spacer

EBI Dbfetch

ID   AB303948; SV 1; linear; genomic DNA; STD; HUM; 956 BP.
XX
AC   AB303948;
XX
DT   19-MAY-2007 (Rel. 91, Created)
DT   15-MAY-2012 (Rel. 112, Last updated, Version 3)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, partial cds, allele:
DE   B*48:18.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-956
RA   Inoko H., Kato S.;
RT   ;
RL   Submitted (16-MAY-2007) to the INSDC.
RL   Contact:Hidetoshi Inoko Tokai University School of Medicine, Basic Medical
RL   Science and Molecular Medicine; Bouseidai, Isehara, Kanagawa 259-1193,
RL   Japan
XX
RN   [2]
RA   Inoko H., Kato S.;
RT   "HLA-B new allele";
RL   Unpublished.
XX
DR   MD5; 410174f5cb52d7f122a8e06138709a7b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..956
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Kanagawa, Isehara"
FT                   /clone="2006032CB"
FT                   /cell_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<118..387,633..>908)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /allele="B*48:18"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A5A8M8"
FT                   /db_xref="IMGT/HLA:B*48:18"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A5A8M8"
FT                   /protein_id="BAF62538.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRIALRYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
XX
SQ   Sequence 956 BP; 168 A; 312 C; 346 G; 130 T; 0 other;
     gaggactact agtcatatgg attgggagga gcgaggggac cgcaggcggg ggcgcaggac        60
     ctgaggagcc gcgccgggag gagggtcggg cgggtctcag cccctcctca cccccaggct       120
     cccactccat gaggtatttc tacacctccg tgtcccggcc cggccgcggg gagccccgct       180
     tcatctcagt gggctacgtg gacgacaccc agttcgtgag gttcgacagc gacgccgcga       240
     gtccgagaga ggagccgcgg gcgccgtgga tagagcagga ggggccggag tattgggacc       300
     gggagacaca gatctccaag accaacacac agacttaccg agagagcctg cggatcgcgc       360
     tccgctacta caaccagagc gaggccggtg agtgaccccg gcccggggcg caggtcacga       420
     ctccccatcc cccacgtacg gcccgggtcg ccccgagtct ccgggtccga gatccgcctc       480
     cctgaggccg cgggacccgc ccagaccctc gaccggcgag agccccaggc gcgtttaccc       540
     ggtttcattt tcagttgagg ccaaaatccc cgcgggttgg tcggggcggg gcggggctcg       600
     ggggactggg ctgaccgcgg ggccggggcc agggtctcac accctccaga gcatgtacgg       660
     ctgcgacgtg gggccggacg ggcgcctcct ccgcgggcat aaccagtacg cctacgacgg       720
     caaggattac atcgccctga acgaggacct gcgctcctgg accgccgcgg acacggcggc       780
     tcagatctcc cagcgcaagt tggaggcggc ccgtgtggcg gagcagctga gagcctacct       840
     ggagggcgag tgcgtggagt ggctccgcag atacctggag aacgggaagg acaagctgga       900
     gcgcgctggt accaggggca gtggggagcc ttccccatct cctataggtc gccggg           956
//


spacer
spacer