Dbfetch

ID   AB212969; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB212969;
XX
DT   11-JUN-2005 (Rel. 84, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-B52 gene for MHC class I antigen, exon 2, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Kinoshita T.;
RT   ;
RL   Submitted (10-MAY-2005) to the INSDC.
RL   Tomoko Kinoshita, Hyogo Prefectural Nishinomiya Hospital, Kidney
RL   Transplantation Center; Rokutanji-cho 13-9, Nishinomiya-city, Hyogo-ken,
RL   662-0918, Japan (E-mail:kennishihla@nifty.com, Tel:81-798-34-5151(ex.3270),
RL   Fax:81-798-36-3745)
XX
RN   [2]
RA   Kinoshita T.;
RT   "Nucleotide sequence of novel HLA-B52 exon2";
RL   Unpublished.
XX
DR   MD5; cf0edc25dfb4dd1f46c3603e699471ec.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-B52"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*52:08"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q4R1E2"
FT                   /protein_id="BAD99583.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRIALRYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B52"
FT                   /number=2
FT                   /note="novel HLA-B52 exon2"
XX
SQ   Sequence 270 BP; 59 A; 89 C; 86 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//