcaaaagatt atataaaatc aatttctaat atagatttag ataaagattg ttaatttttt      1140
     tatgtgtatt ttactaggtt ttttgatata atataagtgt attcacatgg acataaatac      1200
     aaattaataa ttaataacat ttttatatgt taaaataatt atgaccttat atatatgttc      1260
     gtccatgtgc gtatatgtag ggtcattttt gttttgtaaa gtccacatta aaaaagtata      1320
     aaaaaaatag ctatataaat cacactttgg caaaagaaaa cgatttatat aactaccatg      1380
     aaaggatgca ttattcatgc aaaatcttaa tttaaacata agcgcattta ttgataaaat      1440
     aaatgattac gctatctata ttataacatt tcttaaaact actttcaaca atataattgc      1500
     tattagaaat gttgatttta gtttagtcaa tataccaaat agttttggta taatttggca      1560
     ttttatttta tctattcttt atattttaat tttcattact attttagttt ttatgggttc      1620
     tatatttagt atctttaagc aaataataaa atgggctatt tataagccca ttaaactttt      1680
     tgttttagga ttatattatt ttatactatt attaaaatat ttatttactc ctaaatcaaa      1740
     attaaaacaa ccaattaaaa ctaataactt gaatcaatat gatttaaaca aattacaaag      1800
     aaagataaat gatttagaat ataaacttaa tttacaaaaa agacaaaacg ttattaaacc      1860
     agttgaaaac aaatatcaaa aaagaggcta aattatgcaa accaataatc aaaaaaaatt      1920
     gaaaaataaa atatttatca tttggggttt atttattact ggagttattc ttgttttttt      1980
     aatcatttta ttattagcta tgaataaacc ccaacctaaa actgataacc aaaatcaacc      2040
     tactttaacc tctaaaacca atcctcaaca agaacaagaa atatataatg agattcttaa      2100
     taagattaaa aacgaagttg atgaattaac aactgaaaaa gaaatagttt atcgtataga      2160
     tggtaaaaat atacattata ttaaaatatt agattctcaa actaaaaaag aaattaaaag      2220
     aattaattat catgatgatg gtaaaactat tttttacata gaaacatttg attctcaaac      2280
     aggtcaaaaa attaaagaag acacatataa agataatggt aaaaatatac attatagtat      2340
     agaatataat cctataacag gtactaaaat taaaatgaca tattacaacc tagatggaac      2400
     tattaaagaa actaaaacat tttaatcatg aataaaaaaa gaaaaattat attaataatg      2460
     tggactatct ttattgcaat tattctttta atcctattat tccttttagg tttaagatta      2520
     cctaaattca ttaaatcaaa ccaacctaaa actgaaaatc aagctaaaac tcaatctcaa      2580
     tatcaaatcc aatatattca tgatactaat aaaattaata atataattaa gtcattaatt      2640
     aagttaaaac agttaaaaga atcaaaaaaa caaaaacaac aattaaaacc tcaaactgaa      2700
     aaacaagaac aagaacaaga gcaatatcaa tttgattgga attcaaatta tgataacgat      2760
     gataataaat tagttaaaga tatcgcagta gtaactcttg ccacaggtgc agctgttatt      2820
     agttgtgtag ttctagctcc tatttttgca tctgtaggcc caatagcagc tcctcttgct      2880
     ttattagctt aatataaata gaaaggagaa atcaaatgtt aaataaagta caactaatcg      2940
     gtaatatcac tcatgaccta gaacaacaat atattaatac taatgaaggt aaaataccta      3000
     aagttaattt tcaattagca gttaataata aagatacaac ccaattcatt ccatgtgtag      3060
     tttttcgtaa tcaagcagac aatatgttta tgtatctaca taaaggttca aaagtatatt      3120
     tagagggaac gttgtcaatt gaaaaatata taaataacga aagtgaaaat aaaacctcaa      3180
     ctaaagtaat agttcaaaga gttatctttt tagataataa aaatcaataa aacaaaggcc      3240
     cctaatttaa taggggcttt aaaaatataa aatctcaatt gcgcggaatg ttaattttaa      3300
     tccattcatc aattttataa tacctctaaa actcattatt ttatatctat attcaatttt      3360
     aaattaaatt aagtataaaa gtattcaaag acgagcgtag cgaactaggc gtccagccga      3420
     agtatactta gattaaccta ttacacccct cctataaagt cccctttggg gatttagggg      3480
     ttgttttttt tataactaaa atgttaaaat aatcaatgac tctacatata tgtttttcgc      3540
     atattcgtga tatgtagggt cataatttta tattttaatt tgttagttat ttccttggtt      3600
     ttaattgttt ttggctaacc ttatatatat atggagtaaa catataaaat cctcagcatt      3660
     tccctgccat agagggcttg tctctatggc agggagtata tgtagtataa attatattgt      3720
     tttgttagat tttttctaat attttttaac ttgtgtttac tacctttttt tatgtattaa      3780
     tgtagaatag aaatgttata ataatatcga gcgccttacc tgtgaactat caggtaagga      3840
     gtagcgagaa cgaaccaacc acctttgctg cgttaggcag taaaggagta ggttggagag      3900
     tccattaaaa atattaaaag gaatctagta aa                                    3932
//


spacer
spacer