Dbfetch

ID   AB471013; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB471013;
XX
DT   01-DEC-2008 (Rel. 98, Created)
DT   28-DEC-2012 (Rel. 115, Last updated, Version 2)
XX
DE   Homo sapiens HLA-DRB1*0406V2 gene for MHC class II antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Kuroda Y., Oda H., Asao Y., Nakayama M., Nagayoshi Y., Sakota I.,
RA   Tomonari Y., Satou H., Kiyokawa H.;
RT   ;
RL   Submitted (26-NOV-2008) to the INSDC.
RL   Contact:Yukari Kuroda 2nd Labratory Sect.Japanese Red Cross Kyusyu Block
RL   Blood Center; 3-4-12 Miyanojin, Kurume-shi, Fukuoka 839-0801, Japan
XX
RN   [2]
RA   Kuroda Y., Oda H., Asao Y., Nakayama M., Nagayoshi Y., Sakota I.,
RA   Tomonari Y., Satou H., Kiyokawa H.;
RT   "HLA-DRB1*0406V2";
RL   Unpublished.
XX
DR   MD5; d1198956aa7b46b96e97577a969ea63b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="A*1101-Cw*0401-B*1501-DRB1*0406V2"
FT                   /note="HLA-A*1101/2603,B*1501/-,Cw*0303/0401,DRB1*0406V2/
FT                   1502"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0406V2"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:B6ZLV2"
FT                   /db_xref="IMGT/HLA:DRB1*04:85"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B6ZLV2"
FT                   /protein_id="BAG84657.1"
FT                   /translation="SFLEQVKHECHFFNGTERVRFLDRYFYHQEESVRFDSDVGKYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAEVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 61 A; 64 C; 97 G; 48 T; 0 other;
     caagtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     ggaagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgagg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//