Dbfetch

ID   AB359228; SV 2; linear; mRNA; STD; MUS; 1170 BP.
XX
AC   AB359228;
XX
DT   30-AUG-2007 (Rel. 93, Created)
DT   18-NOV-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus H2-M5 mRNA for MHC classIb protein M5, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RC   Publication_Status: Online-Only Publication Status: Online-Only
RX   DOI; 10.1186/1471-2164-9-178.
RX   PUBMED; 18416856.
RA   Ohtsuka M., Inoko H., Kulski J.K., Yoshimura S.;
RT   "Major histocompatibility complex (Mhc) class Ib gene duplications,
RT   organization and expression patterns in mouse strain C57BL/6";
RL   BMC Genomics 9:178-178(2008).
XX
RN   [2]
RP   1-1170
RA   Yoshimura S., Ohtsuka M., Inoko H.;
RT   ;
RL   Submitted (28-AUG-2007) to the INSDC.
RL   Contact:Shinichi Yoshimura Department of Molecular Life Science, Tokai
RL   University School of Medicine; shimokasuya 143, Isehara, Kanagawa 259-1193,
RL   Japan
XX
DR   MD5; 1d025983fa3210b53c766433b291642b.
DR   Ensembl-Gn; ENSMUSG00000024459; mus_musculus.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023517; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000169189; mus_musculus.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0047329; mus_musculus_nodshiltj.
XX
CC   On Feb 5, 2008 this sequence version replaced gi:156622661.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1170
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..1170
FT                   /gene="H2-M5"
FT   CDS             1..1047
FT                   /codon_start=1
FT                   /gene="H2-M5"
FT                   /product="MHC classIb protein M5"
FT                   /db_xref="GOA:A7VMS3"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="MGI:MGI:95917"
FT                   /db_xref="UniProtKB/TrEMBL:A7VMS3"
FT                   /protein_id="BAF76148.1"
FT                   /translation="MRSPALSTLLSLLLTGALALTLVRAGIHSLQFFATTMTQPGLREH
FT                   SFIFVVFVDDTQFLCYNNKGKNQRMEPRALWVKQMGPEYWEQQTRTVKVIEKIALVNLQ
FT                   EAMDIYNHSKDGSHVFQCVYGCEVGPDGLFLRGHEKHAYDGRDYLTLSPDLHSWVAGDT
FT                   AAQITLRRWEKSGVSEQRQSFLKGECVESLRTYLEIGKETLLRTDPPKAHVTHHPRPEG
FT                   EVTLRCWALGFYPANIILTWQWDEEDLTQDMDLIETRPAGDGTFQKWASVVVPSGEEQR
FT                   YTCHVQHEGLTQPLVLKWDPSKHTIPIMGITVGLLLFGVVFTGAVVAIVMRKRKGFQII
FT                   ILKTFLKG"
XX
SQ   Sequence 1170 BP; 277 A; 308 C; 308 G; 277 T; 0 other;
     atgagaagcc ctgcgctctc taccctccta tccttgctgc tcaccggagc tttggccttg        60
     accctggttc gcgcaggcat ccattccttg cagttttttg ccaccaccat gacccagcct       120
     ggtttgaggg agcattcctt catctttgtc gtcttcgtgg acgacacaca gttcctgtgc       180
     tacaacaata aggggaaaaa tcagagaatg gagccacgcg ctctgtgggt gaagcagatg       240
     gggccagagt attgggaaca gcagaccagg actgtcaagg tcattgagaa gattgcccta       300
     gtgaatttgc aggaggccat ggacatctac aaccacagca aggatggctc tcacgtcttt       360
     cagtgtgtgt atggctgcga agtggggcca gatggactct tcctccgtgg gcatgagaag       420
     cacgcatacg acggccgcga ttacctcacc ctaagcccgg acctgcactc ctgggtcgca       480
     ggcgacacag ctgcgcagat cacgctgcgc aggtgggaga agtctggtgt ctctgagcaa       540
     aggcaatcct tcttgaaggg cgagtgtgtg gagtcgctcc gcacatacct ggagataggg       600
     aaggagactc tgctaagaac agatcctccc aaggcacatg tgacccatca ccccagacct       660
     gaaggtgaag tcaccctgag gtgctgggcc ctgggcttct accctgctaa catcatcctg       720
     acctggcagt gggatgagga agacctgact caggacatgg acctcattga gaccagacct       780
     gcaggggatg ggaccttcca gaagtgggca tctgtggtgg taccttctgg agaggaacag       840
     agatacacat gtcatgtgca acatgagggg ctaacccagc cccttgttct aaaatgggac       900
     ccttctaagc acaccattcc catcatggga atcactgttg gcctgcttct ctttggagtt       960
     gtgtttactg gagctgtggt tgccatagtg atgaggaaga ggaaaggttt tcagataata      1020
     attctaaaaa cattcctgaa gggctgaacc caggaattct gctaggattt cccatcctgc      1080
     cgctctccca tctttttatt cccacagatg gaaaaggatg agttactcaa tctattctaa      1140
     aagctcactt ttcccatttt acttccctcc                                       1170
//