spacer

EBI Dbfetch

ID   AB467317; SV 1; linear; genomic DNA; STD; HUM; 900 BP.
XX
AC   AB467317;
XX
DT   06-NOV-2008 (Rel. 97, Created)
DT   10-JUN-2009 (Rel. 101, Last updated, Version 2)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, partial cds, allele:
DE   HLA-B*5901V.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-900
RA   Matsushita M., Ueta M., Sotozono C., Tokunaga K., Kinoshita S., Oka T.;
RT   ;
RL   Submitted (21-OCT-2008) to the INSDC.
RL   Contact:Masaki Matsushita Wakunaga Pharmaceutical Co., Ltd., BioBusiness
RL   Development; 1624 Shimokotachi, Koda-cho, Akitakata, Hiroshima 739-1195,
RL   Japan URL    :http://www.wakunaga.co.jp
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2009.01228.x.
RX   PUBMED; 19493240.
RA   Ueta M., Matsushita M., Sotozono C., Kinoshita S., Tokunaga K.;
RT   "Identification of a novel HLA-B allele, HLA-B*5904";
RL   Tissue Antigens 73(6):612-614(2009).
XX
DR   MD5; 6cf699916ad646a19b298948c1e464d0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..900
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<67..336,582..>857)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5901V"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B6F252"
FT                   /db_xref="IMGT/HLA:B*59:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B6F252"
FT                   /protein_id="BAG81026.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
XX
SQ   Sequence 900 BP; 157 A; 299 C; 322 G; 122 T; 0 other;
     gcgcaggacc cggggagccg cgccgggagg agggtctggc gggtctcagc ccctcctcgc        60
     ccccaggctc ccactccatg aggtatttct acaccgccat gtcccggccc ggccgcgggg       120
     agccccgctt catcgcagtg ggctacgtgg acgacacgca gttcgtgagg ttcgacagcg       180
     acgccgcgag tccgagagag gagccgcggg cgccgtggat agagcaggag gggccggagt       240
     attgggaccg gaacacacag atcttcaaga ccaacacaca gacttaccga gagaacctgc       300
     ggatcgcgct ccgctactac aaccagagcg aggccggtga gtgaccccgg cccggggcgc       360
     aggtcacgac tccccatccc ccacgtacgg cccgggtcgc cccgagtctc cgggtccgag       420
     atccgcctcc ctgaggccgc gggacccgcc cagaccctcg accggcgaga gccccaggcg       480
     cgtttacccg gtttcatttt cagttgaggc caaaatcccc gcgggttggt cggggcgggg       540
     cggggctcgg gggacggggc tgaccgcggg gccggggcca gggtctcaca cttggcagac       600
     gatgtatggc tgcgacctgg ggccggacgg gcgcctcctc cgcgggcata accagttagc       660
     ctacgacggc aaggattaca tcgccctgaa cgaggacctg agctcctgga ccgcggcgga       720
     caccgcggct cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagctgag       780
     agcctacctg gagggcctgt gcgtggagtg gctccgcaga tacctggaga acgggaagga       840
     gacgctgcag cgcgcgggta ccaggggcag tggggagcct tccccatctc ctataggtcg       900
//


spacer
spacer