spacer

EBI Dbfetch

ID   AB212970; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AB212970;
XX
DT   11-JUN-2005 (Rel. 84, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-B52 gene for MHC class I antigen, exon 3, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Kinoshita T.;
RT   ;
RL   Submitted (10-MAY-2005) to the INSDC.
RL   Tomoko Kinoshita, Hyogo Prefectural Nishinomiya Hospital, Kidney
RL   Transplantation Center; Rokutanji-cho 13-9, Nishinomiya-city, Hyogo-ken,
RL   662-0918, Japan (E-mail:kennishihla@nifty.com, Tel:81-798-34-5151(ex.3270),
RL   Fax:81-798-36-3745)
XX
RN   [2]
RA   Kinoshita T.;
RT   "Nucleotide sequence of novel HLA-B52 exon3";
RL   Unpublished.
XX
DR   MD5; 5e939e732bba68653e2b2079a9a6eaa2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-B52"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q4R1E1"
FT                   /db_xref="IMGT/HLA:B*52:08"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q4R1E1"
FT                   /protein_id="BAD99584.1"
FT                   /translation="SHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAAREAEQLRAYLEGECVEWLRRHLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-B52"
FT                   /number=3
FT                   /note="novel HLA-B52 exon3"
XX
SQ   Sequence 276 BP; 56 A; 83 C; 103 G; 34 T; 0 other;
     ggtctcacac ttggcagacg atgtatggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagtacgcc tacgacggca aagattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagac       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer