spacer

EBI Dbfetch

ID   AB211231; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB211231;
XX
DT   16-APR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens gene for MHC class2 antigen, partial cds, allele:
DE   HLA-DQB1*060401V.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Watabe K., Hashimoto M.;
RT   ;
RL   Submitted (13-APR-2005) to the INSDC.
RL   Kiyoko Watabe, Kyoto Prefectural University of Medicine Hospital, Kidney
RL   Transplantation Center; 465 Kajii-cho Kawaramachi-Hirokoji Kamigyo-ku,
RL   Kyoto, Kyoto, 602-8566, Japan (E-mail:kwatabe@koto.kpu-m.ac.jp,
RL   Tel:81-75-251-5111(ex.5530), Fax:81-75-251-5529)
XX
RN   [2]
RA   Watabe K., Hashimoto M.;
RT   "Homo sapiens HLA-DQ gene for MHC class2 antigen,partial
RT   cds,allele:HLA-DQB1*060401V.";
RL   Unpublished.
XX
DR   MD5; ad200eaa9714c50c842f4263b6de6d9f.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*060401V"
FT                   /product="MHC class2 antigen"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*06:25"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="BAD95610.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAV
FT                   TPQGRPSAEYWNSQKEVLERTRAELDTVCRHNYEVGYRGILQRR"
XX
SQ   Sequence 270 BP; 62 A; 66 C; 100 G; 42 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtaac cagacacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtaccg ggcggtgacg ccgcaggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactacgagg       240
     tggggtaccg cgggatcctg cagaggagag                                        270
//


spacer
spacer