spacer

EBI Dbfetch

ID   AB441824; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AB441824;
XX
DT   20-JUN-2008 (Rel. 96, Created)
DT   20-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, partial cds, allele:
DE   HLA-Cw*1214V1.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Horie C., Kato T.;
RT   ;
RL   Submitted (18-JUN-2008) to the INSDC.
RL   Contact:Chizuko Horie Aichi Red Cross Blood Center; Minamiyamaguchichou
RL   539-3, Seto-City, Aichi 488-8999, Japan
XX
RN   [2]
RA   Horie C., Kato T., Ichihara T., Kasiwase K.;
RT   "HLA-Cw*1214V1";
RL   Unpublished.
XX
DR   MD5; dbb064bcfa1c227e5bff5facbf5750f7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*1214V1"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B3IYE5"
FT                   /db_xref="IMGT/HLA:C*12:14:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B3IYE5"
FT                   /protein_id="BAG49330.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 646 BP; 104 A; 173 C; 199 G; 70 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgctgcggac acggcggctc agatcaccca gcgcaagttg       540
     gaggcggccc gtgcggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer