Dbfetch

ID   AB303947; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AB303947;
XX
DT   19-MAY-2007 (Rel. 91, Created)
DT   15-MAY-2012 (Rel. 112, Last updated, Version 3)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, partial cds, allele:
DE   A*02:126.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Inoko H., Kato S.;
RT   ;
RL   Submitted (16-MAY-2007) to the INSDC.
RL   Contact:Hidetoshi Inoko Tokai University School of Medicine, Basic Medical
RL   Science and Molecular Medicine; Bouseidai, Isehara, Kanagawa 259-1193,
RL   Japan
XX
RN   [2]
RA   Inoko H., Kato S.;
RT   "HLA-A new allele";
RL   Unpublished.
XX
DR   MD5; b68e270935a90dd4f5a61be294906af0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Kanagawa, Isehara"
FT                   /clone="2001238DP"
FT                   /cell_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-A"
FT                   /allele="A*02:126"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*02:126"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A5A8M7"
FT                   /protein_id="BAF62537.1"
FT                   /translation="APKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLPKPLTLRW"
XX
SQ   Sequence 276 BP; 61 A; 83 C; 87 G; 45 T; 0 other;
     acgcccccaa aacgcatatg actcaccacg ctgtctctga ccatgaagcc accctgaggt        60
     gctgggccct gagcttctac cctgcggaga tcacactgac ctggcagcgg gatggggagg       120
     accagaccca ggacacggag ctcgtggaga ccaggcctgc aggggatgga accttccaga       180
     agtgggcggc tgtggtggtg ccttctggac aggagcagag atacacctgc catatgcagc       240
     atgagggttt gcccaagccc ctcaccctga gatggg                                 276
//