Dbfetch

ID   AB306895; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AB306895;
XX
DT   06-JUN-2007 (Rel. 92, Created)
DT   15-MAY-2012 (Rel. 112, Last updated, Version 3)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, partial cds, allele:
DE   B*07:58.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Inoko H., Kato S.;
RT   ;
RL   Submitted (01-JUN-2007) to the INSDC.
RL   Contact:Hidetoshi Inoko Tokai University School of Medicine, Basic Medical
RL   Science and Molecular Medicine; Bouseidai, Isehara, Kanagawa 259-1193,
RL   Japan
XX
RN   [2]
RA   Inoko H., Kato S.;
RT   "HLA-B new allele";
RL   Unpublished.
XX
DR   MD5; 97d26e23e5f1c93a2c8d484d373b415a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Kanagawa, Isehara,Bouseidai"
FT                   /clone="99415CB"
FT                   /cell_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /allele="B*07:58"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*07:58"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A5LIC1"
FT                   /protein_id="BAF63624.1"
FT                   /translation="PPKTHVTHHLISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
XX
SQ   Sequence 276 BP; 68 A; 82 C; 82 G; 44 T; 0 other;
     accccccaaa gacacacgtg acccaccacc tcatctctga ccatgaggcc accctgaggt        60
     gctgggccct gggtttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg       120
     accaaactca ggacactgag cttgtggaga ccagaccagc aggagataga accttccaga       180
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacatgc catgtacagc       240
     atgaggggct gccgaagccc ctcaccctga gatggg                                 276
//