spacer

EBI Dbfetch

ID   AB248283; SV 1; linear; genomic DNA; STD; HUM; 343 BP.
XX
AC   AB248283;
XX
DT   03-FEB-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds, allele:
DE   HLA-DRB1*0405V6.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-343
RA   Kashiwase K., Ichihara T., Shimizu M., Satake M.;
RT   ;
RL   Submitted (31-JAN-2006) to the INSDC.
RL   Kouichi Kashiwase, Tokyo Red Cross Blood Center, Research; Hiroo 4-1-31,
RL   Shibuya-ku, Tokyo 150-0012, Japan (E-mail:ko-kashiwase@tokyo.bc.jrc.or.jp,
RL   Tel:81-3-3406-1211, Fax:81-3-3406-7892)
XX
RN   [2]
RA   Kashiwase K., Ichihara T., Shimizu M., Satake M.;
RT   "HLA-DRB1*0405V6";
RL   Unpublished.
XX
DR   MD5; 524a2365f19812042958f5902756aba0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..343
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*1101/2601,B*3501/5101,Cw*0303/1402,
FT                   DRB1*0405V6/1501,TBC58426"
FT                   /db_xref="taxon:9606"
FT   intron          <1..34
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0405V6"
FT                   /number=1
FT   CDS             <35..>304
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0405V6"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q2L4U2"
FT                   /db_xref="IMGT/HLA:DRB1*04:57"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L4U2"
FT                   /protein_id="BAE78959.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPSAENWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            35..304
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0405V6"
FT                   /product="MHC class II antigen"
FT                   /number=2
FT   intron          305..>343
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0405V6"
FT                   /number=2
XX
SQ   Sequence 343 BP; 67 A; 90 C; 125 G; 61 T; 0 other;
     cgcttctgta accggatcgt tcttgtcccc ccagcacgtt tcttggagca ggttaaacat        60
     gagtgtcatt tcttcaacgg gacggagcgg gtgcggttcc tggacagata cttctatcac       120
     caagaggagt acgtgcgctt cgacagcgac gtgggggagt accgggcggt gacggagctg       180
     gggcggccta gcgccgagaa ctggaacagc cagaaggacc tcctggagca gaggcgggcc       240
     gcggtggaca cctactgcag acacaactac ggggttggtg agagcttcac agtgcagcgg       300
     cgaggtgagc gcggcgcggg gcggggcctg agtccctgtg agc                         343
//


spacer
spacer