spacer

EBI Dbfetch

ID   AB378484; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AB378484;
XX
DT   06-FEB-2008 (Rel. 94, Created)
DT   06-FEB-2008 (Rel. 94, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Nishimura C., Inaba H., Minami H., Araki N., Imoto S., Mabuchi O.,
RA   Ichihara T., Kashiwaze K., Tanaka H.;
RT   ;
RL   Submitted (04-FEB-2008) to the INSDC.
RL   Contact:Nobuo Araki Hyogo Red Cross Blood Center, HLA Laboratory;
RL   Wakihama-Kaigandori 1-4-5, Kobe, Cyuo, Hyogo 651-0073, Japan
XX
RN   [2]
RA   Nishimura C., Inaba H., Minami H., Araki N., Imoto S., Mabuchi O.,
RA   Ichihara T., Kashiwaze K., Tanaka H.;
RT   "Homo sapiens HLA-C gene for MHC class I antigen";
RL   Unpublished.
XX
DR   MD5; b39b65efa466077fa037e7e76d19b23a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B0I562"
FT                   /db_xref="IMGT/HLA:C*01:22"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B0I562"
FT                   /protein_id="BAG06861.1"
FT                   /translation="SHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMCGCDLGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 646 BP; 105 A; 170 C; 197 G; 74 T; 100 other;
     gctcccactc catgaagtat ttcttcacat ccgtgtcccg gcctggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagtgg atgtgtggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer