spacer

EBI Dbfetch

ID   AB213609; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB213609;
XX
DT   18-NOV-2005 (Rel. 85, Created)
DT   30-JUL-2013 (Rel. 117, Last updated, Version 5)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, partial cds, allele:
DE   A*66:05.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Kato S., Inoko H., Kikkawa E.F.;
RT   ;
RL   Submitted (17-MAY-2005) to the INSDC.
RL   Contact:Eri F Kikkawa Division of Basic Molecular Science and Molecular
RL   Medicine, School of Medicine, Tokai Univ; Bouseidai, Isehara, Kanagawa
RL   259-1193, Japan
XX
RN   [2]
RA   Kato S., Inoko H.;
RT   "HLA-A new alleles";
RL   Unpublished.
XX
DR   MD5; 21625ccc5cfc53d5524494dd2f6f43c1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Kanagawa"
FT                   /cell_line="Lymphocyte"
FT                   /note="A*2603,*6601"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-A"
FT                   /allele="A*66:05"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q2Z271"
FT                   /db_xref="IMGT/HLA:A*66:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Z271"
FT                   /protein_id="BAE48522.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTDRVDLGTLRGYYNQSED"
XX
SQ   Sequence 270 BP; 53 A; 85 C; 95 G; 37 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg                                        270
//


spacer
spacer