spacer

EBI Dbfetch

ID   AB247517; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   AB247517;
XX
DT   25-JAN-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens HLA-DP gene for MHC class II antigen, partial CDS, allele:
DE   HLA-DPB1*8601V1.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   Kashiwase K., Ichihara T., Shimizu M., Satake M.;
RT   ;
RL   Submitted (20-JAN-2006) to the INSDC.
RL   Kouichi Kashiwase, Tokyo Red Cross Blood Center, Research; Hiroo 4-1-31,
RL   Shibuya-ku, Tokyo 150-0012, Japan (E-mail:ko-kashiwase@tokyo.bc.jrc.or.jp,
RL   Tel:81-3-3406-1211, Fax:81-3-3406-7892)
XX
RN   [2]
RA   Kashiwase K., Ichihara T., Shimizu M., Satake M.;
RT   "HLA-DPB1*8601V1";
RL   Unpublished.
XX
DR   MD5; 30694dc3f621a022083badaf5c750b9e.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*2402/-,B*5201/-,Cw*1202/-,DRB1*1502/-,
FT                   DPB1*0901/8601V1,TBCS197"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DP"
FT                   /allele="HLA-DPB1*8601V1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*113:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="BAE78492.1"
FT                   /translation="NYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRR"
XX
SQ   Sequence 264 BP; 62 A; 64 C; 98 G; 40 T; 0 other;
     agaattacgt gcaccagtta cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg atgaggagta ctggaacagc cagaaggaca       180
     tcctggagga ggagcgggca gtgccggaca ggatgtgcag acacaactac gagctgggcg       240
     ggcccatgac cctgcagcgc cgag                                              264
//


spacer
spacer