Dbfetch

ID   AB426906; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AB426906;
XX
DT   11-MAR-2008 (Rel. 95, Created)
DT   28-DEC-2012 (Rel. 115, Last updated, Version 3)
XX
DE   Homo sapiens HLA-Cw gene for MHC class I antigen, partial cds, allele:
DE   HLA-Cw*08V.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Kuroda Y., Oda H., Tokunaga K., Satou H., Kasiwagi S.;
RT   ;
RL   Submitted (06-MAR-2008) to the INSDC.
RL   Contact:Yukari Kuroda 2nd Labratory Sect.Japanese Red Cross Kyusyu Block
RL   Blood Center; 3-4-12 Miyanojin, Kurume-shi, Fukuoka 839-0801, Japan
XX
RN   [2]
RA   Kuroda Y., Oda H., Tokunaga K., Satou H., Kasiwagi S.;
RT   "HLA-Cw*08V";
RL   Unpublished.
XX
DR   MD5; 4cd6a4e61ba19f204db57c8112617127.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*2402/2602,B*4006/5502,Cw*0102/08V,DRB1*0405/
FT                   1501"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*08V"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*08:16:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B1B6Q2"
FT                   /protein_id="BAG12757.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARTAEQLRAYLEGTC
FT                   VEWLRRYLENGKKTLQRA"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 646 BP; 108 A; 171 C; 196 G; 71 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaat       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtacggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaagaag acgctgcagc gcgcgg                      646
//