spacer

EBI Dbfetch

ID   AB274958; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AB274958;
XX
DT   21-SEP-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens HLA-Cw*0704V1 gene for MHC class I antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Kashiwase K., Ichihara T., Shimizu M., Satake M.;
RT   ;
RL   Submitted (19-SEP-2006) to the INSDC.
RL   Kouichi Kashiwase, Tokyo Red Cross Blood Center, Research; Tatsumi 2-1-67,
RL   Koto-ku, Tokyo 135-8639, Japan (E-mail:ko-kashiwase@tokyo.bc.jrc.or.jp,
RL   Tel:81-3-5534-7501, Fax:81-3-5534-7524)
XX
RN   [2]
RA   Kashiwase K., Ichihara T., Shimizu M., Satake M.;
RT   "HLA-Cw*0704V1";
RL   Unpublished.
XX
DR   MD5; 13676b2d1caf76e9f5be171d361a0a2c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*3101/3303,B*1501/1518,Cw*0704V1/1502,
FT                   DRB1*0802/-,TBC62255"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0704V1"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q0E9Q9"
FT                   /db_xref="IMGT/HLA:C*07:45"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q0E9Q9"
FT                   /protein_id="BAF32755.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTFQRMYGCDLGP
FT                   DGRLLRGYDQFAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQDRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 646 BP; 105 A; 172 C; 198 G; 71 T; 100 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccc cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cttccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagttcgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagttg       540
     gaggcggccc gtgcggcgga gcaggacaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer