Dbfetch

ID   AB274957; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AB274957;
XX
DT   21-SEP-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens HLA-Cw*0304V4 gene for MHC class I antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Kashiwase K., Ichihara T., Shimizu M., Satake M.;
RT   ;
RL   Submitted (19-SEP-2006) to the INSDC.
RL   Kouichi Kashiwase, Tokyo Red Cross Blood Center, Research; Tatsumi 2-1-67,
RL   Koto-ku, Tokyo 135-8639, Japan (E-mail:ko-kashiwase@tokyo.bc.jrc.or.jp,
RL   Tel:81-3-5534-7501, Fax:81-3-5534-7524)
XX
RN   [2]
RA   Kashiwase K., Ichihara T., Shimizu M., Satake M., Kuroda Y., Yamaguchi E.,
RA   Tokunaga K.;
RT   "HLA-Cw*0304V4";
RL   Unpublished.
XX
DR   MD5; 498ea275c71593e46523faa0c3a92380.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*2402/3303,B*4001/4403,Cw*0304V4/1403,
FT                   DRB1*0803/1302,TBC62026"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0304V4"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*03:34"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q0E9R0"
FT                   /protein_id="BAF32754.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGEC
FT                   VEWLRRYLKNGKETLQRA"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 646 BP; 108 A; 164 C; 201 G; 73 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggggagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtatggct gcgacgtggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggatctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctgaagaa tgggaaggag acgctgcagc gcgcgg                      646
//