Dbfetch

ID   AB301477; SV 1; linear; genomic DNA; STD; HUM; 1007 BP.
XX
AC   AB301477;
XX
DT   21-APR-2007 (Rel. 91, Created)
DT   30-JUL-2013 (Rel. 117, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, partial cds, allele:
DE   B*54:13.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1007
RA   Kikkawa E.F., Kato S., Inoko H.;
RT   ;
RL   Submitted (19-APR-2007) to the INSDC.
RL   Contact:Eri F Kikkawa School of Medicine,Tokai Univ.; Bouseidai, Isehara,
RL   Kanagawa 259-1193, Japan
XX
RN   [2]
RA   Kato S., Inoko H.;
RT   "HLA-A new allele";
RL   Unpublished.
XX
DR   MD5; c2fe3d877044bbb99b76d7bb90a19b25.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1007
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Kanagawa,Isehara,Bouseidai"
FT                   /clone="20051539M/20051539seq"
FT                   /cell_type="Lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<157..426,672..>947)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /allele="B*54:13"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*54:13"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A4UYK5"
FT                   /protein_id="BAF56918.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPGFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
XX
SQ   Sequence 1007 BP; 168 A; 324 C; 383 G; 132 T; 0 other;
     gatttggccc tgaccgagac ctgggccggt gagtgcgggt cgggagggaa atggcctctg        60
     tggggaggag cgaggggacc gcaggcgggg gcgcaggacc cggggagccg cgccgggagg       120
     agggtctggc gggtctcagc ccctcctcgc ccccaggctc ccactccatg aggtatttct       180
     acaccgccat gtcccggccc ggccgcgggg agcccggctt catcgcagtg ggctacgtgg       240
     acgacacgca gttcgtgcgg ttcgacagcg acgccgcgag tccgagaggg gagccgcggg       300
     cgccgtgggt ggagcaggag gggccggagt attgggaccg gaacacacag atctacaagg       360
     cccaggcaca gactgaccga gagagcctgc ggaacctgcg cggctactac aaccagagcg       420
     aggccggtga gtgaccccgg cccggggcgc aggtcacgac tccccatccc ccacgtacgg       480
     cccgggtcgc cccgagtctc cgggtccgag atccgcctcc ctgaggccgc gggacccgcc       540
     cagaccctcg accggcgaga gccccaggcg cgtttacccg gtttcatttt cagttgaggc       600
     caaaatcccc gcgggttggt cggggcgggg cggggctcgg gggacggggc tgaccgcggg       660
     gccggggcca gggtctcaca cttggcagac gatgtatggc tgcgacctgg ggccggacgg       720
     gcgcctcctc cgcgggcata accagttagc ctacgacggc aaggattaca tcgccctgaa       780
     cgaggacctg agctcctgga ccgcggcgga caccgcggct cagatcaccc agcgcaagtg       840
     ggaggcggcc cgtgtggcgg agcagctgag agcctacctg gagggcacgt gcgtggagtg       900
     gctccgcaga tacctggaga acgggaagga gacgctgcag cgcgcgggta ccaggggcag       960
     tggggagcct tccccatctc ctataggtcg ccggggatgg cctccca                    1007
//