spacer

EBI Dbfetch

ID   AB292739; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AB292739;
XX
DT   11-MAR-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, partial cds, allele:
DE   HLA-B48/B40.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Maruya E., Saji H., Ogawa T., Futagami T., Ounuma T., Tujino T.,
RA   Hayashi K., Matushita M., Ochiai N., Maekawajiri S.;
RT   ;
RL   Submitted (08-FEB-2007) to the INSDC.
RL   Etsuko Maruya, NPO HLA Laboratory; 4F Ebisu-Bldg. Kawabata-Marutamachi,
RL   Sakyo-ku, Kyoto 606-8396, Japan (E-mail:maruya@mbox.kyoto-inet.or.jp,
RL   Tel:81-75-762-5201, Fax:81-75-762-5202)
XX
RN   [2]
RA   Maruya E., Saji H., Ogawa T., Futagami T., Ounuma T., Tujino T.,
RA   Hayashi K., Ochiai N., Akaza T., Matushita M., Maekawajiri S.;
RT   "Homo sapiens HLA-B gene for MHC class I antigen, partial cds, new allele:
RT   HLA-B48/B40";
RL   Unpublished.
XX
DR   MD5; 6f12851e328b6ad5f41c3a59ead8f537.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B48/B40"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A3KE32"
FT                   /db_xref="IMGT/HLA:B*48:17"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A3KE32"
FT                   /protein_id="BAF48660.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 646 BP; 111 A; 169 C; 188 G; 78 T; 100 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatctccca gcgcaagttg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggac aagctggagc gcgctg                      646
//


spacer
spacer