Dbfetch

ID   AB249885; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AB249885;
XX
DT   11-FEB-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, partial cds,
DE   allele:A*2402V.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Maruya E., Matushita M., Nagata N., Saji H.;
RT   ;
RL   Submitted (09-FEB-2006) to the INSDC.
RL   Etsuko Maruya, HLA Laboratory, Research; 4F Ebisu-Bldg,
RL   Kawabata-Marutamachi, Sakyo, Kyoto, Kyoto 606-8396, Japan
RL   (E-mail:maruya@mbox.kyoto-inet.or.jp, Tel:81-75-762-5201,
RL   Fax:81-75-762-5202)
XX
RN   [2]
RA   Maruya E., Matushita M., Nagata N., Saji H., Ounuma T., Futagami T.,
RA   Maruya K., Akaza T.;
RT   "Homo sapiens HLA-A gene, allele:A*2402V";
RL   Unpublished.
XX
DR   MD5; 6260e6e505b6d22c7f5d486a250f4d2d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-A"
FT                   /allele="A*2402V"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*24:62"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q2HWF8"
FT                   /protein_id="BAE79443.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYQQDAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 646 BP; 111 A; 164 C; 196 G; 75 T; 100 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac cctccagatg atgtttggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtacca gcaggacgcc tacgacggca aggattacat cgccctgaaa       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg       540
     gaggcggccc atgtggcgga gcagcagaga gcctacctgg agggcacgtg cgtggacggg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//