spacer

EBI Dbfetch

ID   AB234290; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AB234290;
XX
DT   18-NOV-2005 (Rel. 85, Created)
DT   30-JUL-2013 (Rel. 117, Last updated, Version 5)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, partial cds, allele:
DE   A*24:02:09.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Kato S., Inoko H., Kikkawa E.F.;
RT   ;
RL   Submitted (07-SEP-2005) to the INSDC.
RL   Contact:Eri F Kikkawa Division of Basic Molecular Science and Molecular
RL   Medicine, School of Medicine,Tokai Univ.; Bouseidai, Isehara, Kanagawa
RL   259-1193, Japan
XX
RN   [2]
RA   Kato S., Inoko H.;
RT   "HLA-A new allele";
RL   Unpublished.
XX
DR   MD5; 6c0f2b73a999f664aa7df68dffd09b97.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Kanagawa.Isehara,Bouseidai"
FT                   /clone="2004150JCBN"
FT                   /cell_type="Lymphocyte"
FT                   /db_xref="taxon:9606"
FT   exon            1..276
FT                   /gene="HLA-A"
FT                   /allele="A*24:02:09"
FT                   /number=3
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-A"
FT                   /allele="A*24:02:09A*24:02:09"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q2Z1W0"
FT                   /db_xref="IMGT/HLA:A*24:02:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Z1W0"
FT                   /protein_id="BAE48523.1"
FT                   /translation="SHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAA
FT                   DMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRT"
XX
SQ   Sequence 276 BP; 57 A; 81 C; 98 G; 40 T; 0 other;
     gttctcacac cctccagatg atgtttggct gcgacgtggg gtcggacggg cgcttcctcc        60
     gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa gaggacctgc       120
     gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg gaggcggccc       180
     atgtggcaga gcagcagaga gcctacctgg agggcacgtg cgtggacggg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcacgg                                 276
//


spacer
spacer